HHsearch alignment for GI: 254780476 and conserved domain: COG2197

>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].
Probab=99.85  E-value=6.1e-20  Score=135.32  Aligned_cols=116  Identities=33%  Similarity=0.500  Sum_probs=107.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCC-CEEE-EECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             78995399899999999999789-8999-988979999999827998999950412969599999998285768995999
Q gi|254780476|r    4 KVMIVEDNELNMKLFRDLIETSG-YIAL-QTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIA   81 (123)
Q Consensus         4 kiLiVDD~~~~~~~l~~~l~~~g-~~v~-~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~   81 (123)
T Consensus         2 ~vlivDDh~l~r~gl~~~L~~~~~~~vv~~a~~~~~~l~~~~~~~pdvvl~Dl~mP~~~G~e~~~~l~~--~~p~~~vvv   79 (211)
T COG2197           2 KVLIVDDHPLVREGLRQLLELEPDLEVVGEASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRA--RGPDIKVVV   79 (211)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHH--HCCCCEEEE
T ss_conf             499980977799999999986899669998278899999851379988998378899875999999998--689972999


Q ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             9924998999999976998899879898999999999740
Q gi|254780476|r   82 VTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG  121 (123)
Q Consensus        82 ~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~  121 (123)
T Consensus        80 lt~~~~~~~v~~~l~~Ga~gyl~K~~~~~~l~~ai~~v~~  119 (211)
T COG2197          80 LTAHDDPAYVIRALRAGADGYLLKDASPEELVEAIRAVAA  119 (211)
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             9677898999999977996998679999999999999975