HHsearch alignment for GI: 254780476 and conserved domain: COG3706

>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms].
Probab=99.92  E-value=1.9e-23  Score=155.52  Aligned_cols=121  Identities=21%  Similarity=0.453  Sum_probs=116.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             87789953998999999999997898999988979999999827998999950412969599999998285768995999
Q gi|254780476|r    2 LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIA   81 (123)
Q Consensus         2 ~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~   81 (123)
T Consensus       132 ~~kILvvdD~~~~~~~l~~~L~~~g~~v~~a~~~~~Al~~~~e~~~dlil~d~~mp~~dg~el~~~lr~~~~t~~ipii~  211 (435)
T COG3706         132 PKKILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLRQLERTRDIPIIL  211 (435)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCCEEE
T ss_conf             75089974807799999999875363366515989999997468985899955787667899999972444445663899


Q ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             99249989999999769988998798989999999997403
Q gi|254780476|r   82 VTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE  122 (123)
Q Consensus        82 ~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~~  122 (123)
T Consensus       212 ~~~~~d~~~~~~Af~~G~~Dyi~kPi~~~~l~~Rl~~~l~~  252 (435)
T COG3706         212 LSSKDDDELVVRAFELGVNDYITKPIEEGELRARLRRQLRR  252 (435)
T ss_pred             EECCCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHH
T ss_conf             95266347899999768851673477879999999999985