HHsearch alignment for GI: 254780476 and conserved domain: PRK00758

>PRK00758 GMP synthase subunit A; Validated.
Probab=92.31  E-value=0.39  Score=27.27  Aligned_cols=73  Identities=19%  Similarity=0.277  Sum_probs=50.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHH-HHHHHHHHCCCCCCCCEEEE
Q ss_conf             78995399899999999999789899998897999999982799899995041296959-99999982857689959999
Q gi|254780476|r    4 KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL-EITKQIKEDSELQEIPVIAV   82 (123)
Q Consensus         4 kiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~-el~~~ir~~~~~~~ipii~~   82 (123)
T Consensus         1 kIlviD~~dsft~ni~~~l~~~g~~v~v~~~~~~~~~-i~~-~~dgiilS~-GP~~~~~~~~~~~i~~----~~iPiLGI   73 (184)
T PRK00758          1 KILVINNGGQYNHLIHRTLRYLGVDAKIIPNTTPLEE-IKA-EPDGIILSG-GPEIERAGNCEEYLLE----LDVPILGI   73 (184)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHH-HHH-CCCEEEECC-CCCCCCCCCHHHHHHH----CCCCEEEE
T ss_conf             9999989863899999999978992899959898999-963-899899889-9983332206999986----59988997


Q ss_pred             E
Q ss_conf             9
Q gi|254780476|r   83 T   83 (123)
Q Consensus        83 t   83 (123)
T Consensus        74 C   74 (184)
T PRK00758         74 C   74 (184)
T ss_pred             E
T ss_conf             1