HHsearch alignment for GI: 254780476 and conserved domain: PRK05637

>PRK05637 anthranilate synthase component II; Provisional.
Probab=95.28  E-value=0.039  Score=33.01  Aligned_cols=78  Identities=18%  Similarity=0.324  Sum_probs=55.8

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEE--CCCCCHHHHHHHHHHCCCCCCCCE
Q ss_conf             877899539989999999999978989999889799999998279989999504--129695999999982857689959
Q gi|254780476|r    2 LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQ--LQEISGLEITKQIKEDSELQEIPV   79 (123)
Q Consensus         2 ~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~--mp~~dG~el~~~ir~~~~~~~ipi   79 (123)
T Consensus         1 M~~ILlIDnyDSFT~Nl~~~l~~~g~~v~V~rn~-~~~~~~~~~~pd~ivlSPGPg~P~d~g~-~~~~~~~~~--~~iPI   76 (208)
T PRK05637          1 MTHVVLIDNHDSFVYNLVDAFAVAGYKCTVFRNT-VPVETILAANPDLICLSPGPGYPADAGN-MMALIERTL--GQIPL   76 (208)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECC-CCHHHHHHCCCCEEEECCCCCCHHHCCC-HHHHHHHHH--CCCCE
T ss_conf             9779999488975999999998679907999699-9999998519995999999999577757-499999973--56982


Q ss_pred             EEEE
Q ss_conf             9999
Q gi|254780476|r   80 IAVT   83 (123)
Q Consensus        80 i~~t   83 (123)
T Consensus        77 LGIC   80 (208)
T PRK05637         77 LGIC   80 (208)
T ss_pred             EEHH
T ss_conf             2114