HHsearch alignment for GI: 254780476 and conserved domain: PRK09581

>PRK09581 pleD response regulator PleD; Reviewed.
Probab=100.00  E-value=4.2e-33  Score=210.95  Aligned_cols=120  Identities=28%  Similarity=0.553  Sum_probs=116.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEE
Q ss_conf             98778995399899999999999789899998897999999982799899995041296959999999828576899599
Q gi|254780476|r    1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVI   80 (123)
Q Consensus         1 m~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii   80 (123)
T Consensus         1 M~~rILiVdD~~~~~~~l~~~L~~~~y~v~~a~~G~eAL~~~~~~~PDLILlDi~MP~mdG~ev~r~Lk~~~~~~~iPVI   80 (457)
T PRK09581          1 MTARILVVDDIPANVKLLEAKLLAEYYTVLTASSGAEAIEICEREQPDIILLDVMMPGMDGFEVCRRLKSDPATAHIPVV   80 (457)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEE
T ss_conf             99719999498999999999998789999998999999999971899989992877999999999999659888998499


Q ss_pred             EEEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             9992499899999997699889987989899999999974
Q gi|254780476|r   81 AVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI  120 (123)
Q Consensus        81 ~~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l  120 (123)
T Consensus        81 vlTa~~d~e~~~~al~~GA~DYL~KP~~~~~L~~ri~~l~  120 (457)
T PRK09581         81 MVTALDDPSDRVRGLEAGADDFLTKPINDVALFARVKSLT  120 (457)
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             9978999999999986488789989999899999999999