HHsearch alignment for GI: 254780476 and conserved domain: PRK10060

>PRK10060 RNase II stability modulator; Provisional.
Probab=90.01  E-value=1.7  Score=23.65  Aligned_cols=110  Identities=18%  Similarity=0.285  Sum_probs=81.2

Q ss_pred             ECCCHHHHHHHHHHHHHCCCEEE--EECCHHHHHHHHHHCCCCEEEEEEECC-----CCCHHHHHHHHHHCCCCCCCCEE
Q ss_conf             53998999999999997898999--988979999999827998999950412-----96959999999828576899599
Q gi|254780476|r    8 VEDNELNMKLFRDLIETSGYIAL--QTRNGMEALELARQHKPDVIIMDIQLQ-----EISGLEITKQIKEDSELQEIPVI   80 (123)
Q Consensus         8 VDD~~~~~~~l~~~l~~~g~~v~--~a~~g~eal~~l~~~~~dlillD~~mp-----~~dG~el~~~ir~~~~~~~ipii   80 (123)
T Consensus       537 ~~d~~~~~~~-l~~Lr~lGv~iALDDFGTGySSLsyL~~lPvd~lKIDrsFV~~i~~d~~~~aIV~aIi~LA~~Lgl~vV  615 (663)
T PRK10060        537 IENEELALSV-IQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDIHKQPVSQSLVRAIVAVAQALNLQVI  615 (663)
T ss_pred             HCCHHHHHHH-HHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             2399999999-999997899899989999733699984289998999989971604892279999999999998699899


Q ss_pred             EEEECCCHHHHHHHHHCCCCE----EEECCCCHHHHHHHHHHH
Q ss_conf             999249989999999769988----998798989999999997
Q gi|254780476|r   81 AVTAFAMKGDEERIRKGGCEA----YISKPISLSIFMETIKKY  119 (123)
Q Consensus        81 ~~t~~~~~~~~~~~~~~g~~~----~l~KPi~~~~L~~~i~~~  119 (123)
T Consensus       616 A-EGVEt~eQ~~~L~~lGcd~~QGy~fsrPmPa~ef~~wL~~~  657 (663)
T PRK10060        616 A-EGVETAKEDAFLTKNGVNERQGFLFAKPMPAVAFERWYKRY  657 (663)
T ss_pred             E-ECCCHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             9-13864999999997599998267536089999999999974