HHsearch alignment for GI: 254780476 and conserved domain: PRK10710

>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional.
Probab=99.95  E-value=1.3e-27  Score=179.33  Aligned_cols=118  Identities=29%  Similarity=0.434  Sum_probs=112.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             87789953998999999999997898999988979999999827998999950412969599999998285768995999
Q gi|254780476|r    2 LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIA   81 (123)
Q Consensus         2 ~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~   81 (123)
T Consensus        10 ~~kILlVEDd~~l~~~l~~~L~~~g~~V~~a~~~~eal~~~~~~~~DliilDi~lp~~~Gl~l~~~lr~~~---~~piI~   86 (240)
T PRK10710         10 TPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDEVLPYVRQTPPDLILLDLMLPGTDGLTLCREIRRFS---DIPIVM   86 (240)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHCCC---CCCEEE
T ss_conf             88799992989999999999998899999989999999999737998999879998887763211221157---646899


Q ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             99249989999999769988998798989999999997403
Q gi|254780476|r   82 VTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE  122 (123)
Q Consensus        82 ~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~~  122 (123)
T Consensus        87 lta~~~~~~~~~al~~GAddYl~KPf~~~eLlari~~~lrr  127 (240)
T PRK10710         87 VTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRR  127 (240)
T ss_pred             ECCCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHH
T ss_conf             81678889999999869987600776538999999999845