HHsearch alignment for GI: 254780476 and conserved domain: PRK11107

>PRK11107 hybrid sensory histidine kinase BarA; Provisional.
Probab=100.00  E-value=4.8e-34  Score=216.34  Aligned_cols=120  Identities=34%  Similarity=0.527  Sum_probs=116.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             77899539989999999999978989999889799999998279989999504129695999999982857689959999
Q gi|254780476|r    3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAV   82 (123)
Q Consensus         3 kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~~   82 (123)
T Consensus       669 lrVLvVEDN~iN~~vi~~lL~~lG~~v~~A~nG~eAle~~~~~~fDLILMDiqMP~MDG~eATr~IR~~~~~~~~PIIAl  748 (920)
T PRK11107        669 LTVMAVDDNPANLKLIGALLEEQVEHVVLCDSGHQAVELAKQRPFDLIFMDIQMPGMDGIRACELIRQLPHNQNTPIIAV  748 (920)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             74999848899999999999984988999899999999974799978998899999989999999981867898959999


Q ss_pred             EECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             9249989999999769988998798989999999997403
Q gi|254780476|r   83 TAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE  122 (123)
Q Consensus        83 t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~~  122 (123)
T Consensus       749 TA~a~~~dre~cl~aGMddyLtKPI~~~~L~~~L~~~~~~  788 (920)
T PRK11107        749 TAHAMAGERERLLGAGMDDYLAKPIDEAALKQVLLRWKPG  788 (920)
T ss_pred             ECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHCCC
T ss_conf             7998989999999779993872879999999999986788