HHsearch alignment for GI: 254780476 and conserved domain: PRK11697

>PRK11697 putative two-component response-regulatory protein YehT; Provisional.
Probab=99.83  E-value=3.6e-19  Score=130.85  Aligned_cols=115  Identities=30%  Similarity=0.437  Sum_probs=99.4

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC-E-EEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCE
Q ss_conf             87789953998999999999997898-9-999889799999998279989999504129695999999982857689959
Q gi|254780476|r    2 LKKVMIVEDNELNMKLFRDLIETSGY-I-ALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPV   79 (123)
Q Consensus         2 ~kkiLiVDD~~~~~~~l~~~l~~~g~-~-v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipi   79 (123)
T Consensus         1 M~ki~I~DDe~~~~~~l~~~l~~~~~i~~~~~~~~~~eal~~~~~~~~DllfLDI~m~~~~G~ela~~l~~~---~~~~i   77 (239)
T PRK11697          1 MIKVLIVDDEPLAREELRELLQEEGDIEIVGECSNAIEALGAIHRLKPDVVFLDIQMPRISGLELVGMLDPE---HMPYI   77 (239)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHCCC---CCCEE
T ss_conf             949999969999999999999758798999998999999999985399999983998695999999983733---49869


Q ss_pred             EEEEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             999924998999999976998899879898999999999740
Q gi|254780476|r   80 IAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG  121 (123)
Q Consensus        80 i~~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~  121 (123)
T Consensus        78 IFvT~~--~e~a~~af~~~a~dYllKP~~~e~l~~~l~r~~~  117 (239)
T PRK11697         78 VFVTAF--DEYAIKAFEEHAFDYLLKPIDPARLAKTLARLRQ  117 (239)
T ss_pred             EEEECC--HHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             999586--8999999730972665389999999999999999