HHsearch alignment for GI: 254780476 and conserved domain: PRK13856

>PRK13856 two-component response regulator VirG; Provisional.
Probab=99.96  E-value=2.5e-27  Score=177.78  Aligned_cols=117  Identities=18%  Similarity=0.378  Sum_probs=110.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             87789953998999999999997898999988979999999827998999950412969599999998285768995999
Q gi|254780476|r    2 LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIA   81 (123)
Q Consensus         2 ~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~   81 (123)
T Consensus         1 M~~ILlVEDD~~l~~~l~~~L~~~g~~v~~a~~~~~~~~~l~~~~~DlvIlDi~lp~~~Gl~~~~~ir~~---~~~piii   77 (241)
T PRK13856          1 MKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVADSQQFNRVLSSETVDVVVVDLNLGREDGLEIVRSLATK---SDVPIII   77 (241)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHCCC---CCCCEEE
T ss_conf             9989999698999999999998779999998999999999865999999996999876613455564036---9973699


Q ss_pred             EEEC-CCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             9924-998999999976998899879898999999999740
Q gi|254780476|r   82 VTAF-AMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG  121 (123)
Q Consensus        82 ~t~~-~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~  121 (123)
T Consensus        78 lt~~~~~~~d~i~~l~~GADDYl~KPf~~~EL~aRi~~~lr  118 (241)
T PRK13856         78 ISGDRLEEADKVVALELGATDFIAKPFGTREFLARIRVALR  118 (241)
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             97267878999999876998899777677799999999987