>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism. It is phosphorylated by NtrB and interacts with sigma-54. One of the best studied examples is its activation of the gene glnA, which encodes the enzyme glutamine synthetase.. NtrC is composed of three domains , . The 124 residue N-terminal domain is homologous to receiver domains of other response regulator proteins in two-component signal transduction systems , . The 240 residue central domain of NtrC is homologous to a domain found in all activators of the sigma-54 RNA polymerase holoenzyme , . The C-terminal domain has been indicated to contain the determinants necessary for both DNA-binding and dimerization of full-length NtrC.; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0009399 nitrogen fixation, 0050906 detection of stimulus during sensory perception.

Probab=99.92 E-value=3.3e-24 Score=159.79 Aligned_cols=117 Identities=23% Similarity=0.383 Sum_probs=112.1 Q ss_pred EEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEE Q ss_conf 89953998999999999997898999988979999999827-99899995041296959999999828576899599999 Q gi|254780476|r 5 VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-KPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVT 83 (123) Q Consensus 5 iLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~-~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii~~t 83 (123) T Consensus 1 vwvvDDD~siR~VL~~AL~~~g~~v~~f~~A~~~l~~l~~~p~pD~~~tD~rMPg~~Gl~LL~~ik~~--~P~LPVIvM~ 78 (471) T TIGR01818 1 VWVVDDDRSIRWVLEKALSRAGIEVRTFDNAASVLRALAREPQPDLLITDVRMPGEDGLDLLKQIKKR--HPKLPVIVMT 78 (471) T ss_pred CEEEECCCHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHC--CCCCCEEEEC T ss_conf 95776471899999999966695453113189999998447999879861226882489999999850--8999779871 Q ss_pred ECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC Q ss_conf 2499899999997699889987989899999999974039 Q gi|254780476|r 84 AFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123 (123) Q Consensus 84 ~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~~a 123 (123) T Consensus 79 A~~dl~~Av~a~~~GAfEYLpKPFD~de~v~lv~RA~~~~ 118 (471) T TIGR01818 79 AHSDLDSAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHA 118 (471) T ss_pred CCHHHHHHHHHHHCCCHHCCCCCCCHHHHHHHHHHHHCCC T ss_conf 3067899999973583021769876688999999861030

HHsearch alignment for GI: 254780476 and conserved domain: TIGR01818