HHsearch alignment for GI: 254780476 and conserved domain: smart00448

>smart00448 REC cheY-homologous receiver domain. CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.
Probab=99.14  E-value=2.3e-10  Score=80.33  Aligned_cols=55  Identities=36%  Similarity=0.710  Sum_probs=53.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECC
Q ss_conf             7789953998999999999997898999988979999999827998999950412
Q gi|254780476|r    3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQ   57 (123)
Q Consensus         3 kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp   57 (123)
T Consensus         1 ~kVLivdD~~~~~~~l~~~l~~~g~~v~~~~~g~~~~~~~~~~~~dlil~D~~mP   55 (55)
T smart00448        1 MRILVVDDDPLLRELLKALLEREGYEVDEATDGEEALELLKEEKPDLILLDIMMP   55 (55)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             9899993799999999999997899999988999999999749999999967687