BLAST/PSIBLAST alignment of GI: 254780476 and GI: 260463924 at iteration 1
>gi|260463924|ref|ZP_05812120.1| response regulator receiver protein [Mesorhizobium opportunistum WSM2075] Length = 138
>gi|259030299|gb|EEW31579.1| response regulator receiver protein [Mesorhizobium opportunistum WSM2075] Length = 138
 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LARQH+PD+I+MDIQL E+S
Sbjct: 16  MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRNGLEALDLARQHRPDLILMDIQLPEVS 75

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 76  GLEVTKWLKEDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 135

Query: 121 GEA 123
           G+A
Sbjct: 136 GDA 138