BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780476|ref|YP_003064889.1| two component response
regulator [Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040153|gb|ACT56949.1| two component response regulator [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 123

 Score =  248 bits (632), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI
Sbjct: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120

Query: 121 GEA 123
           GEA
Sbjct: 121 GEA 123


>gi|315122068|ref|YP_004062557.1| two component response regulator [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495470|gb|ADR52069.1| two component response regulator [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 123

 Score =  230 bits (587), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 121/123 (98%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIETSGY+++QTR+G+EALE+ARQHKPD+IIMDIQL EIS
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIETSGYMSIQTRSGLEALEIARQHKPDIIIMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITKQIKED+ELQ+IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI
Sbjct: 61  GLEITKQIKEDNELQDIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120

Query: 121 GEA 123
           GEA
Sbjct: 121 GEA 123


>gi|222148303|ref|YP_002549260.1| two component response regulator [Agrobacterium vitis S4]
 gi|221735291|gb|ACM36254.1| two component response regulator [Agrobacterium vitis S4]
          Length = 123

 Score =  207 bits (528), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 97/123 (78%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  +QTRNGMEALELAR+H PD+I+MDIQL E+S
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIEASGYATIQTRNGMEALELARKHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+DSEL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKQDSELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFLETIKTYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|15965046|ref|NP_385399.1| putative 2-component receiver domain protein [Sinorhizobium
           meliloti 1021]
 gi|150396148|ref|YP_001326615.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|307301118|ref|ZP_07580887.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|307317851|ref|ZP_07597289.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|15074225|emb|CAC45872.1| DivK cell division response regulator, essential cell cycle
           regulator [Sinorhizobium meliloti 1021]
 gi|150027663|gb|ABR59780.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|306896613|gb|EFN27361.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306904073|gb|EFN34659.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 123

 Score =  205 bits (522), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEALELAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKQVMIVEDNELNMKLFRDLIEASGYATIQTRNGMEALELARKHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIETIKTYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|227821648|ref|YP_002825618.1| putative response regulator in two-component regulatory system
           [Sinorhizobium fredii NGR234]
 gi|227340647|gb|ACP24865.1| putative response regulator in two-component regulatory system
           [Sinorhizobium fredii NGR234]
          Length = 149

 Score =  204 bits (520), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEALELAR+H+PD+I+MDIQL E+S
Sbjct: 27  MPKQVMIVEDNELNMKLFRDLIEASGYATIQTRNGMEALELARKHRPDLILMDIQLPEVS 86

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 87  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIETIKTYL 146

Query: 121 GEA 123
           G+A
Sbjct: 147 GDA 149


>gi|86357266|ref|YP_469158.1| two-component response regulator protein [Rhizobium etli CFN 42]
 gi|116251495|ref|YP_767333.1| two-component response regulator transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|190891315|ref|YP_001977857.1| two-component response regulator protein [Rhizobium etli CIAT 652]
 gi|209548892|ref|YP_002280809.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|218460522|ref|ZP_03500613.1| response regulator receiver protein [Rhizobium etli Kim 5]
 gi|218663505|ref|ZP_03519435.1| response regulator receiver protein [Rhizobium etli IE4771]
 gi|218673591|ref|ZP_03523260.1| response regulator receiver protein [Rhizobium etli GR56]
 gi|241204116|ref|YP_002975212.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|4732057|gb|AAD28577.1|AF121341_1 putative response regulator CelR1 [Rhizobium leguminosarum]
 gi|86281368|gb|ABC90431.1| two-component response regulator protein [Rhizobium etli CFN 42]
 gi|115256143|emb|CAK07224.1| putative two-component response regulator transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|190696594|gb|ACE90679.1| two-component response regulator protein [Rhizobium etli CIAT 652]
 gi|209534648|gb|ACI54583.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|240858006|gb|ACS55673.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|327194837|gb|EGE61671.1| two-component response regulator protein [Rhizobium etli CNPAF512]
          Length = 123

 Score =  204 bits (520), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKQVMIVEDNELNMKLFRDLIEASGYTTIQTRNGMEALDLARKHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIETIKTYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|319783843|ref|YP_004143319.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169731|gb|ADV13269.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 123

 Score =  203 bits (517), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LARQH+PD+I+MDIQL E+S
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRNGLEALDLARQHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|222085607|ref|YP_002544137.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
 gi|221723055|gb|ACM26211.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
          Length = 133

 Score =  203 bits (517), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 11  MPKQVMIVEDNELNMKLFRDLIEASGYTTIQTRNGMEALDLARKHRPDLILMDIQLPEVS 70

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 71  GLEVTKWLKEDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIETIKTYL 130

Query: 121 GEA 123
           G+A
Sbjct: 131 GDA 133


>gi|260463924|ref|ZP_05812120.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030299|gb|EEW31579.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 138

 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LARQH+PD+I+MDIQL E+S
Sbjct: 16  MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRNGLEALDLARQHRPDLILMDIQLPEVS 75

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 76  GLEVTKWLKEDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 135

Query: 121 GEA 123
           G+A
Sbjct: 136 GDA 138


>gi|218678690|ref|ZP_03526587.1| response regulator receiver protein [Rhizobium etli CIAT 894]
          Length = 123

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEAL+LAR+++PD+I+MDIQL E+S
Sbjct: 1   MPKQVMIVEDNELNMKLFRDLIEASGYTTIQTRNGMEALDLARKYRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIETIKTYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|159184699|ref|NP_354304.2| two component response regulator [Agrobacterium tumefaciens str.
           C58]
 gi|325292658|ref|YP_004278522.1| two component response regulator [Agrobacterium sp. H13-3]
 gi|159139988|gb|AAK87089.2| two component response regulator [Agrobacterium tumefaciens str.
           C58]
 gi|325060511|gb|ADY64202.1| two component response regulator [Agrobacterium sp. H13-3]
          Length = 123

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKQVMIVEDNELNMKLFRDLIEASGYTTIQTRNGMEALDLARKHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+E IK Y+
Sbjct: 61  GLEVTKWLKEDDELHVIPVIAVTAFAMKGDEERIRQGGCEAYVSKPISVPKFIEIIKTYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|13471003|ref|NP_102572.1| response regulator [Mesorhizobium loti MAFF303099]
 gi|14021746|dbj|BAB48358.1| response regulator [Mesorhizobium loti MAFF303099]
          Length = 123

 Score =  201 bits (510), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRNGLEALDLARKHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|163759327|ref|ZP_02166413.1| putative two-component response regulator transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
 gi|162283731|gb|EDQ34016.1| putative two-component response regulator transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
          Length = 123

 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 92/123 (74%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGM+A++LARQH+PD+I+MDIQL E+S
Sbjct: 1   MTKQVMIVEDNELNMKLFRDLIEASGYKTVQTRNGMDAMDLARQHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK ++
Sbjct: 61  GLEVTKWLKQDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPKFIETIKSFL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|153010999|ref|YP_001372213.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
 gi|223635114|sp|A6X580|DIVK_OCHA4 RecName: Full=Polar-differentiation response regulator divK
 gi|151562887|gb|ABS16384.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 123

 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 93/123 (75%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKSVMIVEDNELNMKLFRDLIEASGYETIRTRNGLEALDLAREHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKDDDELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|110633700|ref|YP_673908.1| response regulator receiver protein [Mesorhizobium sp. BNC1]
 gi|110284684|gb|ABG62743.1| response regulator receiver protein [Chelativorans sp. BNC1]
          Length = 123

 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 93/123 (75%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDLIE SGY  ++TR+G++AL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRDGLQALDLARRHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKEDDELHSIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVQSFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|239833977|ref|ZP_04682305.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
 gi|239822040|gb|EEQ93609.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
          Length = 123

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 93/123 (75%), Positives = 111/123 (90%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE SGY  ++TRNG+EAL+LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MPKSVMIVEDNELNMKLFRDLIEASGYETIRTRNGLEALDLAREHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKDDDELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYM 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|148558108|ref|YP_001257598.1| polar differentiation response regulator [Brucella ovis ATCC 25840]
 gi|148369393|gb|ABQ62265.1| polar differentiation response regulator [Brucella ovis ATCC 25840]
          Length = 134

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/123 (74%), Positives = 110/123 (89%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE SGY  ++TR+G+EAL+LAR+H PD+I+MDIQL E+S
Sbjct: 12  MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVS 71

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 72  GLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 131

Query: 121 GEA 123
           G+A
Sbjct: 132 GDA 134


>gi|17989004|ref|NP_541637.1| two component response regulator [Brucella melitensis bv. 1 str.
           16M]
 gi|23500356|ref|NP_699796.1| polar differentiation response regulator [Brucella suis 1330]
 gi|62317532|ref|YP_223385.1| DivK, polar differentiation response regulator [Brucella abortus
           bv. 1 str. 9-941]
 gi|83269512|ref|YP_418803.1| response regulator receiver [Brucella melitensis biovar Abortus
           2308]
 gi|161620674|ref|YP_001594560.1| hypothetical protein BCAN_B0613 [Brucella canis ATCC 23365]
 gi|163844764|ref|YP_001622419.1| hypothetical protein BSUIS_B0609 [Brucella suis ATCC 23445]
 gi|189022787|ref|YP_001932528.1| Response regulator receiver [Brucella abortus S19]
 gi|225629102|ref|ZP_03787135.1| two component response regulator [Brucella ceti str. Cudo]
 gi|225686398|ref|YP_002734370.1| hypothetical protein BMEA_B0587 [Brucella melitensis ATCC 23457]
 gi|237817080|ref|ZP_04596072.1| two component response regulator [Brucella abortus str. 2308 A]
 gi|254691029|ref|ZP_05154283.1| polar differentiation response regulator [Brucella abortus bv. 6
           str. 870]
 gi|254695664|ref|ZP_05157492.1| polar differentiation response regulator [Brucella abortus bv. 3
           str. Tulya]
 gi|254698813|ref|ZP_05160641.1| polar differentiation response regulator [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254699848|ref|ZP_05161676.1| polar differentiation response regulator [Brucella suis bv. 5 str.
           513]
 gi|254702986|ref|ZP_05164814.1| polar differentiation response regulator [Brucella suis bv. 3 str.
           686]
 gi|254705892|ref|ZP_05167720.1| polar differentiation response regulator [Brucella pinnipedialis
           M163/99/10]
 gi|254711120|ref|ZP_05172931.1| polar differentiation response regulator [Brucella pinnipedialis
           B2/94]
 gi|254712421|ref|ZP_05174232.1| polar differentiation response regulator [Brucella ceti M644/93/1]
 gi|254715493|ref|ZP_05177304.1| polar differentiation response regulator [Brucella ceti M13/05/1]
 gi|254720403|ref|ZP_05182214.1| polar differentiation response regulator [Brucella sp. 83/13]
 gi|254732260|ref|ZP_05190838.1| polar differentiation response regulator [Brucella abortus bv. 4
           str. 292]
 gi|256015389|ref|YP_003105398.1| polar differentiation response regulator [Brucella microti CCM
           4915]
 gi|256029501|ref|ZP_05443115.1| polar differentiation response regulator [Brucella pinnipedialis
           M292/94/1]
 gi|256043508|ref|ZP_05446435.1| polar differentiation response regulator [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059196|ref|ZP_05449402.1| polar differentiation response regulator [Brucella neotomae 5K33]
 gi|256111465|ref|ZP_05452485.1| polar differentiation response regulator [Brucella melitensis bv. 3
           str. Ether]
 gi|256157696|ref|ZP_05455614.1| polar differentiation response regulator [Brucella ceti M490/95/1]
 gi|256253332|ref|ZP_05458868.1| polar differentiation response regulator [Brucella ceti B1/94]
 gi|256256214|ref|ZP_05461750.1| polar differentiation response regulator [Brucella abortus bv. 9
           str. C68]
 gi|256262462|ref|ZP_05464994.1| response regulator receiver [Brucella melitensis bv. 2 str. 63/9]
 gi|260167408|ref|ZP_05754219.1| polar differentiation response regulator [Brucella sp. F5/99]
 gi|260544768|ref|ZP_05820589.1| response regulator receiver [Brucella abortus NCTC 8038]
 gi|260564703|ref|ZP_05835188.1| response regulator receiver [Brucella melitensis bv. 1 str. 16M]
 gi|260568101|ref|ZP_05838570.1| response regulator receiver [Brucella suis bv. 4 str. 40]
 gi|260756625|ref|ZP_05868973.1| response regulator receiver protein [Brucella abortus bv. 6 str.
           870]
 gi|260760055|ref|ZP_05872403.1| response regulator receiver protein [Brucella abortus bv. 4 str.
           292]
 gi|260763294|ref|ZP_05875626.1| response regulator receiver protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882442|ref|ZP_05894056.1| response regulator DivK [Brucella abortus bv. 9 str. C68]
 gi|261216064|ref|ZP_05930345.1| response regulator receiver protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261217228|ref|ZP_05931509.1| response regulator DivK [Brucella ceti M13/05/1]
 gi|261220448|ref|ZP_05934729.1| response regulator DivK [Brucella ceti B1/94]
 gi|261313322|ref|ZP_05952519.1| response regulator DivK [Brucella pinnipedialis M163/99/10]
 gi|261318711|ref|ZP_05957908.1| response regulator DivK [Brucella pinnipedialis B2/94]
 gi|261320099|ref|ZP_05959296.1| response regulator DivK [Brucella ceti M644/93/1]
 gi|261323145|ref|ZP_05962342.1| response regulator DivK [Brucella neotomae 5K33]
 gi|261750321|ref|ZP_05994030.1| response regulator DivK [Brucella suis bv. 5 str. 513]
 gi|261753595|ref|ZP_05997304.1| response regulator DivK [Brucella suis bv. 3 str. 686]
 gi|261756818|ref|ZP_06000527.1| response regulator receiver [Brucella sp. F5/99]
 gi|265985421|ref|ZP_06098156.1| response regulator DivK [Brucella sp. 83/13]
 gi|265986509|ref|ZP_06099066.1| response regulator DivK [Brucella pinnipedialis M292/94/1]
 gi|265989926|ref|ZP_06102483.1| response regulator DivK [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992969|ref|ZP_06105526.1| response regulator DivK [Brucella melitensis bv. 3 str. Ether]
 gi|265996201|ref|ZP_06108758.1| response regulator DivK [Brucella ceti M490/95/1]
 gi|294853591|ref|ZP_06794263.1| two-component system protein [Brucella sp. NVSL 07-0026]
 gi|297249571|ref|ZP_06933272.1| polar-differentiation response regulator divK [Brucella abortus bv.
           5 str. B3196]
 gi|306839020|ref|ZP_07471841.1| response regulator receiver protein [Brucella sp. NF 2653]
 gi|306845945|ref|ZP_07478512.1| response regulator receiver protein [Brucella sp. BO1]
 gi|81320204|sp|Q7BBW0|DIVK_BRUAB RecName: Full=Polar-differentiation response regulator divK
 gi|81751298|sp|Q8FW53|DIVK_BRUSU RecName: Full=Polar-differentiation response regulator divK
 gi|81850387|sp|Q8YC73|DIVK_BRUME RecName: Full=Polar-differentiation response regulator divK
 gi|123545928|sp|Q2YKN1|DIVK_BRUA2 RecName: Full=Polar-differentiation response regulator divK
 gi|223635106|sp|B2SB45|DIVK_BRUA1 RecName: Full=Polar-differentiation response regulator divK
 gi|223635107|sp|A9MBQ2|DIVK_BRUC2 RecName: Full=Polar-differentiation response regulator divK
 gi|223635113|sp|A9WYT1|DIVK_BRUSI RecName: Full=Polar-differentiation response regulator divK
 gi|223635147|sp|A5VUU3|DIVK_BRUO2 RecName: Full=Polar-differentiation response regulator divK
 gi|19223931|gb|AAL86375.1|AF411569_1 response regulator DivK [Brucella abortus]
 gi|17984842|gb|AAL53901.1| two component response regulator [Brucella melitensis bv. 1 str.
           16M]
 gi|23463973|gb|AAN33801.1| polar differentiation response regulator [Brucella suis 1330]
 gi|62197725|gb|AAX76024.1| DivK, polar differentiation response regulator [Brucella abortus
           bv. 1 str. 9-941]
 gi|82939786|emb|CAJ12794.1| Response regulator receiver [Brucella melitensis biovar Abortus
           2308]
 gi|161337485|gb|ABX63789.1| Hypothetical protein BCAN_B0613 [Brucella canis ATCC 23365]
 gi|163675487|gb|ABY39597.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021361|gb|ACD74082.1| Response regulator receiver [Brucella abortus S19]
 gi|225615598|gb|EEH12647.1| two component response regulator [Brucella ceti str. Cudo]
 gi|225642503|gb|ACO02416.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237787893|gb|EEP62109.1| two component response regulator [Brucella abortus str. 2308 A]
 gi|255998049|gb|ACU49736.1| polar differentiation response regulator [Brucella microti CCM
           4915]
 gi|260098039|gb|EEW81913.1| response regulator receiver [Brucella abortus NCTC 8038]
 gi|260152346|gb|EEW87439.1| response regulator receiver [Brucella melitensis bv. 1 str. 16M]
 gi|260154766|gb|EEW89847.1| response regulator receiver [Brucella suis bv. 4 str. 40]
 gi|260670373|gb|EEX57313.1| response regulator receiver protein [Brucella abortus bv. 4 str.
           292]
 gi|260673715|gb|EEX60536.1| response regulator receiver protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676733|gb|EEX63554.1| response regulator receiver protein [Brucella abortus bv. 6 str.
           870]
 gi|260871970|gb|EEX79039.1| response regulator DivK [Brucella abortus bv. 9 str. C68]
 gi|260917671|gb|EEX84532.1| response regulator receiver protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260919032|gb|EEX85685.1| response regulator DivK [Brucella ceti B1/94]
 gi|260922317|gb|EEX88885.1| response regulator DivK [Brucella ceti M13/05/1]
 gi|261292789|gb|EEX96285.1| response regulator DivK [Brucella ceti M644/93/1]
 gi|261297934|gb|EEY01431.1| response regulator DivK [Brucella pinnipedialis B2/94]
 gi|261299125|gb|EEY02622.1| response regulator DivK [Brucella neotomae 5K33]
 gi|261302348|gb|EEY05845.1| response regulator DivK [Brucella pinnipedialis M163/99/10]
 gi|261736802|gb|EEY24798.1| response regulator receiver [Brucella sp. F5/99]
 gi|261740074|gb|EEY28000.1| response regulator DivK [Brucella suis bv. 5 str. 513]
 gi|261743348|gb|EEY31274.1| response regulator DivK [Brucella suis bv. 3 str. 686]
 gi|262550498|gb|EEZ06659.1| response regulator DivK [Brucella ceti M490/95/1]
 gi|262763839|gb|EEZ09871.1| response regulator DivK [Brucella melitensis bv. 3 str. Ether]
 gi|263000595|gb|EEZ13285.1| response regulator DivK [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092198|gb|EEZ16495.1| response regulator receiver [Brucella melitensis bv. 2 str. 63/9]
 gi|264658706|gb|EEZ28967.1| response regulator DivK [Brucella pinnipedialis M292/94/1]
 gi|264664013|gb|EEZ34274.1| response regulator DivK [Brucella sp. 83/13]
 gi|294819246|gb|EFG36246.1| two-component system protein [Brucella sp. NVSL 07-0026]
 gi|297173440|gb|EFH32804.1| polar-differentiation response regulator divK [Brucella abortus bv.
           5 str. B3196]
 gi|306273580|gb|EFM55425.1| response regulator receiver protein [Brucella sp. BO1]
 gi|306405926|gb|EFM62184.1| response regulator receiver protein [Brucella sp. NF 2653]
          Length = 123

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 92/123 (74%), Positives = 110/123 (89%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE SGY  ++TR+G+EAL+LAR+H PD+I+MDIQL E+S
Sbjct: 1   MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|307946430|ref|ZP_07661765.1| response regulator receiver protein [Roseibium sp. TrichSKD4]
 gi|307770094|gb|EFO29320.1| response regulator receiver protein [Roseibium sp. TrichSKD4]
          Length = 125

 Score =  196 bits (499), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/122 (74%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  LQTR G+EAL+LARQHKPD+I+MDIQL E+S
Sbjct: 1   MSKTVLIVEDNELNMKLFHDLLEAHGYSTLQTRTGIEALDLARQHKPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS++ F+ET++ YI
Sbjct: 61  GLEVTKWIKEDEDLASIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVARFLETVRSYI 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|6513589|gb|AAF14690.1|AF051940_1 response regulator [Brucella abortus]
          Length = 123

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/123 (73%), Positives = 109/123 (88%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE SGY  ++TR+G+EAL+LAR+H PD+I+MDIQL E+S
Sbjct: 1   MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL+ IPVIAVTAFAMKGDE RIR+GGCEAYISKPIS+  F+ETIK Y+
Sbjct: 61  GLEVTKWLKDDEELRHIPVIAVTAFAMKGDERRIRQGGCEAYISKPISVPRFIETIKSYL 120

Query: 121 GEA 123
           G+A
Sbjct: 121 GDA 123


>gi|118590176|ref|ZP_01547579.1| Response regulator receiver [Stappia aggregata IAM 12614]
 gi|118437148|gb|EAV43786.1| Response regulator receiver [Stappia aggregata IAM 12614]
          Length = 123

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  LQTR G+EAL+LAR+H PD+I+MDIQL E+S
Sbjct: 1   MAKSVLIVEDNELNMKLFHDLLEAHGYNTLQTRTGIEALQLAREHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED ++  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS++ F+ET++ Y+
Sbjct: 61  GLEVTKWIKEDEDIASIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVAKFLETVRAYL 120

Query: 121 GEA 123
           GEA
Sbjct: 121 GEA 123


>gi|90419567|ref|ZP_01227477.1| response regulator [Aurantimonas manganoxydans SI85-9A1]
 gi|90336504|gb|EAS50245.1| response regulator [Aurantimonas manganoxydans SI85-9A1]
          Length = 126

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 109/123 (88%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDL+E  GY  +QTR+G+ A ELAR+H+PD+I+MDIQL EIS
Sbjct: 4   MAKTVMIVEDNELNMKLFRDLVEAHGYRTVQTRSGLTATELAREHRPDLILMDIQLPEIS 63

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+Q+KED EL  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS++ F+ETI+ ++
Sbjct: 64  GLDVTRQLKEDPELFRIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVTKFIETIRSFL 123

Query: 121 GEA 123
           G+A
Sbjct: 124 GDA 126


>gi|328543460|ref|YP_004303569.1| chemotaxis protein CheY [polymorphum gilvum SL003B-26A1]
 gi|326413204|gb|ADZ70267.1| CheY-like receiver [Polymorphum gilvum SL003B-26A1]
          Length = 123

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  LQTR G+EALELAR H+PD+I+MDIQL E+S
Sbjct: 1   MAKTVLIVEDNELNMKLFHDLLEAHGYNTLQTRTGIEALELARAHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED +L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS++ F+ET++ Y+
Sbjct: 61  GLEVTKWIKEDDDLCTIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVAKFLETVRSYL 120

Query: 121 GEA 123
           GE 
Sbjct: 121 GEG 123


>gi|326410769|gb|ADZ67833.1| Response regulator receiver [Brucella melitensis M28]
 gi|326554061|gb|ADZ88700.1| Response regulator receiver [Brucella melitensis M5-90]
          Length = 118

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (90%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           MIVEDNELNMKLFRDLIE SGY  ++TR+G+EAL+LAR+H PD+I+MDIQL E+SGLE+T
Sbjct: 1   MIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVT 60

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           K +K+D EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+G+A
Sbjct: 61  KWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYLGDA 118


>gi|254474205|ref|ZP_05087596.1| two component response regulator [Pseudovibrio sp. JE062]
 gi|211956735|gb|EEA91944.1| two component response regulator [Pseudovibrio sp. JE062]
          Length = 123

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  LQ+RNGMEALELAR HKPD+I+MDIQL E+S
Sbjct: 1   MQKTVLIVEDNELNMKLFNDLLEAHGYATLQSRNGMEALELARAHKPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED EL+ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ET+  ++
Sbjct: 61  GLEVTKWIKEDDELKIIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVGNFLETVSGFL 120


>gi|220927156|ref|YP_002502458.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
 gi|219951763|gb|ACL62155.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
          Length = 126

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  L+T NG+EA+ELARQH+PD+I+MDIQL E+S
Sbjct: 1   MTKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARQHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED EL+ IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T++ Y+
Sbjct: 61  GLEVTKWIKEDDELKSIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRTYL 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|158423478|ref|YP_001524770.1| response regulator receiver [Azorhizobium caulinodans ORS 571]
 gi|158330367|dbj|BAF87852.1| response regulator receiver [Azorhizobium caulinodans ORS 571]
          Length = 149

 Score =  191 bits (484), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 107/121 (88%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLF DL+E  GY  ++TRNG+EA++LARQH+PD+I+MDIQL E+S
Sbjct: 28  MAKTVMIVEDNELNMKLFHDLLEAHGYHTVETRNGIEAMDLARQHRPDLILMDIQLPEVS 87

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K D+EL+ IPV+AVTAFAMKGDEERIR GGCEAY+SKPIS++ F+ET++++ 
Sbjct: 88  GLEVTKWLKADAELKAIPVVAVTAFAMKGDEERIRAGGCEAYLSKPISVAKFLETVRRFA 147

Query: 121 G 121
           G
Sbjct: 148 G 148


>gi|170744710|ref|YP_001773365.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168198984|gb|ACA20931.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 126

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  L+T NG+EA+ELAR+H+PD+I+MDIQL E+S
Sbjct: 1   MTKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARRHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED EL+ IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T++ Y+
Sbjct: 61  GLEVTKWIKEDDELKSIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRTYL 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|300022156|ref|YP_003754767.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523977|gb|ADJ22446.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 144

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (85%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V+IVEDNELNMKLF DL+   GY  +QTRNG EALELAR+H+PD+I+MDIQL E+SGL
Sbjct: 22  QSVLIVEDNELNMKLFNDLLAAHGYKTIQTRNGFEALELARKHRPDLILMDIQLPEVSGL 81

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+TK +K+D EL  IPV+AVTAFAMKGDEERIR GGCEAY+SKPIS+  F+ET++K+IG 
Sbjct: 82  EVTKWLKDDDELCRIPVVAVTAFAMKGDEERIRSGGCEAYVSKPISVMTFLETVRKFIGP 141

Query: 123 A 123
           +
Sbjct: 142 S 142


>gi|114707397|ref|ZP_01440294.1| Response regulator receiver [Fulvimarina pelagi HTCC2506]
 gi|114537278|gb|EAU40405.1| Response regulator receiver [Fulvimarina pelagi HTCC2506]
          Length = 123

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 87/123 (70%), Positives = 107/123 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLFRDLIE  GY  ++T +G+ A++LAR+H+PD+I+MDIQL EIS
Sbjct: 1   MAKTVMIVEDNELNMKLFRDLIEAYGYETIRTSSGLNAVDLARKHRPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+Q+K D ELQ IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETI+ ++
Sbjct: 61  GLDVTRQLKADPELQRIPVIAVTAFAMKGDEERIREGGCEAYISKPISVPKFIETIRSFL 120

Query: 121 GEA 123
           GE 
Sbjct: 121 GEG 123


>gi|329889206|ref|ZP_08267549.1| response regulator [Brevundimonas diminuta ATCC 11568]
 gi|328844507|gb|EGF94071.1| response regulator [Brevundimonas diminuta ATCC 11568]
          Length = 125

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 108/123 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+++ GY  LQTR G++AL +AR+H+PD+I+MDIQL EIS
Sbjct: 1   MSKKVLIVEDNELNMKLFHDLLDSQGYEVLQTREGLQALAIAREHRPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ET+++++
Sbjct: 61  GLEVTKWLKDDEELNHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVISFLETVRRHL 120

Query: 121 GEA 123
           G+ 
Sbjct: 121 GQG 123


>gi|315500125|ref|YP_004088928.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
 gi|315418137|gb|ADU14777.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
          Length = 122

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 104/119 (87%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IVEDNELNMKLF DL++  GY  LQT  G+ AL LAR+H+PD+I+MDIQL EISGL
Sbjct: 4   KKVLIVEDNELNMKLFHDLLDAQGYETLQTGEGLSALSLARKHRPDLILMDIQLPEISGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+TK +KED EL  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+S F++T+++Y+G
Sbjct: 64  EVTKWLKEDDELSHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVSHFLDTVRRYLG 122


>gi|254418761|ref|ZP_05032485.1| hypothetical protein BBAL3_1071 [Brevundimonas sp. BAL3]
 gi|196184938|gb|EDX79914.1| hypothetical protein BBAL3_1071 [Brevundimonas sp. BAL3]
          Length = 122

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 87/121 (71%), Positives = 105/121 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+++ GY  LQTR G++AL LAR H PD+I+MDIQL EIS
Sbjct: 2   MSKKVLIVEDNELNMKLFHDLLDSQGYETLQTREGLQALALARAHHPDLILMDIQLPEIS 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETI++++
Sbjct: 62  GLEVTKWLKDDEELNHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVMHFLETIRQHL 121

Query: 121 G 121
           G
Sbjct: 122 G 122


>gi|304391594|ref|ZP_07373536.1| response regulator [Ahrensia sp. R2A130]
 gi|303295823|gb|EFL90181.1| response regulator [Ahrensia sp. R2A130]
          Length = 126

 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 103/123 (83%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLF DL+E  GY  +QT NG+ AL+LAR+H PD+I+MDIQL E+S
Sbjct: 1   MAKKVMIVEDNELNMKLFNDLLEAQGYETIQTSNGLSALDLARKHYPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED  L  IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+E +K Y+
Sbjct: 61  GLEVTKWLKEDDSLARIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVMRFIELVKTYL 120

Query: 121 GEA 123
           GE 
Sbjct: 121 GEG 123


>gi|329851381|ref|ZP_08266138.1| response regulator [Asticcacaulis biprosthecum C19]
 gi|328840227|gb|EGF89799.1| response regulator [Asticcacaulis biprosthecum C19]
          Length = 122

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (86%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IVEDNELNMKLF DL++  GY   QT  G+ AL LARQH+PD+I+MDIQL EISGL
Sbjct: 4   KKVLIVEDNELNMKLFHDLLDAQGYETFQTGEGLSALTLARQHRPDLILMDIQLPEISGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+TK +KED EL  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS++ F++T++KY+G
Sbjct: 64  EVTKWLKEDDELSHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVTHFLDTVRKYLG 122


>gi|312115580|ref|YP_004013176.1| response regulator receiver protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220709|gb|ADP72077.1| response regulator receiver protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 125

 Score =  187 bits (475), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 106/120 (88%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++IVEDNELNMKLF DL+E  GY  LQTRNG++A+ LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MGKTILIVEDNELNMKLFHDLLEAHGYTTLQTRNGIDAIALARKHRPDLIVMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++TK +KED  L+ IP++AVTAFAMKGDEERIR+GGCEAY+SKPIS+S F+ETI+++I
Sbjct: 61  GLDVTKWLKEDDSLRHIPIVAVTAFAMKGDEERIREGGCEAYVSKPISVSRFLETIRQFI 120


>gi|254504929|ref|ZP_05117080.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222441000|gb|EEE47679.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 123

 Score =  186 bits (473), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 106/122 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  G+  LQTR G+EAL+LAR+++PD+I+MDIQL E+S
Sbjct: 1   MAKTVLIVEDNELNMKLFHDLLEAHGFDTLQTRTGIEALKLARENRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED  +  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+S F++T+K ++
Sbjct: 61  GLEVTKWIKEDESIASIPVVAVTAFAMKGDEERIRQGGCEAYISKPISVSKFLDTVKSFL 120

Query: 121 GE 122
           GE
Sbjct: 121 GE 122


>gi|167645461|ref|YP_001683124.1| response regulator receiver protein [Caulobacter sp. K31]
 gi|167347891|gb|ABZ70626.1| response regulator receiver protein [Caulobacter sp. K31]
          Length = 127

 Score =  186 bits (473), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 85/120 (70%), Positives = 105/120 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  LQTR G++AL +AR+H+PD+I+MDIQL EIS
Sbjct: 6   MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLQALSIAREHRPDLILMDIQLPEIS 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+S F++TI++ +
Sbjct: 66  GLEVTKWLKEDDDLSHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVSHFLDTIRRLL 125


>gi|163850399|ref|YP_001638442.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|188580174|ref|YP_001923619.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|240137476|ref|YP_002961947.1| putative response regulator receiver [Methylobacterium extorquens
           AM1]
 gi|254559653|ref|YP_003066748.1| response regulator receiver [Methylobacterium extorquens DM4]
 gi|163662004|gb|ABY29371.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|179343672|gb|ACB79084.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|240007444|gb|ACS38670.1| putative response regulator receiver [Methylobacterium extorquens
           AM1]
 gi|254266931|emb|CAX22730.1| putative response regulator receiver [Methylobacterium extorquens
           DM4]
          Length = 126

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 106/122 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  L+T NG+EA+ELAR H PD+I+MDIQL E+S
Sbjct: 1   MKKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARAHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D +L+ IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T+++YI
Sbjct: 61  GLEVTKWLKDDDDLRNIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRRYI 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|182678197|ref|YP_001832343.1| response regulator receiver protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634080|gb|ACB94854.1| response regulator receiver protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 123

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++IVEDNELNMKLF DL+E  GY  +QTRNG+EA++LAR HKPD+I+MDIQL E+S
Sbjct: 1   MQKKILIVEDNELNMKLFNDLLEAHGYKTVQTRNGVEAVQLARDHKPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ +KED +L+ IPVIA+TAFAMKGDEE+IR+GGCEAY+SKPIS+  F+ET++ Y+
Sbjct: 61  GLQVTQWLKEDDDLRHIPVIAITAFAMKGDEEKIRQGGCEAYLSKPISVVKFLETVRNYL 120

Query: 121 GE 122
            E
Sbjct: 121 AE 122


>gi|46203763|ref|ZP_00051012.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 126

 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  L+T NG+EA+ELAR H P++I+MDIQL E+S
Sbjct: 1   MKKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARAHHPNLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D +L++IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T++KYI
Sbjct: 61  GLEVTKWLKDDDDLRDIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRKYI 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|299135154|ref|ZP_07028345.1| response regulator receiver protein [Afipia sp. 1NLS2]
 gi|298590131|gb|EFI50335.1| response regulator receiver protein [Afipia sp. 1NLS2]
          Length = 121

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 105/121 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY  + T NG EAL LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTVGTSNGREALRLAREHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D+EL+  PV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET+++++
Sbjct: 61  GLEVTRWIKDDAELRATPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFV 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|197104775|ref|YP_002130152.1| polar differentiation response regulator [Phenylobacterium zucineum
           HLK1]
 gi|196478195|gb|ACG77723.1| polar differentiation response regulator [Phenylobacterium zucineum
           HLK1]
          Length = 121

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 105/120 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  ++TR G+ AL LAR+H+PD+I+MDIQL EIS
Sbjct: 1   MAKKVLIVEDNELNMKLFHDLLEAQGYEIIETREGLAALSLAREHRPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL +IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+S F+ETI++ +
Sbjct: 61  GLEVTKWLKEDDELAKIPVVAVTAFAMKGDEERIREGGCEAYISKPISVSHFLETIRRLL 120


>gi|209884910|ref|YP_002288767.1| cell division response regulator DivK [Oligotropha carboxidovorans
           OM5]
 gi|209873106|gb|ACI92902.1| cell division response regulator DivK [Oligotropha carboxidovorans
           OM5]
          Length = 121

 Score =  184 bits (468), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 105/121 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY  + T NG EAL LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTVGTSNGREALRLAREHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D+EL+  P++AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET+++++
Sbjct: 61  GLEVTRWIKDDAELRATPIVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFV 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|154247782|ref|YP_001418740.1| response regulator receiver protein [Xanthobacter autotrophicus
           Py2]
 gi|154161867|gb|ABS69083.1| response regulator receiver protein [Xanthobacter autotrophicus
           Py2]
          Length = 124

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 106/121 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K VMIVEDNELNMKLF DL+E  GY  ++TR+G+EA+ELAR H+PD+IIMDIQL EIS
Sbjct: 3   MAKTVMIVEDNELNMKLFHDLLEAHGYRTVETRSGVEAVELARAHRPDLIIMDIQLPEIS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+++K D EL+ IPV+AVTAFAMKGDEERIR GGCEAY+SKPIS++ F++T++++ 
Sbjct: 63  GLDVTRKLKADPELKAIPVVAVTAFAMKGDEERIRAGGCEAYLSKPISVAKFLQTVRQFA 122

Query: 121 G 121
           G
Sbjct: 123 G 123


>gi|302383483|ref|YP_003819306.1| response regulator receiver protein [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194111|gb|ADL01683.1| response regulator receiver protein [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 127

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 105/121 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+++ GY   QTR G++A+ LARQ+ PD+I+MDIQL EIS
Sbjct: 1   MSKKVLIVEDNELNMKLFHDLLDSQGYQTFQTREGLQAMALARQYMPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D EL  IP+IAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ET++K++
Sbjct: 61  GLEVTKWLKDDEELAHIPIIAVTAFAMKGDEERIRQGGCEAYISKPISVMPFLETVRKHL 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|218528959|ref|YP_002419775.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|218521262|gb|ACK81847.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
          Length = 126

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 106/122 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  L+T NG+EA+ELAR H P++I+MDIQL E+S
Sbjct: 1   MKKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARAHHPELILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D +L+ IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T+++YI
Sbjct: 61  GLEVTKWLKDDDDLRNIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRRYI 120

Query: 121 GE 122
           G+
Sbjct: 121 GD 122


>gi|154253255|ref|YP_001414079.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157205|gb|ABS64422.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 124

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 107/120 (89%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL++  GY  LQTR+G+EALE+AR ++PD+I+MDIQL E+S
Sbjct: 4   MSKKVLIVEDNELNMKLFHDLLDAHGYETLQTRDGIEALEIARTNRPDLILMDIQLPEVS 63

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IKED  L+ IPV+AVTAFAMKGDEE+IR+GGCEAYISKPIS++ F+ET+++++
Sbjct: 64  GLEVTKWIKEDDSLRSIPVVAVTAFAMKGDEEKIREGGCEAYISKPISVTQFLETVQRFL 123


>gi|295690170|ref|YP_003593863.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
 gi|295432073|gb|ADG11245.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
          Length = 125

 Score =  183 bits (464), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 102/120 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR +KPD+I+MDIQL EIS
Sbjct: 1   MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARDNKPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED EL  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 61  GLEVTKWLKEDEELAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 120


>gi|16126702|ref|NP_421266.1| polar differentiation response regulator [Caulobacter crescentus
           CB15]
 gi|13424012|gb|AAK24434.1| polar differentiation response regulator [Caulobacter crescentus
           CB15]
          Length = 130

 Score =  182 bits (463), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 103/120 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR++KPD+I+MDIQL EIS
Sbjct: 6   MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEIS 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 66  GLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 125


>gi|221235483|ref|YP_002517920.1| response regulator receiver protein divK [Caulobacter crescentus
           NA1000]
 gi|1086465|gb|AAA82214.1| cell division response regulator DivK [Caulobacter crescentus CB15]
 gi|220964656|gb|ACL96012.1| response regulator receiver protein divK [Caulobacter crescentus
           NA1000]
          Length = 125

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 103/120 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR++KPD+I+MDIQL EIS
Sbjct: 1   MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 61  GLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 120


>gi|288958710|ref|YP_003449051.1| two-component response regulator [Azospirillum sp. B510]
 gi|288911018|dbj|BAI72507.1| two-component response regulator [Azospirillum sp. B510]
          Length = 135

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 104/119 (87%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V+IVEDNELNMKLF DL+E  GY  LQTR G+EA+ LAR+H+PD+I+MDIQL E+SGL
Sbjct: 17  KTVLIVEDNELNMKLFHDLLEAHGYGTLQTREGVEAMRLAREHRPDLILMDIQLPEVSGL 76

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+T+ IK+D EL+ IPV+AVTAFAMKGDEE+IR+GGCE Y++KPIS+  F+ET+KK++G
Sbjct: 77  EVTRWIKDDPELKSIPVVAVTAFAMKGDEEKIRQGGCEDYVAKPISVVKFLETVKKFLG 135


>gi|209964835|ref|YP_002297750.1| cell division response regulator protein DivK [Rhodospirillum
           centenum SW]
 gi|209958301|gb|ACI98937.1| cell division response regulator protein DivK [Rhodospirillum
           centenum SW]
          Length = 143

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 106/119 (89%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V++VEDNELNMKLF DL+E  GY  LQT++GMEAL LARQH+PD+I+MDIQL E+SGL
Sbjct: 25  KLVLVVEDNELNMKLFHDLLEAHGYATLQTKDGMEALRLARQHRPDLILMDIQLPEVSGL 84

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+TK +KED +L+ IPV+AVTAFAMKGDEE+IR+GGCE YI+KPIS++ F++T+++++G
Sbjct: 85  EVTKWLKEDDDLRGIPVVAVTAFAMKGDEEKIREGGCEDYIAKPISVARFIQTVQRFLG 143


>gi|298291496|ref|YP_003693435.1| response regulator receiver protein [Starkeya novella DSM 506]
 gi|296928007|gb|ADH88816.1| response regulator receiver protein [Starkeya novella DSM 506]
          Length = 123

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 107/123 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E  GY  + TR+G+EA++LAR+H+PD+I+MDIQL E+S
Sbjct: 1   MSKTVLIVEDNELNMKLFNDLLEAHGYSTVGTRSGVEAMDLARRHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ +K D EL+ IPVIAVTAFAMKGDEERIR+GGCEAY+SKPIS+S F+ET+++++
Sbjct: 61  GLDVTRALKADPELKAIPVIAVTAFAMKGDEERIREGGCEAYLSKPISVSKFLETVRQFL 120

Query: 121 GEA 123
             A
Sbjct: 121 PAA 123


>gi|115525387|ref|YP_782298.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
 gi|115519334|gb|ABJ07318.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
          Length = 121

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY  + T NG EALEL R+ +PD+I+MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTMGTSNGYEALELTRKLRPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTKWIKDDPELRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|27065585|pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk
 gi|27065589|pdb|1M5U|A Chain A, Crystal Structure Of The Response Regulator Divk.
           Structure At Ph 8.0 In The Apo-Form
 gi|27065629|pdb|1MAV|A Chain A, Crystal Structure Of The Response Regulator Divk At Ph 6.0
           In Complex With Mn2+
 gi|27065631|pdb|1MB0|A Chain A, Crystal Structure Of The Response Regulator Divk At Ph 8.0
           In Complex With Mn2+
 gi|27065632|pdb|1MB3|A Chain A, Crystal Structure Of The Response Regulator Divk At Ph 8.5
           In Complex With Mg2+
          Length = 124

 Score =  181 bits (459), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IVEDNELNMKLF DL+E  GY  LQTR G+ AL +AR++KPD+I+MDIQL EISGL
Sbjct: 2   KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGL 61

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+TK +KED +L  IPV+AVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK+ +
Sbjct: 62  EVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLL 119


>gi|163792857|ref|ZP_02186833.1| response regulator receiver protein [alpha proteobacterium BAL199]
 gi|159181503|gb|EDP66015.1| response regulator receiver protein [alpha proteobacterium BAL199]
          Length = 136

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/119 (69%), Positives = 103/119 (86%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V+IVEDNELNMKLF DL+E  GY  + TR+GMEAL +AR  +PD+I+MDIQL ++SGL
Sbjct: 18  KTVLIVEDNELNMKLFHDLLEAHGYNIIGTRDGMEALRIARDSRPDLILMDIQLPKVSGL 77

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+TK IKED  L+ IPVIAVTAFAMKGDEE+IR+GGCEAYI+KPIS++ F+ET+KKY+G
Sbjct: 78  EVTKWIKEDDRLKSIPVIAVTAFAMKGDEEKIREGGCEAYIAKPISVTNFLETVKKYLG 136


>gi|114569826|ref|YP_756506.1| response regulator receiver protein [Maricaulis maris MCS10]
 gi|114340288|gb|ABI65568.1| response regulator receiver protein [Maricaulis maris MCS10]
          Length = 144

 Score =  180 bits (457), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 105/120 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLF DL+E  GY  LQT++G +ALE+AR+H PD+I+MDIQL E+S
Sbjct: 24  MPKKVLIVEDNELNMKLFNDLLEAHGYETLQTKDGFKALEMAREHTPDLILMDIQLPEVS 83

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +K+D  L  IPV+AVTAFAMKGDEERIR+GGCEAY+SKPI+++ F++T+++++
Sbjct: 84  GLEVTKWLKDDDSLAAIPVVAVTAFAMKGDEERIREGGCEAYLSKPITVATFIQTVRQFL 143


>gi|170748283|ref|YP_001754543.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654805|gb|ACB23860.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 123

 Score =  180 bits (456), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 104/120 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E +GY  L+T +G+EA+ELAR H PD+I+MDIQL E+S
Sbjct: 1   MKKTVLIVEDNELNMKLFNDLLEANGYATLKTAHGIEAIELARAHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK +KED +L+ IPVIA+TAFAMKGDEERIR+GGCEAY+SKPIS++ F+ T++ Y+
Sbjct: 61  GLEVTKWLKEDDDLKGIPVIAITAFAMKGDEERIREGGCEAYLSKPISVAKFLATVRAYL 120


>gi|39936196|ref|NP_948472.1| CheY-like response regulator receiver [Rhodopseudomonas palustris
           CGA009]
 gi|192291912|ref|YP_001992517.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|316933636|ref|YP_004108618.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
 gi|39650051|emb|CAE28574.1| response regulator receiver (CheY-like protein) [Rhodopseudomonas
           palustris CGA009]
 gi|192285661|gb|ACF02042.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|315601350|gb|ADU43885.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
          Length = 121

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 104/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+ +PD+I+MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTAGTSNGYEALDLVRKLRPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D+EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTRWIKDDAELRHIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|90424800|ref|YP_533170.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris BisB18]
 gi|90106814|gb|ABD88851.1| response regulator receiver domain protein (CheY-like)
           [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EALEL R+ +PD+I+MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTSGTSNGYEALELVRKLRPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTRWIKDDPELRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|323138820|ref|ZP_08073884.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
 gi|322395968|gb|EFX98505.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
          Length = 124

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 107/122 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E +G+  L+T++G+EA+ LAR+H PD+I+MDIQL E+S
Sbjct: 1   MTKTVLIVEDNELNMKLFNDLLEANGHATLRTKSGVEAIALAREHHPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ +K+D EL++IPVIA+TAFAMKGDEE+IR+GGCEAY+SKPIS++ F+ET+  ++
Sbjct: 61  GLEVTRWLKDDEELRDIPVIAITAFAMKGDEEKIRQGGCEAYLSKPISVAKFLETVNSFL 120

Query: 121 GE 122
            +
Sbjct: 121 AD 122


>gi|27380235|ref|NP_771764.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
 gi|27353389|dbj|BAC50389.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 103/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+ +PD+++MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTTGTSNGYEALDLVRKMRPDLVLMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTRWIKDDPELRSIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|83945514|ref|ZP_00957861.1| response regulator [Oceanicaulis alexandrii HTCC2633]
 gi|83851090|gb|EAP88948.1| response regulator [Oceanicaulis alexandrii HTCC2633]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 104/120 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IVEDNELNMKLFRDL+E  GY  +QT  G++AL++AR+HKPD+I+MDIQL E+S
Sbjct: 1   MSKKVLIVEDNELNMKLFRDLLEAHGYETVQTSEGLKALDMAREHKPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++TK IK D EL  IPV+AVTAFAMKGDEERIR+GGCE Y+SKPI+++ F++T++ ++
Sbjct: 61  GLDVTKWIKNDDELSAIPVVAVTAFAMKGDEERIREGGCEGYLSKPITVASFIKTVRDFL 120


>gi|319405636|emb|CBI79259.1| two-component system response regulator [Bartonella sp. AR 15-3]
          Length = 121

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 102/121 (84%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDLIE  GY  ++TRNG+ AL+LAR  KP +I+MDIQL EIS
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLIEACGYETIETRNGLIALDLARSSKPSLILMDIQLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I KQ+KED EL+ IP+IAVTAFAMKGDEERIR  GCE Y+SKPIS++ F+ T+K ++
Sbjct: 61  GIDIIKQLKEDEELKSIPIIAVTAFAMKGDEERIRASGCEEYMSKPISVTHFITTVKSFL 120

Query: 121 G 121
            
Sbjct: 121 N 121


>gi|296447290|ref|ZP_06889218.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
 gi|296255155|gb|EFH02254.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
          Length = 123

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 106/122 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLF DL+E +G+  LQT++G+EA+ LAR+H PD+I+MDIQL E+S
Sbjct: 1   MQKTVLIVEDNELNMKLFNDLLEANGHATLQTKSGVEAIALARRHSPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ +K+D EL+ IP+IA+TAFAMKGDEE+IR+GGCEAY+SKPIS++ F+ET+  ++
Sbjct: 61  GLEVTRWLKDDEELRSIPIIAITAFAMKGDEEKIRQGGCEAYLSKPISVARFLETVNAFL 120

Query: 121 GE 122
            +
Sbjct: 121 AD 122


>gi|75675623|ref|YP_318044.1| response regulator receiver [Nitrobacter winogradskyi Nb-255]
 gi|74420493|gb|ABA04692.1| response regulator receiver [Nitrobacter winogradskyi Nb-255]
          Length = 121

 Score =  177 bits (448), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+ +PD+++MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYHTSGTSNGFEALDLVRKLRPDLVLMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET+++++
Sbjct: 61  GLDVTRWIKDDPELRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFV 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|86749532|ref|YP_486028.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris HaA2]
 gi|86572560|gb|ABD07117.1| response regulator receiver domain protein [Rhodopseudomonas
           palustris HaA2]
          Length = 121

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 101/121 (83%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL L R+  PD+I+MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTAGTSNGHEALALVRKLHPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTRWIKDDPELRHIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|92117964|ref|YP_577693.1| response regulator receiver domain-containing protein [Nitrobacter
           hamburgensis X14]
 gi|91800858|gb|ABE63233.1| response regulator receiver domain protein (CheY-like) [Nitrobacter
           hamburgensis X14]
          Length = 121

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+ +PD+++MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTSGTSNGFEALDLVRKLRPDLVLMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET+++++
Sbjct: 61  GLDVTRWIKDDPELRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFV 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|91977507|ref|YP_570166.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
 gi|91683963|gb|ABE40265.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
          Length = 121

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+  PD+I+MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYQTAGTSNGYEALDLVRKLHPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLDVTRWIKDDPELRHIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|85716224|ref|ZP_01047198.1| response regulator receiver [Nitrobacter sp. Nb-311A]
 gi|85696896|gb|EAQ34780.1| response regulator receiver [Nitrobacter sp. Nb-311A]
          Length = 121

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T NG EAL+L R+ +PD+++MDIQL ++S
Sbjct: 1   MAKTVLIVEDNELNMKLFRDLLEAHGYHTSGTSNGFEALDLVRKLRPDLVLMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ IK+D EL+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET+++++
Sbjct: 61  GLDVTRWIKDDPELRGIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFV 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|217976612|ref|YP_002360759.1| response regulator receiver protein [Methylocella silvestris BL2]
 gi|217501988|gb|ACK49397.1| response regulator receiver protein [Methylocella silvestris BL2]
          Length = 123

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 103/122 (84%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++IVEDNELNMKLF DL+E  GY  +QTR+G+EA+ L R+H PD+I+MDIQL E+S
Sbjct: 1   MQKTILIVEDNELNMKLFNDLLEAHGYKTVQTRSGLEAVGLTREHMPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ +K+D  L+ IPVIA+TAFAMKGDEE+IR+GGCEAY+SKPIS+  F+ET++ Y+
Sbjct: 61  GLEVTQWLKQDEALRHIPVIAITAFAMKGDEEKIRQGGCEAYLSKPISIVKFLETVRSYL 120

Query: 121 GE 122
            E
Sbjct: 121 NE 122


>gi|319404198|emb|CBI77791.1| two-component system response regulator [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319407208|emb|CBI80847.1| two-component system response regulator [Bartonella sp. 1-1C]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 100/121 (82%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDLIE  GY  ++TRNG+ AL+LAR  KP +I+MDIQL E+S
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLIEACGYETVETRNGLIALDLARSSKPSLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I KQ+KED EL+ IPVIAVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDIIKQLKEDEELKSIPVIAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMVKSFL 120

Query: 121 G 121
            
Sbjct: 121 N 121


>gi|144898226|emb|CAM75090.1| Response regulator receiver [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 103/120 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDN+LNMKLF DL++ +GY  LQT++G EA++LAR H+PD+I+MDIQL E+S
Sbjct: 1   MAKTVLIVEDNDLNMKLFNDLLQANGYATLQTKDGREAMDLARTHRPDLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEIT+ +K D+EL+ IPVIAVTAFAMKGDEE+IR+GGCE YI+KPIS+  F+ETI  ++
Sbjct: 61  GLEITRMLKNDAELKVIPVIAVTAFAMKGDEEKIREGGCEGYIAKPISVVNFLETIGAFL 120


>gi|319408568|emb|CBI82221.1| two-component system response regulator [Bartonella schoenbuchensis
           R1]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 101/120 (84%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDL+E SGY  ++TRNG+ AL+LAR  KP +IIMDIQL E+S
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLVEVSGYETVETRNGLIALDLARSTKPSLIIMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+KED EL+ IP++AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDVIKQLKEDEELKSIPIVAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMLKSFL 120


>gi|146341430|ref|YP_001206478.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [Bradyrhizobium sp. ORS278]
 gi|146194236|emb|CAL78258.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [Bradyrhizobium sp. ORS278]
          Length = 121

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 104/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T +G+EAL++ R+ +PD+I+MDIQL ++S
Sbjct: 1   MGKTVLIVEDNELNMKLFRDLLEAHGYQTSGTSSGVEALDIVRRTRPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+TK IK+D +L+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTKWIKDDPDLRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|306841741|ref|ZP_07474427.1| response regulator receiver protein [Brucella sp. BO2]
 gi|306288146|gb|EFM59533.1| response regulator receiver protein [Brucella sp. BO2]
          Length = 109

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 98/109 (89%)

Query: 15  MKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSEL 74
           MKLFRDLIE SGY  ++TR+G+EAL+LAR+H PD+I+MDIQL E+SGLE+TK +K+D EL
Sbjct: 1   MKLFRDLIEASGYETIRTRSGLEALDLAREHHPDLILMDIQLPEVSGLEVTKWLKDDEEL 60

Query: 75  QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + IPVIAVTAFAMKGDEERIR+GGCEAYISKPIS+  F+ETIK Y+G+A
Sbjct: 61  RHIPVIAVTAFAMKGDEERIRQGGCEAYISKPISVPRFIETIKSYLGDA 109


>gi|83312669|ref|YP_422933.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82947510|dbj|BAE52374.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 123

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 105/120 (87%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDN+LNMKLF DL++ +GY  +QT++G EA+++AR+H PD+I+MDIQL EIS
Sbjct: 3   MAKSVLIVEDNDLNMKLFNDLLQANGYETIQTKDGREAMDIARKHHPDLILMDIQLPEIS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITK +K D+EL+ IPV+AVTAFAMKGDEE+IR+GGCE YI+KPIS++ F++T+ +++
Sbjct: 63  GLEITKMLKSDAELKSIPVVAVTAFAMKGDEEKIREGGCEGYIAKPISVANFLQTVARFL 122


>gi|46201004|ref|ZP_00056020.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 123

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 104/120 (86%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDN+LNMKLF DL+  +GY  +QT++G EA+++AR+H PD+I+MDIQL EIS
Sbjct: 3   MAKSVLIVEDNDLNMKLFNDLLRANGYETIQTKDGREAMDIARKHHPDLILMDIQLPEIS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEITK +K D+EL+ IPVIAVTAFAMKGDEE+IR+GGCE YI+KPIS++ F++T+ +++
Sbjct: 63  GLEITKMLKNDAELKSIPVIAVTAFAMKGDEEKIREGGCEGYIAKPISVASFLQTVARFL 122


>gi|148256094|ref|YP_001240679.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [Bradyrhizobium sp. BTAi1]
 gi|146408267|gb|ABQ36773.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 104/121 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVEDNELNMKLFRDL+E  GY    T +G+EAL++ R+ +PD+I+MDIQL ++S
Sbjct: 1   MGKTVLIVEDNELNMKLFRDLLEAHGYQTSGTSSGVEALDIVRRTRPDLILMDIQLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ IK+D +L+ IPV+AVTAFAMKGDEERIR+GGCEAY+SKPIS+  F+ET++++I
Sbjct: 61  GLEVTRWIKDDPDLRAIPVVAVTAFAMKGDEERIREGGCEAYLSKPISVGKFIETVRRFI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|121602733|ref|YP_989188.1| cell division response regulator DivK [Bartonella bacilliformis
           KC583]
 gi|120614910|gb|ABM45511.1| cell division response regulator DivK [Bartonella bacilliformis
           KC583]
          Length = 121

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 100/120 (83%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDL+E  GY  ++TRNG+ AL+LAR  KP +I+MDIQL E+S
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLVEAGGYETVETRNGLIALDLARLSKPSLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+KED EL+ IPV+AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDVIKQLKEDEELKSIPVVAVTAFAMKGDEERIRASGCEEYMSKPISVPYFIAMLKSFL 120


>gi|319898873|ref|YP_004158966.1| two-component system response regulator [Bartonella clarridgeiae
           73]
 gi|319402837|emb|CBI76388.1| two-component system response regulator [Bartonella clarridgeiae
           73]
          Length = 121

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 100/120 (83%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           MLKKVMIVEDNELNMKLFRDLIE  GY  ++TRNG+ AL+LAR  KP +I+MDIQL E+S
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLIEACGYETVETRNGLIALDLARFSKPSLILMDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I KQ+KED EL+ IP+IAVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDIIKQLKEDGELKSIPIIAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMVKSFL 120


>gi|304320055|ref|YP_003853698.1| hypothetical protein PB2503_02397 [Parvularcula bermudensis
           HTCC2503]
 gi|303298958|gb|ADM08557.1| hypothetical protein PB2503_02397 [Parvularcula bermudensis
           HTCC2503]
          Length = 130

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 98/119 (82%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V+IVEDNELNMKLF DL+E  GY  LQ  NG EAL+LAR H+PD+I+MDIQL E SGL
Sbjct: 12  RTVLIVEDNELNMKLFHDLLEVQGYRVLQAVNGAEALDLARAHRPDLILMDIQLPEKSGL 71

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           ++T++IK D EL+ IPVIAVTAFAMK DE RIR+GGCE YI+KPIS+ +F++ +K+Y+ 
Sbjct: 72  DVTREIKADDELRAIPVIAVTAFAMKSDEARIREGGCEDYIAKPISVPVFLDKVKRYLS 130


>gi|163868612|ref|YP_001609821.1| two-component system response regulator [Bartonella tribocorum CIP
           105476]
 gi|161018268|emb|CAK01826.1| two-component system response regulator [Bartonella tribocorum CIP
           105476]
          Length = 121

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (82%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDL+E SGY  ++TRNG+ AL+LAR   P +I++DIQL E+S
Sbjct: 1   MSKKVMIVEDNELNMKLFRDLVEASGYETVETRNGLMALDLARSTMPSLILVDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+KED EL+ IPV+AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDVIKQLKEDEELRSIPVVAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMVKHFV 120


>gi|240850786|ref|YP_002972186.1| two component response regulator [Bartonella grahamii as4aup]
 gi|240267909|gb|ACS51497.1| two component response regulator [Bartonella grahamii as4aup]
          Length = 121

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (82%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDL+E SGY  ++TRNG+ AL+LAR   P +I++DIQL E+S
Sbjct: 1   MSKKVMIVEDNELNMKLFRDLVEASGYETIETRNGLMALDLARSSMPSLILVDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+KED EL+ IPV+AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDVIKQLKEDEELRSIPVVAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMVKHFL 120


>gi|83594536|ref|YP_428288.1| response regulator receiver protein [Rhodospirillum rubrum ATCC
           11170]
 gi|83577450|gb|ABC24001.1| response regulator receiver protein [Rhodospirillum rubrum ATCC
           11170]
          Length = 126

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 103/120 (85%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++IVEDNELNMKLF DL++ SGY  +QT +G + ++LAR H+PD+I+MDIQL E+S
Sbjct: 5   MAKTILIVEDNELNMKLFNDLLQASGYDTVQTNDGRKVVDLARAHRPDLILMDIQLPEVS 64

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+T+ +K+D +L+ IPVIAVTAFAMKGDEE+IR+GGC+ Y++KPIS++ F++T+ +++
Sbjct: 65  GLEVTRMLKDDGDLKAIPVIAVTAFAMKGDEEKIREGGCDGYVAKPISVAGFLQTVARFL 124


>gi|49475550|ref|YP_033591.1| response regulator [Bartonella henselae str. Houston-1]
 gi|49238356|emb|CAF27580.1| Response regulator [Bartonella henselae str. Houston-1]
          Length = 121

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (82%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDL+E SGY  ++TRNG+ AL+LAR   P +I++DIQL E+S
Sbjct: 1   MSKKVMIVEDNELNMKLFRDLVEASGYETVETRNGLMALDLARSSMPSLILVDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K+D EL+ IPV+AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K ++
Sbjct: 61  GIDVIKQLKKDEELRAIPVVAVTAFAMKGDEERIRASGCEEYMSKPISVPHFITMVKNFL 120


>gi|49474264|ref|YP_032306.1| response regulator [Bartonella quintana str. Toulouse]
 gi|49239768|emb|CAF26155.1| Response regulator [Bartonella quintana str. Toulouse]
          Length = 121

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 99/120 (82%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKVMIVEDNELNMKLFRDL+E SGY  ++TRNG+ AL+LAR   P +I++DIQL E+S
Sbjct: 1   MSKKVMIVEDNELNMKLFRDLVEASGYETVETRNGLMALDLARSSMPSLILVDIQLPEVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+KED  L+ +PV+AVTAFAMKGDEERIR  GCE Y+SKPIS+  F+  +K+++
Sbjct: 61  GIDVIKQLKEDEVLKSVPVVAVTAFAMKGDEERIRASGCEEYMSKPISVPHFIAMVKRFL 120


>gi|114799980|ref|YP_760980.1| cell division response regulator DivK [Hyphomonas neptunium ATCC
           15444]
 gi|114740154|gb|ABI78279.1| cell division response regulator DivK [Hyphomonas neptunium ATCC
           15444]
          Length = 131

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 90/113 (79%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDNELNM+LF DL+   G+   Q R+G +A+E+AR+  PD+IIMDIQL E+SGL+
Sbjct: 9   KVLVVEDNELNMRLFCDLLGAYGFTTFQCRDGAKAVEIARKELPDLIIMDIQLPEVSGLD 68

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           IT+ +K+D ++  IPV+AVTAFAM+ DE+R+R+ GCE Y+SKPI ++ F+  +
Sbjct: 69  ITRWLKDDKKVAHIPVLAVTAFAMRADEQRVREAGCEGYLSKPIQIASFIRAV 121


>gi|83310017|ref|YP_420281.1| CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82944858|dbj|BAE49722.1| CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 133

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 92/119 (77%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++I+EDN L++KLF D+++  GY  LQ  +G EA E+  Q +P++I++DIQL  +SGL
Sbjct: 15  KTILIIEDNALSLKLFNDILQARGYSTLQAMDGREAKEIVEQSRPNLILLDIQLPGVSGL 74

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +  + +KED+ELQ IP+IAVTAFAMKGDEERI + GC+AY++KPIS+  F+  + +++G
Sbjct: 75  DFARVLKEDAELQAIPIIAVTAFAMKGDEERILESGCDAYLAKPISIEKFLNKVTEFLG 133


>gi|103488486|ref|YP_618047.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
 gi|98978563|gb|ABF54714.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
          Length = 120

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 87/119 (73%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++VEDNELN++LF DL+   GY A   R+G +AL  AR   PD+IIMDIQL  +S
Sbjct: 1   MGKTILVVEDNELNLRLFCDLLNAHGYSAHPVRDGRDALAKARAVSPDLIIMDIQLPHVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           GL++  Q+K D  L+ IP++AVTA+A KGDEE+IR  G EAY+SKPIS+  F+E++  +
Sbjct: 61  GLDLIGQMKADPILRAIPIMAVTAYAGKGDEEQIRAAGAEAYVSKPISVIRFIESVAAF 119


>gi|254294351|ref|YP_003060374.1| response regulator receiver [Hirschia baltica ATCC 49814]
 gi|254042882|gb|ACT59677.1| response regulator receiver protein [Hirschia baltica ATCC 49814]
          Length = 131

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 93/116 (80%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV++VEDNELNMKLF DL+   G+ A+++ +G+ A+E+A++  PD+IIMDIQL E+SGL
Sbjct: 7   KKVLVVEDNELNMKLFCDLLGAFGFEAVKSIDGLRAVEMAKEIHPDLIIMDIQLPEVSGL 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           ++ + IK+D  +  IP++AVTAFAM+ DEE ++  GCEAY++KPI ++ F++ +++
Sbjct: 67  DLARWIKDDDVVGNIPILAVTAFAMRQDEEDVKAAGCEAYMTKPIQMTPFIKMVEE 122


>gi|332188168|ref|ZP_08389897.1| response regulator [Sphingomonas sp. S17]
 gi|332011775|gb|EGI53851.1| response regulator [Sphingomonas sp. S17]
          Length = 116

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 85/116 (73%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNELN+KLF DL+   G+IA   R+G EA+  AR  +PD+IIMDIQ+  ++G E+
Sbjct: 1   MLVVEDNELNLKLFCDLLRVHGFIAEPVRDGREAVAYARAFQPDLIIMDIQMPHVTGYEL 60

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++K D EL+ IPV+AVTA+A + DE+RIR  G +AY+SKPISL  FME +   +
Sbjct: 61  ILELKADEELRRIPVMAVTAYAGREDEDRIRAAGADAYVSKPISLMRFMEAVNALV 116


>gi|148555692|ref|YP_001263274.1| response regulator receiver protein [Sphingomonas wittichii RW1]
 gi|148500882|gb|ABQ69136.1| response regulator receiver protein [Sphingomonas wittichii RW1]
          Length = 133

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++IVEDNELN++LFRDL+E  G      R+  EAL+  R   P ++IMDIQL  ISG+
Sbjct: 6   KKILIVEDNELNLRLFRDLLEAHGAEVRTVRDAREALDAIRIFLPQLVIMDIQLPHISGV 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ + +K D +L+ IPV+AVTA+A KGDE R+R+ G +AY+SKPIS+S F+  +++  G
Sbjct: 66  ELIRMMKTDGQLEAIPVMAVTAYAGKGDESRVREAGADAYVSKPISVSRFVLAVEELAG 124


>gi|294010068|ref|YP_003543528.1| CheY-like response regulator [Sphingobium japonicum UT26S]
 gi|292673398|dbj|BAI94916.1| CheY-like response regulator [Sphingobium japonicum UT26S]
          Length = 120

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 84/120 (70%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+V++VEDNELN+KLF DL+   G+  L  R+G + L  AR   PD++I DI L  +S
Sbjct: 1   MAKRVLVVEDNELNLKLFCDLLRAHGHDVLPLRDGRDLLAQARDFHPDLVITDIHLPHVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++   +K D++L  +P++AVTA+A  GDEERIR+ G +AY+SKPIS+  F+E +   +
Sbjct: 61  GLDLIVSLKRDAQLSPVPIMAVTAYAGHGDEERIREAGAQAYVSKPISVLRFVEQVNALL 120


>gi|296284961|ref|ZP_06862959.1| two-component response regulator [Citromicrobium bathyomarinum
           JL354]
          Length = 122

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 82/122 (67%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VEDN+LN KLF D++   GY  L   +G   +  A Q +PD+ IMDIQL  +S
Sbjct: 1   MAKRILVVEDNDLNRKLFCDVLRAKGYEVLGCADGNSVIASAHQFRPDLAIMDIQLPHVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++  Q+K D +L  +PV+AVTA+A KGDE+RIR  G E Y++KP+S+  F   +   I
Sbjct: 61  GLDLIAQMKADPKLAGVPVLAVTAYAGKGDEDRIRAAGAEDYLAKPVSIGPFSAKVLALI 120

Query: 121 GE 122
           GE
Sbjct: 121 GE 122


>gi|326388823|ref|ZP_08210405.1| response regulator receiver protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206423|gb|EGD57258.1| response regulator receiver protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 122

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VEDN+LN KLF DL+   G+      +G   +E AR   PD++IMDIQL  IS
Sbjct: 1   MAKRILVVEDNDLNRKLFGDLLVAKGFDVETLADGHAVIERARDFAPDLVIMDIQLPNIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ + +K D  L +IPV+AVTA+A KGDEERIR+ G E Y++KP+S++ F+  + K +
Sbjct: 61  GLELIEALKGDETLAQIPVLAVTAYAGKGDEERIREAGAEGYLAKPVSITPFLLAVGKLL 120


>gi|85709615|ref|ZP_01040680.1| two-component response regulator [Erythrobacter sp. NAP1]
 gi|85688325|gb|EAQ28329.1| two-component response regulator [Erythrobacter sp. NAP1]
          Length = 117

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 82/115 (71%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           M+VEDN+LN +LF D+++ +G+       G + LE AR  +PD+IIMDIQL  ISG+E+ 
Sbjct: 1   MVVEDNDLNRRLFCDVLKANGFEVEPVAEGEKVLETARSVQPDLIIMDIQLPGISGIELI 60

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            Q K+DS L +IPV+AVTAFA KGDEERIR  G  +Y++KP+S+  FM  + + +
Sbjct: 61  AQAKQDSGLSDIPVLAVTAFAAKGDEERIRAAGAASYLAKPVSIMPFMNAVNELL 115


>gi|85375644|ref|YP_459706.1| two-component response regulator [Erythrobacter litoralis HTCC2594]
 gi|84788727|gb|ABC64909.1| two-component response regulator [Erythrobacter litoralis HTCC2594]
          Length = 122

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VEDN+LN KLF D++   G+  L   +G   L  AR+  PD+ IMDIQL  IS
Sbjct: 1   MAKRILVVEDNDLNRKLFCDVLRAKGHEVLPCADGNAVLGAAREFSPDLTIMDIQLPNIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ + +K+D  L  IPV+AVTA+A KGDEE+IR  G   Y+SKP+S+  FM  +   I
Sbjct: 61  GVDLIQAMKQDPTLAAIPVLAVTAYAGKGDEEKIRDAGAADYLSKPVSIGPFMAAVDALI 120

Query: 121 G 121
            
Sbjct: 121 A 121


>gi|149185414|ref|ZP_01863730.1| two-component response regulator [Erythrobacter sp. SD-21]
 gi|148830634|gb|EDL49069.1| two-component response regulator [Erythrobacter sp. SD-21]
          Length = 126

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 85/120 (70%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDN+LN KLF D+++ +GY  +   +G   L  A++  P ++IMDIQL  +SG+
Sbjct: 7   KRILVVEDNDLNRKLFCDVLKANGYEVVPVSDGNNFLATAKKSDPQLVIMDIQLPNVSGV 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++   +K DS +  +PV+AVTA+A KGDEERIR+ G + Y++KP+S+  FM  ++K + +
Sbjct: 67  DLITDLKADSGMHGVPVLAVTAYAGKGDEERIREAGAQDYLAKPVSIGPFMAAVRKLLSD 126


>gi|307296983|ref|ZP_07576799.1| response regulator receiver protein [Sphingobium chlorophenolicum
           L-1]
 gi|306877509|gb|EFN08737.1| response regulator receiver protein [Sphingobium chlorophenolicum
           L-1]
          Length = 116

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 82/116 (70%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNELN+KLF DL+   G   L  R+G + L  AR+  PD++I DI L  +SGL++
Sbjct: 1   MLVVEDNELNLKLFCDLLRAHGREVLPLRDGRDLLPQAREFHPDLVITDIHLPHVSGLDL 60

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +K+D++L  +P++AVTA+A  GDEERIR+ G +AY+SKPIS+  F+E +   +
Sbjct: 61  IVSLKQDAQLASVPIMAVTAYAGHGDEERIREAGAQAYVSKPISVLRFVEQVNALL 116


>gi|94498032|ref|ZP_01304595.1| two-component response regulator [Sphingomonas sp. SKA58]
 gi|94422467|gb|EAT07505.1| two-component response regulator [Sphingomonas sp. SKA58]
          Length = 120

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 80/120 (66%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+V++VEDNELN+KLF DL+   G+  L  R+G + L  A    PD++I DI L  +S
Sbjct: 1   MTKRVLVVEDNELNLKLFCDLLRAHGHDVLPLRDGRDVLREAGAFLPDLVITDIHLPHVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++   +K D+ L  +P++AVTA+A  GDE+RIR  G +AY+SKPIS+  F+E +   +
Sbjct: 61  GFDLILSLKADARLSHVPIMAVTAYAGHGDEDRIRGAGADAYVSKPISVLRFVEQVNALL 120


>gi|241762808|ref|ZP_04760872.1| response regulator receiver protein [Acidovorax delafieldii 2AN]
 gi|241368227|gb|EER62419.1| response regulator receiver protein [Acidovorax delafieldii 2AN]
          Length = 127

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED   NMKL   L+  SGY  LQ  N  + + LAR+H PD+I+MDIQL  + 
Sbjct: 1   MTTQILVVEDTPANMKLVSMLLGNSGYRVLQADNANDGIALAREHLPDLILMDIQLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL  T+ +KED+    I ++A+TAFAMKGDE+R+   GC+ YI+KPI    F+E I++ +
Sbjct: 61  GLTATRLLKEDAATCHIKIVALTAFAMKGDEDRMIAAGCDGYIAKPIRYKKFLEEIERIL 120

Query: 121 GEA 123
             A
Sbjct: 121 ASA 123


>gi|91203276|emb|CAJ72915.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 123

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K VM+VEDNE N KL R +++  GY  ++   G EAL L ++  PD+I+MDIQL  I GL
Sbjct: 4   KNVMVVEDNEKNRKLIRVVLKAKGYNVIEATTGEEALSLLKEQIPDIILMDIQLPGIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + +QIK D+  ++IP+IAVTA AMKGD+++I   GC+AY+SKPI       TI+KY+
Sbjct: 64  TLIRQIKADAGKKDIPIIAVTAHAMKGDQQKILDTGCDAYMSKPIDTRELPLTIEKYL 121


>gi|87201120|ref|YP_498377.1| response regulator receiver protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136801|gb|ABD27543.1| response regulator receiver protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 122

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 80/118 (67%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDN+LN KLF DL+   G+      +G +A+E  R   P +++MDIQL  ISG+
Sbjct: 5   KRILVVEDNDLNRKLFCDLLRAKGFEVEPVADGRDAIEKTRLFMPHLVVMDIQLPNISGM 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           ++ + IK D EL+ IP++AVTA+A KGDEE IR  G E Y++KP+S+  FM  +   +
Sbjct: 65  DLIEAIKADEELKAIPILAVTAYAGKGDEESIRDAGAEGYLAKPVSIGPFMAAVNALV 122


>gi|21229308|ref|NP_635230.1| response regulator receiver domain-containing protein
           [Methanosarcina mazei Go1]
 gi|20907889|gb|AAM32902.1| Response regulator receiver domain [Methanosarcina mazei Go1]
          Length = 122

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 85/120 (70%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++VEDN L M+L R L+ + GY +L+  +G+ AL L +++K ++I++DIQL  I G
Sbjct: 3   VKNILVVEDNPLIMELVRTLLLSFGYESLEAYDGITALRLCKKYKLNLILLDIQLPGIDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K +KED   +EIPV+A+TA AM+GDEE+  K GC AYISKPI +  F   ++K+I 
Sbjct: 63  AEVLKILKEDPGTEEIPVVALTAHAMRGDEEKFLKAGCSAYISKPIDIQRFKSVVEKFIA 122


>gi|258593328|emb|CBE69667.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [NC10 bacterium 'Dutch sediment']
          Length = 123

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 80/117 (68%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++ VEDN+ N K+ RDL+    Y  ++  NG  AL+   + +PD+I+MDIQL ++SGLE+
Sbjct: 6   ILHVEDNQYNRKIIRDLLSKHNYEIMEAHNGEAALDALARRRPDLILMDIQLPKLSGLEV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T++I+ D  L +IP+IA+T+FA+ GDE    + GC AYI+KP      +E I++++G
Sbjct: 66  TRRIRADPSLAQIPIIAITSFALSGDERTAFEAGCSAYIAKPFRPRDLLEMIQRFLG 122


>gi|56551146|ref|YP_161985.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56542720|gb|AAV88874.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 120

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 79/120 (65%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVEDNELN+KLF DL+    +     R+G   +  A    PD+IIMDIQL  IS
Sbjct: 1   MASRILIVEDNELNLKLFCDLLRAHHFDVEPVRDGRGMIAHAHSFMPDLIIMDIQLPHIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+  QI++  EL  IP++AVTA+A   DE++IR+ G   YI+KPIS+  F+E +K  I
Sbjct: 61  GLELIGQIRKTKELCHIPIMAVTAYAAPEDEQKIRQAGATGYIAKPISVVRFLEAVKTLI 120


>gi|241761500|ref|ZP_04759588.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753205|ref|YP_003226098.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|241374407|gb|EER63904.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552568|gb|ACV75514.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 120

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 79/120 (65%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVEDNELN+KLF DL+    +     R+G   +  A    PD+IIMDIQL  IS
Sbjct: 1   MASRILIVEDNELNLKLFCDLLRAHHFDVEPVRDGRGMIARAHSFMPDLIIMDIQLPHIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+  QI++  EL  IP++AVTA+A   DE++IR+ G   YI+KPIS+  F+E +K  I
Sbjct: 61  GLELIGQIRKTKELCHIPIMAVTAYAAPEDEQKIRQAGATGYIAKPISVVRFLEAVKTLI 120


>gi|21227170|ref|NP_633092.1| two-component response regulator [Methanosarcina mazei Go1]
 gi|20905506|gb|AAM30764.1| Two-component response regulator [Methanosarcina mazei Go1]
          Length = 123

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 85/122 (69%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+K+++IVEDN +NM+L  DL+E  G+   +  +G++ALE   + K D+I++D+QL ++ 
Sbjct: 2   MMKEILIVEDNPMNMELILDLLEFYGHRVTEAEDGIKALERLAEKKFDLILLDMQLPKMD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++IK++    EIPVIAVTA AMKG EE   + GC  YISKPI +  F   I KY+
Sbjct: 62  GLEVLERIKKNPATSEIPVIAVTAHAMKGSEEHFIEMGCVDYISKPIDIHRFRSLIDKYL 121

Query: 121 GE 122
           GE
Sbjct: 122 GE 123


>gi|330962180|gb|EGH62440.1| response regulator receiver [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 129

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 77/106 (72%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++MIVEDN  NM+L + L+ ++G++ L   +    L+LAR+H+PD+I+MDIQL E+ G
Sbjct: 1   MAQIMIVEDNAANMRLAQLLLTSAGHVVLCATDAETGLKLAREHQPDLILMDIQLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L+ T  +K+D+    IPV+A+TA AMK DEE+IR  GC AYI KP+
Sbjct: 61  LKATSLLKKDASTAAIPVVALTAMAMKEDEEKIRLAGCNAYIIKPL 106


>gi|224370416|ref|YP_002604580.1| putative transcriptional response regulator protein
           [Desulfobacterium autotrophicum HRM2]
 gi|223693133|gb|ACN16416.1| putative transcriptional response regulator protein
           [Desulfobacterium autotrophicum HRM2]
          Length = 124

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 87/121 (71%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++I+EDNE + KL +DL++  GY  ++  NG++ +E A +++P +I+MDIQ+  + GL
Sbjct: 4   KLILIIEDNEKSTKLVKDLLQYKGYRTVEAVNGLDGIESALKYRPQLILMDIQMPVMDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E T+++KE  E + IPV+A+T++AMKGDE+ I + GC+ Y+SKPI+   F+E + ++   
Sbjct: 64  EATRKLKEMPETRSIPVVALTSWAMKGDEKAILEAGCDDYMSKPINTRSFIELVDRFFNA 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|73668584|ref|YP_304599.1| response regulator receiver [Methanosarcina barkeri str. Fusaro]
 gi|72395746|gb|AAZ70019.1| response regulator receiver [Methanosarcina barkeri str. Fusaro]
          Length = 125

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 84/123 (68%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+KK++IVEDN +NM+L  DL+E  G+   +  +G++ALE   + K D+I++D+QL ++ 
Sbjct: 1   MMKKILIVEDNPMNMELILDLLEFYGHNITKAEDGIKALESLAETKFDIILLDMQLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+  +IK++    +IPVIAVTA AMKG EE   + GC  Y+SKPI +  F   I KY+
Sbjct: 61  GLEVLDRIKKNPATADIPVIAVTAHAMKGSEEHFIEMGCVDYVSKPIDIHKFRALIDKYL 120

Query: 121 GEA 123
           GE 
Sbjct: 121 GEG 123


>gi|20093163|ref|NP_619238.1| response regulator receiver [Methanosarcina acetivorans C2A]
 gi|19918506|gb|AAM07718.1| response regulator receiver [Methanosarcina acetivorans C2A]
          Length = 123

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 83/121 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+++IVEDN +NM+L  DL+E  G+   +  +G++ALE   + K D+I++D+QL ++ G
Sbjct: 3   MKEILIVEDNPMNMELILDLLEFYGHRVTEAEDGIKALERLAEKKFDIILLDMQLPKMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+  +IK++    +IPVIAVTA AMKG EE   + GC  YISKPI +  F   I KY+G
Sbjct: 63  LEVLDRIKKNPATADIPVIAVTAHAMKGSEEHFIEMGCVDYISKPIDIHRFRSLIDKYLG 122

Query: 122 E 122
           E
Sbjct: 123 E 123


>gi|254415932|ref|ZP_05029689.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196177359|gb|EDX72366.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1821

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 79/119 (66%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L  +++ EDNE N+    D + + G+  +  RNG+EA++ A+QH PDVI+MDIQ+ E+ G
Sbjct: 1701 LPLILLAEDNEANIITLTDYLHSKGFRVVLARNGIEAVQQAKQHTPDVILMDIQMPEMDG 1760

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            LE T+QI+ DS L  +P+IAVTA AM GD E+    G   Y++KPI L   +  I++Y+
Sbjct: 1761 LESTRQIRADSGLPRMPIIAVTALAMPGDREKCLAAGATEYMAKPIRLKKLVTLIEQYL 1819



 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 3/107 (2%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            + K ++VED++ +       +   G   L    G   ++  +Q  PDVII+DI L  ISG
Sbjct: 1571 IHKALVVEDSDASANHIARYLGELGITVLIHPQGEGTIDTVQQFNPDVIILDILLPHISG 1630

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
             E+  Q+KE+S  Q IPV+ V+      D  +  + G   Y+ KP+S
Sbjct: 1631 WEVLVQLKENSATQSIPVVVVSV---VDDPTQALELGAADYLLKPVS 1674


>gi|206889649|ref|YP_002248032.1| response regulator receiver [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741587|gb|ACI20644.1| response regulator receiver [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 125

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 80/120 (66%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++I EDNE N KL  D+ +  GY      NG E +E+A++ KPD+I+MD+Q+  + 
Sbjct: 1   MPYKILICEDNEKNRKLMEDIFKYHGYEVYLAANGKEGIEMAKRIKPDLILMDMQMPVLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  K+I++DSE++ I +IAVT++AM GD+ER+ + G + YI+KPI      E IKK I
Sbjct: 61  GFEAIKKIRQDSEIKHIKIIAVTSYAMSGDKERVLQAGADYYIAKPIDTRALPEIIKKII 120


>gi|332706440|ref|ZP_08426501.1| PAS domain S-box protein [Lyngbya majuscula 3L]
 gi|332354324|gb|EGJ33803.1| PAS domain S-box protein [Lyngbya majuscula 3L]
          Length = 1299

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 81/116 (69%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N+K   D + + GY  +  +NG EA+  A+++ P +I+MDIQ+ ++ G+E 
Sbjct: 1172 ILIAEDNETNIKTIWDYLLSKGYRLILAKNGWEAISQAKEYHPQLIMMDIQMPDMDGIEA 1231

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             K+I+++ + +EIP+IAVTA AM GD+E+    G + YISKP+SL   + TI++Y+
Sbjct: 1232 IKRIRDNQKTREIPIIAVTALAMPGDKEKCLGAGADEYISKPVSLKNLVSTIQQYV 1287



 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V+I+ED+    ++    I   G   L    G  ALE   Q  P VII+D+QL ++SG +
Sbjct: 1030 QVLIIEDSITAAEVISRYIREIGLQTLTYPEGEGALEQVIQVNPGVIILDLQLPKVSGWK 1089

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            +  Q+K   + Q IPV+ ++      +  +  + G   Y+ KP+S  +   TI K +G
Sbjct: 1090 VLAQLKAHPQTQHIPVMILSVV---DERSQALEMGASEYLVKPVSRQLLRSTISKILG 1144


>gi|322421478|ref|YP_004200701.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320127865|gb|ADW15425.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 129

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 80/118 (67%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IVEDN  N  L  D++   GY  L+ +NG+E +E+AR+H PD+++MDIQ+  + G 
Sbjct: 5   RTILIVEDNNSNRLLMSDILNYHGYTVLEAKNGIEGIEMARKHLPDLVLMDIQMPAMDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              + +K+D   +++ +IA+T+FAM+GD ERI   G + YI+KPI++  F + I+ Y+
Sbjct: 65  TAARILKDDPLTRQLRLIAITSFAMQGDRERILAAGFDDYIAKPIAIREFPQAIQSYL 122


>gi|323701833|ref|ZP_08113503.1| multi-sensor hybrid histidine kinase [Desulfotomaculum nigrificans
            DSM 574]
 gi|323533137|gb|EGB23006.1| multi-sensor hybrid histidine kinase [Desulfotomaculum nigrificans
            DSM 574]
          Length = 1274

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 77/119 (64%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            +  V++VEDN+ N +L + L+  +GY      NG +ALE+  Q   D+++MD+Q+  + G
Sbjct: 1052 ITNVLLVEDNQFNQRLIQHLLADNGYRVTLAENGQQALEMLNQSNFDIVLMDMQMPVMDG 1111

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I+ D   + +P+IA+TA AMKGD E+    GC+ Y++KP+   I ++TIKKYI
Sbjct: 1112 YETTRVIRSDERYKSLPIIALTAHAMKGDNEKCLAAGCDDYLAKPVKRDILIKTIKKYI 1170



 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ ED     +L  + +E +GY  + T  G +AL LA+ ++PDV+++DI L ++SG E+
Sbjct: 796 VLVAEDEWTTKQLIANYLEKAGYTVVATDQGKQALTLAKIYQPDVLVLDILLPDLSGWEV 855

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             +IK+D E Q+IPV+  +    K   ER    G   +I K +S  + +  ++K
Sbjct: 856 LAKIKKDQETQDIPVVVCSVLPEK---ERAFSLGAVDFIEKTVSEKVLVNRLQK 906


>gi|75910897|ref|YP_325193.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
 gi|75704622|gb|ABA24298.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
          Length = 1274

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 75/119 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N+K F   +   GY  L   NG +ALELA  H+PD+I+MDIQ+  I GLE 
Sbjct: 1154 ILLAEDNEANIKTFSSYLSAKGYGILLATNGEQALELATIHQPDLILMDIQMPGIDGLEA 1213

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +QI+ D EL  IP++A+TA AM GD +R  + G   Y++KP+ L     TI++ + E 
Sbjct: 1214 IRQIRLDPELVNIPIVALTALAMTGDRDRCLQAGANDYLTKPVKLKQLATTIQQLLMET 1272


>gi|88603926|ref|YP_504104.1| response regulator receiver domain-containing protein
           [Methanospirillum hungatei JF-1]
 gi|88189388|gb|ABD42385.1| response regulator receiver domain protein (CheY-like)
           [Methanospirillum hungatei JF-1]
          Length = 124

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 78/117 (66%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV+++EDN  NM L   L+E+ GY  ++  NG+  ++ A++ +PD+I++DIQL E+ 
Sbjct: 1   MTHKVLVIEDNAQNMYLIHFLLESQGYTVIEAENGLIGIQKAKEERPDIILLDIQLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           G EI + ++    +  IP+IAVT++AM GD+ERI   G   YI KPI+ + F++ IK
Sbjct: 61  GYEIARILRSTPGIDTIPIIAVTSYAMAGDKERILAAGATDYIEKPINPATFVDQIK 117


>gi|294494981|ref|YP_003541474.1| response regulator receiver protein [Methanohalophilus mahii DSM
           5219]
 gi|292665980|gb|ADE35829.1| response regulator receiver protein [Methanohalophilus mahii DSM
           5219]
          Length = 121

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 82/119 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++VEDN +NM+L  DL+E+ GY  +Q  +G +AL++  ++  D+I++D+QL ++ G
Sbjct: 1   MATILVVEDNPMNMELTVDLLESYGYEVMQAEDGSQALDVVEKNTFDLILLDMQLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE+ ++ KE    ++ PV+A+TA AM+GD+++    GC  YISKPI +  F +TI  Y+
Sbjct: 61  LEVLEKFKEIENSKDTPVVALTAHAMRGDDKKFINAGCAGYISKPIDIHEFQQTISSYV 119


>gi|56479139|ref|YP_160728.1| CheY-like domain-containing protein [Aromatoleum aromaticum EbN1]
 gi|56315182|emb|CAI09827.1| CheY-like response regulator domain [Aromatoleum aromaticum EbN1]
          Length = 131

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 80/120 (66%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++I ED+  +++L R L+  +GY  L   +G  ALELAR+H PD+II D+Q+ + +
Sbjct: 1   MAARILIAEDHPASLELLRYLLSANGYDILSAEDGEAALELARRHPPDLIICDLQMPKKN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +++K +  L  IPV+AVTAF+M GD E++   G + Y+SKPI    F+  I++Y+
Sbjct: 61  GYEVVRELKREPALAAIPVVAVTAFSMIGDREQVLAAGFDGYLSKPIEPEEFVALIEQYL 120


>gi|21228982|ref|NP_634904.1| response regulator [Methanosarcina mazei Go1]
 gi|20907523|gb|AAM32576.1| Response regulator [Methanosarcina mazei Go1]
          Length = 137

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 82/121 (67%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ++K +++VED+ + M+L R L+ T GY + + R+G EAL++ ++++ D+I++DIQL  + 
Sbjct: 12  VMKNILVVEDSAIIMELIRFLLTTFGYESKEARDGFEALKIVKENRFDLILLDIQLPGLD 71

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+IK   E+   PVIA+TA AM+GDE+R  K GC  YISKPI +      +   I
Sbjct: 72  GLEVLKEIKNLPEICRTPVIALTAHAMQGDEDRFLKAGCNGYISKPIEIERLKSMLDSCI 131

Query: 121 G 121
           G
Sbjct: 132 G 132


>gi|218779449|ref|YP_002430767.1| response regulator receiver protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760833|gb|ACL03299.1| Response regulator receiver domain protein (CheY-like)
           [Desulfatibacillum alkenivorans AK-01]
          Length = 122

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 79/118 (66%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+I+EDNE N+ L   L+E SGY     R+G +   +A   +PDVI++DIQL  + G 
Sbjct: 4   KKVLIIEDNEQNLYLITYLLENSGYEVTPARDGAQGCAMAEVVQPDVILLDIQLPGMDGY 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ K +++   ++E P++AVT++AM GD+E+    GC  YI KPI  ++F++ +++++
Sbjct: 64  EVAKALRKKPLVKETPIVAVTSYAMPGDKEKALSAGCTGYIEKPIDPAVFIDQLEEHL 121


>gi|213968376|ref|ZP_03396520.1| sensory box histidine kinase [Pseudomonas syringae pv. tomato T1]
 gi|301384642|ref|ZP_07233060.1| sensory box histidine kinase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058905|ref|ZP_07250446.1| sensory box histidine kinase [Pseudomonas syringae pv. tomato K40]
 gi|302133018|ref|ZP_07259008.1| sensory box histidine kinase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213927014|gb|EEB60565.1| sensory box histidine kinase [Pseudomonas syringae pv. tomato T1]
 gi|330873087|gb|EGH07236.1| sensory box histidine kinase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|331015225|gb|EGH95281.1| sensory box histidine kinase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 74/106 (69%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++GY  L   +    L++AR+ +PD+I+MDIQL ++ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLNSAGYGVLCASDAETGLKMARERQPDLILMDIQLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K D++   IPV+A+TA AMK DEE+IR+ GC AYI KP+
Sbjct: 61  LSATSLLKNDAQTAAIPVVALTAMAMKEDEEKIRRAGCNAYIIKPL 106


>gi|330963167|gb|EGH63427.1| response regulator receiver [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 129

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 74/106 (69%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++GY  L   +    L++AR+ +PD+I+MDIQL ++ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLNSAGYGVLCASDAETGLKMARERQPDLILMDIQLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K D++   IPV+A+TA AMK DEE+IR+ GC AYI KP+
Sbjct: 61  LTATSLLKNDAQTAAIPVVALTAMAMKEDEEKIRRAGCNAYIIKPL 106


>gi|308270676|emb|CBX27287.1| Polar-differentiation response regulator divK [uncultured
           Desulfobacterium sp.]
          Length = 120

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 76/120 (63%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++I+EDN+ N+ + R L+E SG+  +   NG + ++ A  HKP  I++DIQL E+ 
Sbjct: 1   MNGTLLIIEDNQQNLYMMRFLLEKSGFTVVGAENGRDGIDKALCHKPLAILLDIQLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  +  ++K+  EL E+P+IAVT++AM GD ERI   G   YI KPI    F+  I+KY+
Sbjct: 61  GYAVAAELKKHRELDEVPIIAVTSYAMVGDRERILAAGATGYIEKPIDPETFVGEIRKYL 120


>gi|17230612|ref|NP_487160.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17132215|dbj|BAB74819.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1286

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 74/116 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN+ N+K F   +   GY  L   NG +A+ELA  H+PD+I+MDIQ+  I GLE 
Sbjct: 1166 ILLAEDNKANIKTFSSYLSAKGYDILLATNGQQAIELATIHQPDLILMDIQMPGIDGLEA 1225

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             +QI+ D +L  IP++A+TA AM GD +R  + G   Y++KP+ L     TI++ +
Sbjct: 1226 IRQIRLDPQLVNIPIVALTALAMTGDRDRCLQAGANDYLTKPVKLKQLATTIQQLL 1281


>gi|320160595|ref|YP_004173819.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319994448|dbj|BAJ63219.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++ VEDN  N  L R L+   GY  ++  N   A+E+ +  KP +I+MDI + ++ G 
Sbjct: 5   KHILYVEDNPDNRMLVRRLLTAFGYEVIEAENATRAMEILKTTKPVLILMDINMPDVDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            +T +IK D EL  IPVIA+TA  MKGD ER    GC+ YI KPI +  F+E I++++ 
Sbjct: 65  TLTNRIKSDPELFNIPVIALTANVMKGDRERTLDAGCDGYIEKPIDVDRFIEQIERFLA 123


>gi|78223985|ref|YP_385732.1| response regulator receiver domain-containing protein [Geobacter
           metallireducens GS-15]
 gi|78195240|gb|ABB33007.1| response regulator receiver domain protein (CheY-like) [Geobacter
           metallireducens GS-15]
          Length = 122

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 77/120 (64%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++I+EDNE N+ L   ++E  GY      +G E + LA   +P +I++DIQL E+ 
Sbjct: 1   MNNKILIIEDNEQNLYLLSFILEKHGYEVFAAMDGFEGIALADSVRPTLILLDIQLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ ++++ +  L ++P++AVT++AM GD E+    GC  YI KPI+   FM+ +K+++
Sbjct: 61  GYDVARKLRANPSLADVPIVAVTSYAMAGDREKALIAGCSGYIEKPINPDTFMQQVKEHL 120


>gi|158523281|ref|YP_001531151.1| response regulator receiver protein [Desulfococcus oleovorans Hxd3]
 gi|158512107|gb|ABW69074.1| response regulator receiver protein [Desulfococcus oleovorans Hxd3]
          Length = 120

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 76/120 (63%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++EDN  N+ L R L+E +G+  +    G   +E A Q+KP  I++DIQL E+ 
Sbjct: 1   MNDTLLVIEDNAQNLYLMRFLLEKNGFSVIGAGTGRAGIEAALQNKPRAILLDIQLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  +  +IK+ +EL  +P+IAVT++AM GD ER+   G + YI KPI+   F+E I+ Y+
Sbjct: 61  GYAVAAEIKKHAELANVPIIAVTSYAMVGDRERVLAAGADGYIEKPINPETFVEEIRGYL 120


>gi|171056737|ref|YP_001789086.1| response regulator receiver protein [Leptothrix cholodnii SP-6]
 gi|170774182|gb|ACB32321.1| response regulator receiver protein [Leptothrix cholodnii SP-6]
          Length = 125

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 77/119 (64%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IVEDN  NMKL RD+++  G+  L+   G E ++LA   +PD+I+MDIQL +I G
Sbjct: 1   MSTILIVEDNARNMKLVRDILQHHGHSTLEAATGAEGVQLALAQRPDLILMDIQLPDIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +    +I+ D  L  +PV+AV+A  M  ++++I   G +AY++KP+SL  F+  +  ++
Sbjct: 61  ITALARIRADPALAAVPVLAVSASVMPDEQQKIVASGFDAYVTKPLSLRPFVAMVDSFL 119


>gi|206889241|ref|YP_002249148.1| two-component response regulator [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741179|gb|ACI20236.1| two-component response regulator [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 122

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 83/121 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++V+DNE + +L + +++  GY  ++  +G +A+  A  ++PD+I+MDI + +I G
Sbjct: 1   MKTILVVDDNEDSRELVKKILKKHGYEVIEAVDGEDAIAKALAYRPDLILMDISIPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+++KE  + ++ P+IA TA AM+GD+E+  + GC  YISKPI++  F E IK Y+ 
Sbjct: 61  YEATRRLKERPDFKDTPIIAFTAHAMRGDQEKALQAGCNGYISKPINVREFPEQIKIYLK 120

Query: 122 E 122
           E
Sbjct: 121 E 121


>gi|239617405|ref|YP_002940727.1| response regulator receiver protein [Kosmotoga olearia TBF 19.5.1]
 gi|239506236|gb|ACR79723.1| response regulator receiver protein [Kosmotoga olearia TBF 19.5.1]
          Length = 134

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 80/122 (65%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++++DNE N+ L   L+E+ GY  +   +G++ ++ A + KPD+I++DIQL E+ 
Sbjct: 1   MKKKVLVIDDNEQNLYLITFLLESKGYEVITAIDGIKGIKKAIEKKPDLILLDIQLPELD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ K+IK   E+  IP++AVT++AM  DEE+    GC  YI KP     F+  I+KY+
Sbjct: 61  GYEVAKRIKSIDEISHIPIVAVTSYAMPADEEKALAIGCVGYIKKPFFPENFIPEIEKYL 120

Query: 121 GE 122
            E
Sbjct: 121 FE 122


>gi|312960965|ref|ZP_07775470.1| response regulator receiver [Pseudomonas fluorescens WH6]
 gi|311284623|gb|EFQ63199.1| response regulator receiver [Pseudomonas fluorescens WH6]
          Length = 127

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 70/106 (66%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IVEDNE NM+L R L+ T+G+  L   +    L +AR+ KP +I+MDIQL  + G
Sbjct: 1   MATILIVEDNEANMRLARLLLVTAGHSVLWAADAETGLAMAREQKPALILMDIQLPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T+ +K+D     IPVIA+TA AMK D E+ R  GC+AY+ KP+
Sbjct: 61  LAATRLLKQDPHTAHIPVIALTAMAMKEDREKTRLAGCDAYVIKPL 106


>gi|237799881|ref|ZP_04588342.1| response regulator receiver [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331022736|gb|EGI02793.1| response regulator receiver [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 128

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 73/106 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  +   +    L+LAR+ +PD+I+MDIQL E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLNSAGHGVMCATDAETGLKLARERQPDLILMDIQLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D     IPVIA+TA AMK DEE+IR+ GC AYI KP+
Sbjct: 61  LSATFLLKQDVATAAIPVIALTAMAMKEDEEKIRRAGCNAYIIKPL 106


>gi|91774039|ref|YP_566731.1| response regulator receiver protein [Methanococcoides burtonii DSM
           6242]
 gi|91713054|gb|ABE52981.1| response regulator receiver [Methanococcoides burtonii DSM 6242]
          Length = 123

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 80/119 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VEDN +NM+L  +L+E+ GY   Q  +G  AL+  ++ K D+I++D+QL  + G
Sbjct: 1   MAQILVVEDNPMNMELTVNLLESWGYEVGQAEDGPIALDKVKEAKYDLILLDMQLPRMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE+   +KEDSE   IPV+A+TA +M GD+++    GC  YISKPI +  F + I +++
Sbjct: 61  LEVLSHLKEDSETAGIPVVALTAHSMAGDQDKFLDAGCTGYISKPIDIHEFKKRIVEFL 119


>gi|289678179|ref|ZP_06499069.1| response regulator receiver [Pseudomonas syringae pv. syringae FF5]
 gi|330938947|gb|EGH42438.1| response regulator receiver [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 129

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLTSAGHAVLSAVDAESGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPVIA+TA AMK D+E+IR  GC AY+ KP+
Sbjct: 61  LTATSLLKKDASTAAIPVIALTAMAMKEDKEKIRLAGCNAYVIKPL 106


>gi|116624973|ref|YP_827129.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228135|gb|ABJ86844.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 232

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 78/118 (66%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D  +N+KL R L+   GY  L   +  EALEL R ++P +++ DIQL  I GL
Sbjct: 4   EPILIVDDTPVNLKLTRILLVNEGYKVLTAASAEEALELLRGYQPRLVLADIQLPGIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+T++IK+D   ++  V+A+TAFAMKGDE+R  + GC+ Y+ KPI    F   I++ +
Sbjct: 64  EMTRRIKQDERTRDTLVVALTAFAMKGDEQRAIEAGCDGYLVKPIDTRSFGGKIRELL 121


>gi|298485837|ref|ZP_07003915.1| signal transduction response regulator receiver [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298159661|gb|EFI00704.1| signal transduction response regulator receiver [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 129

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 73/106 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L + L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTKLLLTSAGHSVLSAVDAETGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AYI KP+
Sbjct: 61  LSATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYIIKPL 106


>gi|330950939|gb|EGH51199.1| response regulator receiver [Pseudomonas syringae Cit 7]
          Length = 129

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLTSAGHAVLSAVDAESGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPVIA+TA AMK D+E+IR  GC AY+ KP+
Sbjct: 61  LTATSLLKKDAGTAAIPVIALTAMAMKEDKEKIRLAGCNAYVIKPL 106


>gi|302188803|ref|ZP_07265476.1| response regulator receiver [Pseudomonas syringae pv. syringae 642]
          Length = 129

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLTSAGHAVLSAVDAESGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPVIA+TA AMK D+E+IR  GC AY+ KP+
Sbjct: 61  LTATSLLKKDAGTAAIPVIALTAMAMKEDKEKIRLAGCNAYVIKPL 106


>gi|320162405|ref|YP_004175630.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319996259|dbj|BAJ65030.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 128

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 78/118 (66%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +++++EDN  N++L R L+E +G+  +   +G++ LE AR  KPD++++D+ L E+ G 
Sbjct: 5   NRILVIEDNADNLELVRFLLEQAGFQIISAMDGLDGLEKARSLKPDLVLLDMSLPELDGW 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + KQ+KE  E   I ++A+TA  + GD  R  + GC+ +ISKP++++ F   I++Y+
Sbjct: 65  HLAKQLKESPETAHILIVALTAHTLPGDRRRALEAGCDGFISKPLNVARFASQIQEYL 122


>gi|330895744|gb|EGH28033.1| response regulator receiver [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 129

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLTSAGHAVLSAVDAESGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPVIA+TA AMK D+E+IR  GC AY+ KP+
Sbjct: 61  LTATSLLKKDAGTAAIPVIALTAMAMKEDKEKIRLAGCNAYVIKPL 106


>gi|330890507|gb|EGH23168.1| sensory box histidine kinase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 129

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 73/106 (68%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +   +L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTELLLTSAGHSVLSAVDAETSLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AYI KP+
Sbjct: 61  LSATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYIIKPL 106


>gi|220906185|ref|YP_002481496.1| response regulator receiver protein [Cyanothece sp. PCC 7425]
 gi|219862796|gb|ACL43135.1| response regulator receiver protein [Cyanothece sp. PCC 7425]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 74/122 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +   GY      +G + +ELA    PD+I+MD+ L  I G
Sbjct: 1   MPKILLVEDNEMNRDMLSRRLTRKGYDVTIAVDGQQGVELAHTQTPDLILMDMSLPVIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+Q+K  S+ Q IPVIA+TA AM GD E+  + GC+ Y +KPI L   +  I+  +G
Sbjct: 61  WEATRQLKASSQTQAIPVIALTAHAMSGDREKALEAGCDDYDTKPIDLPQLLSKIEALLG 120

Query: 122 EA 123
           ++
Sbjct: 121 KS 122


>gi|219850003|ref|YP_002464436.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
 gi|219544262|gb|ACL26000.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
          Length = 1352

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 74/117 (63%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDNE+N+ +  + ++  GY     RNG EAL++A + +PD+IIMDIQ+ E+ GLE
Sbjct: 1229 RVLVAEDNEMNLMVLSEYLQAYGYEVCVARNGREALQVAAEWRPDLIIMDIQMPELDGLE 1288

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +Q++  +     P+IAVTA AM GD E+    G   Y++KPISL      I++ +
Sbjct: 1289 AIRQLRAQAAYATTPIIAVTALAMPGDREQCLLAGATDYLTKPISLRRLARHIERLL 1345



 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 35   GMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERI 94
            G  A+E     +PD+I++ +++ + SG EI   ++ D EL+ IPVI V+      + ER 
Sbjct: 1129 GNGAVEQVAAMRPDLIVLSVEIPDRSGWEILADLQRDPELRRIPVIVVSVV---DEPERG 1185

Query: 95   RKGGCEAYISKPISLSIFMETIKK 118
               G  AY+ KPI+ ++  + + +
Sbjct: 1186 FTAGAAAYLVKPINRAMLQQALSQ 1209


>gi|148263613|ref|YP_001230319.1| response regulator receiver protein [Geobacter uraniireducens Rf4]
 gi|146397113|gb|ABQ25746.1| response regulator receiver protein [Geobacter uraniireducens Rf4]
          Length = 124

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 74/120 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++VEDN+ NM+L    ++  GY  +    G E +ELA + +P  IIMDI L  I G
Sbjct: 1   MKKVLVVEDNKDNMRLITYALQKVGYEVIPAETGEEGVELAIRERPFFIIMDINLPGIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE T++I+       +P+IA+T++AM GD +R+ + GC AY  KPI     +E I K IG
Sbjct: 61  LEATRRIRASEADGSVPIIAITSYAMFGDRDRVLQAGCTAYFEKPIDPLTIVERIHKAIG 120


>gi|289623552|ref|ZP_06456506.1| sensory box histidine kinase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649157|ref|ZP_06480500.1| sensory box histidine kinase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330867855|gb|EGH02564.1| sensory box histidine kinase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 129

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTELLLTSAGHSVLSAVDAETGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AYI KP+
Sbjct: 61  LSATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYIIKPL 106


>gi|66044350|ref|YP_234191.1| response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255057|gb|AAY36153.1| Response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|330969227|gb|EGH69293.1| response regulator receiver [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 129

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLAELLLTSAGHTVLSAVDAETGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AY+ KP+
Sbjct: 61  LTATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYVIKPL 106


>gi|71736237|ref|YP_273434.1| sensory box histidine kinase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71556790|gb|AAZ36001.1| sensory box histidine kinase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320329811|gb|EFW85799.1| sensory box histidine kinase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330874309|gb|EGH08458.1| sensory box histidine kinase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 129

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTELLLTSAGHSVLSAVDAETGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AYI KP+
Sbjct: 61  LSATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYIIKPL 106


>gi|298676092|ref|YP_003727842.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
 gi|298289080|gb|ADI75046.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
          Length = 127

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 76/119 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VEDN  NM+L  DL+++ GY   +  +G  ALE  +  K D+I++D+QL ++ GLE
Sbjct: 7   NVLVVEDNVFNMELTVDLLKSYGYNVTKAEDGYIALEKLKNIKIDLILLDMQLPKMDGLE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +  ++K D E   IPV+A+TA AM GD++R    GC+ YISKP+ +  F   I +++  
Sbjct: 67  LLSKLKNDPETMNIPVVALTAHAMLGDKKRFIDAGCDGYISKPMDIYKFKSQIDQHLNN 125


>gi|300867967|ref|ZP_07112606.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
 gi|300333988|emb|CBN57784.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
          Length = 1102

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 76/115 (66%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L  +++ EDNE N+    + +E  GY      NG+EA+++AR+ KP++++MDIQ+  + G
Sbjct: 976  LPLILLAEDNEANISTIVEYLEAVGYRVATALNGVEAIQMARELKPNLVLMDIQMPAMDG 1035

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            LE T+Q++ D E  ++P+IA+T+ AM GD E+  + G   Y++KP+SL   +E I
Sbjct: 1036 LEATRQLRADVEFVQLPIIALTSLAMPGDREKCLEVGVNEYLAKPVSLKKLVEAI 1090



 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IV+D   N++L  DL+   GY       G  AL+ A+   PD+I++DI + E+ G E
Sbjct: 12  SILIVDDMVDNLRLLSDLLTEQGYKVRGVSKGTMALKAAKSFSPDLILLDIMMPEMDGYE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + + +K      +IP+I ++A     D+ +    G   YI+KP  +   +  +K ++
Sbjct: 72  VCQHLKAAENTCDIPIIFISALNDAADQLKAFAVGGVDYITKPFRIEEILARVKNHL 128



 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 59/123 (47%), Gaps = 14/123 (11%)

Query: 2   LKKVMIVEDN-----ELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQL 56
           + +V+IVED+     ++   L    I  S   +L T    EA+++     PD II+D+QL
Sbjct: 842 INQVLIVEDSAPAAEQIAHYLAELGINNSAIYSLGTGIVQEAIQI----NPDAIILDLQL 897

Query: 57  QEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEE-RIRKGGCEAYISKPISLSIFMET 115
            + SG ++  Q+K +   Q IP++ V+      DE  R        Y+ KP S   F   
Sbjct: 898 PDRSGWDVLAQLKAEPRTQNIPILIVSV----ADEPVRSPAASVYEYLVKPFSRHQFQLA 953

Query: 116 IKK 118
           ++K
Sbjct: 954 LRK 956


>gi|309789734|ref|ZP_07684314.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides DG6]
 gi|308228220|gb|EFO81868.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides DG6]
          Length = 1491

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 71/119 (59%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L ++++ EDNE+N+    D +   GY     RNG EA+ LA +  PD+I+MDIQ+ E+ G
Sbjct: 1369 LARILLAEDNEINITAIGDYLSDKGYTLTIARNGREAVALAHETHPDLILMDIQMPELDG 1428

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            L  T+Q++        P+IA+TA AM GD ER    G   Y++KPISL   +  I++ +
Sbjct: 1429 LSATRQLRATPTFATTPIIALTALAMPGDRERCLAAGANEYMAKPISLRSLVLVIEQLL 1487



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 9/118 (7%)

Query: 2    LKKVMIVEDNELN-MKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
             +  +++ED+E +  ++ R L E      + +R G  AL+      PDVI +DIQL + S
Sbjct: 1228 FRTALVIEDSETSGEQIARYLGELRIDTTIHSR-GAGALDRVLSVHPDVIFLDIQLPDQS 1286

Query: 61   GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKPISLSIFMETI 116
            G E+ + +K D  L+ IPVI ++       ++RIR    G  AY+ KPI+  I   T+
Sbjct: 1287 GWEVLEHLKADPHLRSIPVIIISVL-----DDRIRGMAAGASAYLVKPITRDILRHTL 1339


>gi|229590585|ref|YP_002872704.1| putative two-component response regulator transcriptional
           regulatory protein [Pseudomonas fluorescens SBW25]
 gi|229362451|emb|CAY49357.1| putative two-component response regulator transcriptional
           regulatory protein [Pseudomonas fluorescens SBW25]
          Length = 127

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IVEDNE NM+L R L+  +G+  L   +    L LAR+ +P +I+MDIQL  + G
Sbjct: 1   MANILIVEDNEANMRLARLLLVNAGHTVLWAPDAETGLTLAREQQPALILMDIQLPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K D     IPVIA+TA AMK D E+ R  GC+AYI KP+
Sbjct: 61  LAATALLKRDPLTAHIPVIALTAMAMKEDREKTRLAGCDAYIIKPL 106


>gi|320322880|gb|EFW78971.1| sensory box histidine kinase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 129

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 71/106 (66%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LAR+ +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTELLLTSAGHSVLSAVDAETGLKLARERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA  MK D+E+IR  GC AYI KP+
Sbjct: 61  LSATALLKKDAGTAAIPVVALTAMTMKEDKEKIRLAGCNAYIIKPL 106


>gi|209528442|ref|ZP_03276872.1| response regulator receiver protein [Arthrospira maxima CS-328]
 gi|284054062|ref|ZP_06384272.1| response regulator receiver protein [Arthrospira platensis str.
           Paraca]
 gi|209491121|gb|EDZ91546.1| response regulator receiver protein [Arthrospira maxima CS-328]
 gi|291571977|dbj|BAI94249.1| two-component response regulator (CheY subfamily) [Arthrospira
           platensis NIES-39]
          Length = 125

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 74/119 (62%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  + +  +   GY  L   +G E + LA+   PD+I+MD+ L    G
Sbjct: 1   MAKILLVEDNEMNRDMLKRRLSRKGYDVLIAEDGAEGVNLAQTQAPDLILMDMSLPIKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + T++IK D++ +EIPVIA+TA AM GD E+    GC+ Y +KP+     +E I+ ++
Sbjct: 61  WQATREIKADTKTKEIPVIALTAHAMAGDREKCLAAGCDDYDTKPVEFPRLLEKIETHL 119


>gi|309790923|ref|ZP_07685465.1| two-component hybrid sensor and regulator [Oscillochloris trichoides
            DG6]
 gi|308227037|gb|EFO80723.1| two-component hybrid sensor and regulator [Oscillochloris trichoides
            DG6]
          Length = 1010

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 75/119 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +++++VEDN +N+    D + + GY      NG EAL+   Q +P++I+MDIQ+  + G+
Sbjct: 892  RRILLVEDNTVNILTISDYLHSRGYTVAVANNGQEALDSIEQAQPELILMDIQMPVMDGI 951

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T++++      EIP+IA+TA AM GD ER    G  AY++KPISL   ++ I++ + 
Sbjct: 952  EATRRLRAMPAYSEIPIIALTALAMPGDRERCLAAGANAYLTKPISLRHLVQMIEEMVA 1010


>gi|258592022|emb|CBE68327.1| Response regulator receiver protein [NC10 bacterium 'Dutch
           sediment']
          Length = 126

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 76/117 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VEDN LN ++   ++E  GY  L+  +G+  +E  +  +P +IIMD+QL +I G  
Sbjct: 5   KILVVEDNPLNREMIITVLEAYGYTVLEAEDGLGLMERVKAERPGLIIMDLQLPKIDGFA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +T+ +K D+  ++IPV+A +AFA   D+      GC  +++KP+ L++ ++T+ +++
Sbjct: 65  LTRNLKADASTRDIPVVAASAFAKSEDQALALDAGCAFFLTKPLDLTVLLQTVARFL 121


>gi|298674027|ref|YP_003725777.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
 gi|298287015|gb|ADI72981.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
          Length = 131

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 76/120 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VED+ LN +L  D +   GY  +   +G EALE    +  D+I++DIQL +++GLE
Sbjct: 5   NILLVEDDRLNRELISDFLNPHGYNIINAEDGFEALEKLEDYYVDLILLDIQLPQMNGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
              ++K +    +IPV+A+TA AM GD+++    GC+ YI KPI++ +F   +K+++  +
Sbjct: 65  FIYKLKNNFLFTDIPVVALTAHAMLGDKKKFIDAGCDGYIPKPINVDVFESQVKQHLKNS 124


>gi|170739809|ref|YP_001768464.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168194083|gb|ACA16030.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 119

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 75/120 (62%), Gaps = 1/120 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+++IVED  LN  L   L+E   Y  +   +G   +E+A  H+PD+I+MD+ L  + G
Sbjct: 1   MKRILIVEDVALNRDLLTQLLEDD-YDLVVAVDGAAGVEMALTHQPDLILMDLSLPLLDG 59

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+ IK ++    IPV+AVTA AM GDEER +  GC+ +++KPI   +    +++++G
Sbjct: 60  WEATRCIKANAATAGIPVVAVTANAMSGDEERAKAAGCDDFMTKPIDEDLLFAKLRRWMG 119


>gi|309790682|ref|ZP_07685233.1| response regulator receiver protein [Oscillochloris trichoides DG6]
 gi|308227276|gb|EFO80953.1| response regulator receiver protein [Oscillochloris trichoides DG6]
          Length = 125

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+I+EDN  N++L   L++  G+      +GM  L L +   P VI+ DIQ+  + GL +
Sbjct: 4   VLIIEDNPANLELMHYLLDAFGHEVRSATDGMTGLTLIQHDPPAVIVCDIQIPHLDGLAL 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +++K D  L+ IP+IAVTA AM GD ERI + G + YI KPI+   F++ ++ ++G+
Sbjct: 64  ARRLKADPALRHIPLIAVTAQAMVGDRERILEVGFDGYIPKPINPECFVQQVEAFLGQ 121


>gi|297537735|ref|YP_003673504.1| response regulator receiver protein [Methylotenera sp. 301]
 gi|297257082|gb|ADI28927.1| response regulator receiver protein [Methylotenera sp. 301]
          Length = 121

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 78/121 (64%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +   +I+EDNE N++L R ++E S Y       G+E ++ A    PD +I+DIQL +I+G
Sbjct: 1   MTTALIIEDNENNLELIRFILEQSQYKTRFAMTGLEGVQQALTMPPDFVILDIQLPDING 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I+     ++IP+IA+T++AM GD+E++   GC AYI KPI   + +  I+K I 
Sbjct: 61  LEVLKRIRAHPVGKDIPIIAMTSYAMSGDKEKLLAAGCTAYIEKPIDPILVIGQIQKAIA 120

Query: 122 E 122
           +
Sbjct: 121 K 121


>gi|170746663|ref|YP_001752923.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653185|gb|ACB22240.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 139

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+++IVED  LN  L   L+E   Y  L   +G + +++A  H+PD+I+MD+ L  + G
Sbjct: 21  MKRILIVEDVALNRDLLTQLLEDE-YEILIAVDGADGVDMAIAHRPDLILMDLSLPLVDG 79

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T++IK ++    IPV+A+TA AM GDE+R R  GC+ +++KP+   +    ++ ++G
Sbjct: 80  WEATRRIKANATTSAIPVMAITANAMSGDEDRARAAGCDDFMTKPVDEDLLFAKLQHWLG 139


>gi|304406283|ref|ZP_07387940.1| response regulator receiver protein [Paenibacillus curdlanolyticus
           YK9]
 gi|304344867|gb|EFM10704.1| response regulator receiver protein [Paenibacillus curdlanolyticus
           YK9]
          Length = 121

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 72/120 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++VEDNELN  +    +   G+  L   +G E ++LA QH+PD+I+MD+ L  + G
Sbjct: 1   MHTILLVEDNELNRDMLTRRLNRKGFQILTAEDGKEGVDLAIQHRPDLILMDLSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+ +K   + ++IPVIA+TA AM GDE    + GC+ + +KP+ L   +  I   +G
Sbjct: 61  WEATRLLKSTDDTKQIPVIALTAHAMAGDEAEAYRAGCDDFDTKPVDLERLLNKINAALG 120


>gi|196231317|ref|ZP_03130176.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
 gi|196224653|gb|EDY19164.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
          Length = 127

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++ EDN  N  L   L+E +GY  +  +NG EAL LA   +PD+++MD+Q+ E+ 
Sbjct: 1   MSAKILLAEDNAANRYLETFLLEKAGYTVIHAQNGAEALRLALADQPDLVLMDLQMPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  ++I  +  L E P++AVT+FAM  D E+  + G   YI KPI    F   I +++
Sbjct: 61  GYESARRIHAEPRLAETPIVAVTSFAMTRDREKALQFGFAGYIEKPIRPQTFAAEISQFL 120


>gi|85860640|ref|YP_462842.1| response regulator receiver domain-containing protein [Syntrophus
           aciditrophicus SB]
 gi|85723731|gb|ABC78674.1| response regulator receiver domain [Syntrophus aciditrophicus SB]
          Length = 135

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IVEDNE+N  +    +E  G+  +   +G+E + +AR   PD+I+MD+ L  + G
Sbjct: 8   MAKLLIVEDNEMNRDMLTRRLERKGFTTVVAVDGVEGIAMARSEAPDLILMDMSLPVLDG 67

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            E T+++K   E + IP+IA+TA AM+ D ER  + GC+ Y SKPI     +E I
Sbjct: 68  WEATRRLKAAQETRTIPIIALTAHAMESDRERALRAGCDEYDSKPIEFPRLLEKI 122


>gi|163845997|ref|YP_001634041.1| histidine kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222523722|ref|YP_002568192.1| multi-sensor hybrid histidine kinase [Chloroflexus sp. Y-400-fl]
 gi|163667286|gb|ABY33652.1| Histidine kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222447601|gb|ACM51867.1| multi-sensor hybrid histidine kinase [Chloroflexus sp. Y-400-fl]
          Length = 1347

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 73/121 (60%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +++++ EDNE+N     D +   GY       G EAL++A + +PD+IIMDIQ+  + GL
Sbjct: 1223 RRILLAEDNEVNRVTLSDYLVAQGYEVRVACQGKEALQIAAEWRPDLIIMDIQMPGLDGL 1282

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            E+ ++++ D+     P+IAVTA AM GD ER    G   Y +KPI L   +E I++++  
Sbjct: 1283 EVIQRLRADAAFAATPIIAVTALAMPGDRERCLSAGANDYFAKPIRLRQLVERIEQFLAS 1342

Query: 123  A 123
            +
Sbjct: 1343 S 1343



 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 6    MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
            +I+ED+          +E      +    G  A+E  +  +PD+I++D+Q+ + SG EI 
Sbjct: 1096 LIIEDSATTADQLARYLEELQIQPVICSYGKGAVEQVQALRPDLILLDVQMPDRSGWEIL 1155

Query: 66   KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
              ++ D +L+++PVI V+      + ER    G  AY+ KPI+
Sbjct: 1156 ADLRRDPDLRQVPVIIVSVV---DEPERGLAAGAAAYLVKPIN 1195


>gi|119487003|ref|ZP_01620875.1| two-component response regulator [Lyngbya sp. PCC 8106]
 gi|119455932|gb|EAW37066.1| two-component response regulator [Lyngbya sp. PCC 8106]
          Length = 125

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 75/122 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N+ + +  +   GY  L   +G + +EL+R  +PD+I+MD+ L  + G
Sbjct: 1   MAKILLVEDNEMNLDMLKRRLSRKGYELLIAVDGAQGVELSRSDQPDIILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T++I+     + IPVIA+TA AM GD E+    GC+ Y +KPI     +E I+  + 
Sbjct: 61  WQATREIRNYPNTKHIPVIALTAHAMAGDREKCMAAGCDDYDTKPIEFPRLLEKIETLLK 120

Query: 122 EA 123
           +A
Sbjct: 121 KA 122


>gi|171060843|ref|YP_001793192.1| response regulator receiver protein [Leptothrix cholodnii SP-6]
 gi|170778288|gb|ACB36427.1| response regulator receiver protein [Leptothrix cholodnii SP-6]
          Length = 128

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 77/120 (64%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++EDNE N+ L + L+ ++G+  L  R+G++ ++ AR   PD+++ D+Q+  + 
Sbjct: 1   MAACILVIEDNEANLALVQYLLASAGHRVLLARDGVDGVQAARMALPDLVVCDLQMPRLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + ++ D   ++IPV+AVTAF+M  D ER+   G + Y++KPI   +F+  I+ ++
Sbjct: 61  GYGVLQALRADPGTRDIPVVAVTAFSMADDRERVSLAGFDGYLTKPIEPELFIGQIESFL 120


>gi|257487364|ref|ZP_05641405.1| sensory box histidine kinase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330988051|gb|EGH86154.1| sensory box histidine kinase [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331009037|gb|EGH89093.1| sensory box histidine kinase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 129

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 71/106 (66%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+EDN  NM+L   L+ ++G+  L   +    L+LA + +PD+I+MDI L E+ G
Sbjct: 1   MAQILIIEDNAANMRLTELLLTSAGHSVLSAVDAETGLKLALERQPDLILMDIHLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L  T  +K+D+    IPV+A+TA AMK D+E+IR  GC AYI KP+
Sbjct: 61  LIATALLKKDAGTAAIPVVALTAMAMKEDKEKIRLAGCNAYIIKPL 106


>gi|302339340|ref|YP_003804546.1| PAS/PAC sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
 gi|301636525|gb|ADK81952.1| PAS/PAC sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
          Length = 753

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 75/116 (64%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++ EDN LN +L + LI + G+  +   NG+EA+ L  + K D++++D+ +  + GL
Sbjct: 636 KTILVAEDNGLNQELMKLLIRSMGHHCIVVGNGLEAITLLEKEKFDLLLLDMHMPVMDGL 695

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           E  + I++   L ++PVIA+TA AMKGDEER  + GC  Y+SKPI   +  E I++
Sbjct: 696 ETIENIRKSPALSDLPVIALTASAMKGDEERFIEAGCNGYLSKPIDRKLLAEMIER 751


>gi|116623387|ref|YP_825543.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226549|gb|ABJ85258.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 125

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 73/122 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VEDNE+N  +    +   G+      +G   ++ A   KPD+++MD+ L  + G
Sbjct: 1   MAKVLLVEDNEMNRDMLSRRLMRQGFEVTVAVDGQAGVDAAHSGKPDIVLMDMSLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+Q+K +   + IPVIA+TA AM GD ++    GC+ Y +KPI L   +E +++ +G
Sbjct: 61  WEATRQLKANDATRAIPVIALTAHAMAGDRQQALDAGCDDYDTKPIELPRLLEKMRRLLG 120

Query: 122 EA 123
           EA
Sbjct: 121 EA 122


>gi|329896810|ref|ZP_08271726.1| response regulator receiver domain protein (CheY-like) [gamma
           proteobacterium IMCC3088]
 gi|328921565|gb|EGG28945.1| response regulator receiver domain protein (CheY-like) [gamma
           proteobacterium IMCC3088]
          Length = 122

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 71/116 (61%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++VEDNELN  +    +   G+  +   +G+EALE  RQH+PDV++MD+ L  +S
Sbjct: 1   MSTKLLLVEDNELNRDMLTRRLLRKGFEVVTAEDGLEALEQMRQHQPDVVLMDLNLPVLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           G E  K    D +L  IP++A+TA A++ + E+    GC+ Y +KPI   + +E I
Sbjct: 61  GWEACKIAANDPDLAHIPMLALTAHALEQELEKALDAGCKDYATKPIDFPVLLEKI 116


>gi|256829012|ref|YP_003157740.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
 gi|256578188|gb|ACU89324.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
          Length = 1044

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 78/119 (65%), Gaps = 3/119 (2%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++ ED+E+N+   R+L+  +G+  +   NG E LE   +   D+++MDIQ+ E+ G+
Sbjct: 921  RKILVAEDDEVNLFAVRNLLTKNGHEVVTAHNGHEVLERIMEQDFDLVLMDIQMPEMDGI 980

Query: 63   EITKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            E T++I+   + +  + +P+IA+TA+AM GD E++   G + Y+SKP S+   ME IK+
Sbjct: 981  EATRRIRVTEQATGKKPVPIIAMTAYAMNGDREKLLDKGVDGYVSKPFSIKTLMEVIKE 1039


>gi|167945734|ref|ZP_02532808.1| sensor histidine kinase with ATPase domain, two fused [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 415

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 78/119 (65%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDN +N ++  +L+++ G + L   +G  AL   ++   D+++MD+Q+  + G E
Sbjct: 253 KVLLVEDNPINQQVALELLQSFGLLVLVAEDGRAALRRLQESAFDLVLMDVQMPLMDGYE 312

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+QI++  ELQ++PVIA+TA AM GD E+    G   Y+SKPI  +  + T++ ++GE
Sbjct: 313 TTRQIRQQPELQQLPVIAMTAHAMSGDREKCLDAGMSDYLSKPIDPAKLLATLRHWLGE 371



 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL---------ARQHKPDVIIMDI 54
           +V++V+DN +   +  D++ +  +      N  EA EL         A+     +++MD 
Sbjct: 102 RVLLVDDNPMVRTVLADMLRSFSFEVEVGANAAEAYELLMGAGAVGLAKPKPFQLVLMDW 161

Query: 55  QLQEISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFM 113
            +  ++G++  + IK++  L + P +I VTAF  +   ++ +  G +A + KP + S+  
Sbjct: 162 HMPPVNGIDAVQHIKQELALVQQPKMILVTAFGREELMQQSQAAGLDAVLLKPANPSLLF 221

Query: 114 ETIKKYIGEA 123
           +TI     E+
Sbjct: 222 DTIMSVFKES 231


>gi|81300626|ref|YP_400834.1| response regulator receiver domain-containing protein
           [Synechococcus elongatus PCC 7942]
 gi|81169507|gb|ABB57847.1| response regulator receiver domain protein (CheY-like)
           [Synechococcus elongatus PCC 7942]
          Length = 121

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE N  +    +   G+  +   +G   ++ AR+ +PD+I+MD+ L  + G
Sbjct: 1   MTKILLVEDNEDNWDMLSRRLTRKGFEVVLAHDGAAGVDTARREQPDLILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T+Q+K D ELQ+ PVIA+TA AM  D E+    GC+ Y +KPI L   +  I + +
Sbjct: 61  WEATRQLKADPELQQTPVIALTAHAMASDREKAIAAGCDDYDTKPIELPRLLSKIAQLL 119


>gi|300869422|ref|ZP_07114007.1| two-component hybrid sensor and regulator (fragment) [Oscillatoria
           sp. PCC 6506]
 gi|300332552|emb|CBN59205.1| two-component hybrid sensor and regulator (fragment) [Oscillatoria
           sp. PCC 6506]
          Length = 237

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 72/120 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L  +++ EDNE N+      ++  GY  +  +NG EA+ LA+   P++I+MDIQ+  + G
Sbjct: 116 LPLILLAEDNEANISTVSSYLKAKGYRIVLAKNGEEAIALAKSENPNLILMDIQMPGMDG 175

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE  +QI+ D +L ++P+IA+TA AM  D +R    G   YISKP+ L     TI++ + 
Sbjct: 176 LEAMQQIRLDPKLVKVPIIALTALAMSSDRDRCLAAGANDYISKPVKLKQLAATIQQLLA 235


>gi|56752286|ref|YP_172987.1| two-component response regulator [Synechococcus elongatus PCC 6301]
 gi|24251267|gb|AAN46187.1| unknown protein [Synechococcus elongatus PCC 7942]
 gi|56687245|dbj|BAD80467.1| two-component response regulator [Synechococcus elongatus PCC 6301]
          Length = 126

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE N  +    +   G+  +   +G   ++ AR+ +PD+I+MD+ L  + G
Sbjct: 6   MTKILLVEDNEDNWDMLSRRLTRKGFEVVLAHDGAAGVDTARREQPDLILMDMSLPVMDG 65

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T+Q+K D ELQ+ PVIA+TA AM  D E+    GC+ Y +KPI L   +  I + +
Sbjct: 66  WEATRQLKADPELQQTPVIALTAHAMASDREKAIAAGCDDYDTKPIELPRLLSKIAQLL 124


>gi|254410199|ref|ZP_05023979.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196183235|gb|EDX78219.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1855

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 70/105 (66%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N +   D ++  GY  +  ++G EA++L+++ KPD+I+MDIQ+ E+ GL  
Sbjct: 1738 ILLAEDNEANTQTLSDYLQGIGYEMIMAKDGKEAVQLSQRRKPDLILMDIQMPELDGLSA 1797

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T+QI+ +     IP+IA+TA AM GD E+    G   Y++KP++L
Sbjct: 1798 TQQIRANPRTATIPIIAITALAMSGDREKCLAAGVSYYMTKPVNL 1842


>gi|39995983|ref|NP_951934.1| response regulator [Geobacter sulfurreducens PCA]
 gi|39982748|gb|AAR34207.1| response regulator [Geobacter sulfurreducens PCA]
 gi|298504998|gb|ADI83721.1| response regulator, PilZ domain-containing [Geobacter
           sulfurreducens KN400]
          Length = 248

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 72/117 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D  L ++L + L+  S       RNG EALEL R  +PD++ MD+ + +++G++
Sbjct: 5   KVLIVDDVNLMLELEKSLLRFSPVRVFTARNGEEALELVRSERPDLVYMDLNMPKMNGVD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               IK D EL++ PVI VT      D+E   + GC+ YI+KP+   +F+E  ++YI
Sbjct: 65  CCIAIKSDPELRDTPVIMVTTAGKPEDQELCARAGCDGYITKPVDRRLFLEIGRRYI 121


>gi|159897748|ref|YP_001543995.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890787|gb|ABX03867.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 126

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 70/116 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ +EDN  NM L   L+   G   L+  NG   +ELA  H P +I++DI L +I G E+
Sbjct: 6   VLYIEDNPDNMLLVERLLIARGCQMLKAINGSTGIELALAHNPQIILLDINLPDIDGYEV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +++++  +   IP++AVTA A+KGD E+    GC+ Y+SKPI+L      + ++I
Sbjct: 66  ARRLRDAPQTATIPIVAVTANALKGDAEKAIAAGCDGYVSKPINLRDLWNAMLQFI 121


>gi|219854352|ref|YP_002471474.1| hypothetical protein CKR_1009 [Clostridium kluyveri NBRC 12016]
 gi|219568076|dbj|BAH06060.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 657

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 81/121 (66%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IVEDNE+NM++   +++  GY  L   NG +AL++      D+I+MDIQ+ E++GL
Sbjct: 538 KNILIVEDNEINMQIACGMLKKLGYNFLSAYNGNQALKILETMSVDLILMDIQMPELNGL 597

Query: 63  EITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           E TK I+++ EL E   +P+IA+TA+AM GD E   +GG + YISKP  + I    ++++
Sbjct: 598 ETTKIIRKN-ELHEKCHMPIIAMTAYAMPGDRELCIEGGMDDYISKPFDIYILKNILQRF 656

Query: 120 I 120
           +
Sbjct: 657 L 657


>gi|193084070|gb|ACF09740.1| chemotaxis protein CheV [uncultured marine group III euryarchaeote
           AD1000-40-D7]
          Length = 119

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 75/118 (63%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +   GY  +   +G EA+++A+   PDVI+MD+ L    G
Sbjct: 1   MTKILLVEDNEMNKDMLSRRLMKKGYDVVFAMDGQEAIDMAQSETPDVILMDMGLPVKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           L+ TK+IKE+S+   IPVIA+TA AM    ++   GGC+ Y +KP+ L   +E I+++
Sbjct: 61  LQATKEIKENSDTANIPVIALTANAMAEHRQQALDGGCDEYETKPVRLPSLLEKIEQF 118


>gi|157963514|ref|YP_001503548.1| PAS/PAC sensor hybrid histidine kinase [Shewanella pealeana ATCC
            700345]
 gi|157848514|gb|ABV89013.1| PAS/PAC sensor hybrid histidine kinase [Shewanella pealeana ATCC
            700345]
          Length = 1234

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 77/118 (65%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY      NG  AL++  + K D ++MDIQ+  + GL  
Sbjct: 1112 VLLVEDNFINQQVATELLKSAGYTVDVAENGQIALDMLDKAKYDAVLMDIQMPVMDGLTA 1171

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            TK++++   + E+PVIA+TA AM GD E+    G  A+I+KPI L+   +T+  +IGE
Sbjct: 1172 TKELRKRYPVDELPVIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFDTLSHWIGE 1229



 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 64/124 (51%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++++DN   ++++  ++    +      +G E L    ++  D++++D  + E+ G+E
Sbjct: 968  KTLVIDDNPTALQIYSSVMRDFHFNVDTAASGPEGLYKLSKNPVDLLLLDWMMPEMDGVE 1027

Query: 64   ITKQIKE---DSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            + KQI +   D  L++ P +I +TA+  +  ++ +      A + KP  + S+F E I  
Sbjct: 1028 VIKQIDQMVADGRLEKRPIIIMMTAYTAEPMQKDVEAANVFALLQKPFKASSLFDEIISA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|153953733|ref|YP_001394498.1| sensor protein [Clostridium kluyveri DSM 555]
 gi|146346614|gb|EDK33150.1| Predicted sensor protein [Clostridium kluyveri DSM 555]
          Length = 652

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 81/121 (66%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IVEDNE+NM++   +++  GY  L   NG +AL++      D+I+MDIQ+ E++GL
Sbjct: 533 KNILIVEDNEINMQIACGMLKKLGYNFLSAYNGNQALKILETMSVDLILMDIQMPELNGL 592

Query: 63  EITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           E TK I+++ EL E   +P+IA+TA+AM GD E   +GG + YISKP  + I    ++++
Sbjct: 593 ETTKIIRKN-ELHEKCHMPIIAMTAYAMPGDRELCIEGGMDDYISKPFDIYILKNILQRF 651

Query: 120 I 120
           +
Sbjct: 652 L 652


>gi|134299991|ref|YP_001113487.1| multi-sensor hybrid histidine kinase [Desulfotomaculum reducens MI-1]
 gi|134052691|gb|ABO50662.1| PAS/PAC sensor hybrid histidine kinase [Desulfotomaculum reducens
            MI-1]
          Length = 1271

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++VEDN  N +L   ++ +  Y  ++  NG++ALE+  + K D+++MD+Q+  + G E
Sbjct: 1047 KILLVEDNHFNQRLVTHML-SDDYSIVEVENGVQALEILEEQKFDLVLMDMQMPVMDGYE 1105

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T+ I++ ++ + +P+IA+TA+AMKGD E+    GC  Y++KP+     ++TIK+
Sbjct: 1106 TTRLIRKQNKYKNLPIIALTAYAMKGDSEKCMAAGCNGYLAKPVKRDQLIKTIKQ 1160



 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 68/116 (58%), Gaps = 3/116 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED+    +L  + +E  GY  + T+ G +A+ LA+ ++PDV+I+DI L +++G EI
Sbjct: 791 VLVVEDDWTTKQLISNYLEKVGYSVITTQQGKQAITLAKIYRPDVMILDILLPDLTGWEI 850

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            K+IK   E ++IP++  +    K   E+    G   +I KPIS  + +  + K I
Sbjct: 851 LKRIKTYEETKDIPIVVCSVMPEK---EQAFSLGAVDFIEKPISEKVLISRLGKLI 903



 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGY-IALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++++D E  ++  + +IE  GY      R G     L +      I++D+ +  ++G E
Sbjct: 913  IVLIDDEEATLQFLKKIIENEGYRTHTFARAGDAFYYLMQGGAVHAILLDLLMPGMNGFE 972

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
              + ++   E ++IPVI  TA  +   + +     CE  ++K +
Sbjct: 973  FLESLRLKPEFRDIPVIINTAKDLTQKDYQKLNLKCEKILNKSL 1016


>gi|119897782|ref|YP_932995.1| polar differentiation response regulator [Azoarcus sp. BH72]
 gi|119670195|emb|CAL94108.1| probable polar differentiation response regulator [Azoarcus sp.
           BH72]
          Length = 131

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 79/120 (65%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++ EDN  N++L R L+  +G+  + T +G+ ALE A++  PD+II D+Q+  + 
Sbjct: 2   MGARILVAEDNLANLELVRYLLSRAGHEVITTADGLAALEEAQRAVPDLIISDLQMPRMD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++  +++ D  L+ +PVIA+TAF+M GD  ++ + G ++Y+SKP+    F+  ++ ++
Sbjct: 62  GYQLLARLRGDPALRAVPVIALTAFSMPGDRVKVMQAGFDSYMSKPLVPETFVAQVEAWL 121


>gi|20091094|ref|NP_617169.1| response regulator receiver [Methanosarcina acetivorans C2A]
 gi|19916192|gb|AAM05649.1| response regulator receiver [Methanosarcina acetivorans C2A]
          Length = 127

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 77/111 (69%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++VED+ + ++L    + +SGY + +T +G +AL++A +++ D+I++D QL    G
Sbjct: 3   MKSILVVEDSPVILELISFFLTSSGYESRETGDGFDALKIAEENRFDLILLDKQLPGFDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIF 112
           LE+ K+IK+  E+++  VIA+ A AM+GDE+R  K GC  YISKPI +  F
Sbjct: 63  LEVLKKIKKIFEIRKTSVIALMAHAMQGDEDRFLKAGCNGYISKPIDIDRF 113


>gi|307153867|ref|YP_003889251.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306984095|gb|ADN15976.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1486

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 70/105 (66%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N+    + ++   Y  +  +NG EA+ LA+  +PD+I+MDI L  I+GLE 
Sbjct: 1370 ILLAEDNETNITTISNYLKAKKYKLILAKNGKEAISLAQSQQPDLILMDICLPGINGLEA 1429

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             +QI++  +L++IP+IAVTA A+ GD ER  + G   Y+SKP+ L
Sbjct: 1430 IQQIRQLPDLKDIPIIAVTALALTGDRERCLEAGANEYLSKPLKL 1474


>gi|323139255|ref|ZP_08074309.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
 gi|322395476|gb|EFX98023.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
          Length = 132

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 74/115 (64%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    ++ +GY  +   +G + +E+A    PD+I+MD+ L  I G
Sbjct: 10  VAKILLVEDNEMNRDMLSRRLKRNGYDVVIAVDGRQGVEMAASETPDLILMDMSLPVIDG 69

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            E T+Q+K++   ++IPVIA+TA AM GD E+  + GCE Y +KP+ ++  +  I
Sbjct: 70  WEATRQVKQNQATRKIPVIALTAHAMAGDREKAIEAGCEDYDTKPVEITRLLGKI 124


>gi|269839727|ref|YP_003324419.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791457|gb|ACZ43597.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 129

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 77/119 (64%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETS-GYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++IV+DN + + L RD +E    Y  L T +  E L+L R+  PD+++MD+Q+ ++ G 
Sbjct: 5   KILIVDDNPVALSLMRDTLELEESYEVLTTSDPREVLQLCREQLPDLVLMDLQMPKMDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMK-GDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+T+++K D+  ++IPV+A+TA  +   D  R  + GC  Y+ KP+  S+ +E +++Y+
Sbjct: 65  EVTRRLKADARTRDIPVVALTASRLSVEDMGRAMEAGCAGYLQKPVPRSLLLEAVQRYL 123


>gi|217969789|ref|YP_002355023.1| response regulator receiver protein [Thauera sp. MZ1T]
 gi|217507116|gb|ACK54127.1| response regulator receiver protein [Thauera sp. MZ1T]
          Length = 125

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 71/119 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++++EDN  N  L R L++  G+   +  +G   L +A +  P +I++DIQL  + 
Sbjct: 1   MNKRILLIEDNAQNRYLARFLLDARGWQVSEAEDGPSGLLIADRTDPAIILLDIQLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           G  + + ++E+  L  +P+IAVT++AM GD E+    GC  YI KPI    F + +++Y
Sbjct: 61  GYAVARGLRENPRLAHVPIIAVTSYAMPGDREQCLAAGCTGYIEKPIDPERFADEVERY 119


>gi|255012859|ref|ZP_05284985.1| two-component hybrid sensor kinase/response regulator [Bacteroides
            sp. 2_1_7]
          Length = 1041

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 74/106 (69%), Gaps = 3/106 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V+I EDN  N KLF  +++ + Y  +   NG EA+EL ++++P +++MDI + E++G E 
Sbjct: 922  VLIAEDNAGNFKLFETILK-NDYTIVHAWNGKEAVELFKEYEPHIVLMDINMPEMNGYEA 980

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
            TK+I++ SE+  IP+IAVTA+A   DEE++   G +AY SKP++ S
Sbjct: 981  TKEIRKLSEV--IPIIAVTAYAFASDEEQVMNSGFDAYASKPLNAS 1024


>gi|150375913|ref|YP_001312509.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150030460|gb|ABR62576.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 121

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 69/119 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VEDNE+N  +    +   G+  L   NG   +ELA   KPD+I+MD+ L  + G
Sbjct: 1   MTRILLVEDNEMNRDMLSRRLSRRGFEVLIAENGQAGVELAASEKPDLILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T++IK D     IPVIA+TA AM  D E   K GC+ Y SKP+ L   +  I++ +
Sbjct: 61  WEATRRIKADPLTSAIPVIALTAHAMASDREMALKAGCDDYDSKPVDLPQLVRKIEQLL 119


>gi|150009899|ref|YP_001304642.1| two-component hybrid sensor kinase/response regulator
            [Parabacteroides distasonis ATCC 8503]
 gi|149938323|gb|ABR45020.1| two-component system sensor histidine kinase, with response regulator
            receiver domain [Parabacteroides distasonis ATCC 8503]
          Length = 1041

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 74/106 (69%), Gaps = 3/106 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V+I EDN  N KLF  +++ + Y  +   NG EA+EL ++++P +++MDI + E++G E 
Sbjct: 922  VLIAEDNAGNFKLFETILK-NDYTIVHAWNGKEAVELFKEYEPHIVLMDINMPEMNGYEA 980

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
            TK+I++ SE+  IP+IAVTA+A   DEE++   G +AY SKP++ S
Sbjct: 981  TKEIRKLSEV--IPIIAVTAYAFASDEEQVMNSGFDAYASKPLNAS 1024


>gi|196232625|ref|ZP_03131477.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
 gi|196223387|gb|EDY17905.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
          Length = 133

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 74/117 (63%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+DN  N+KL  D++E  GY  L+  +   A E+   + PD+I+MDI L  + GL +
Sbjct: 6   ILVVDDNPTNLKLVSDVLEFDGYQILKAIDAETAQEIIEANPPDLILMDIALPGMDGLTL 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+ +K + + + I ++A+TAFAMKGD+ +  + GC+ YI+KPI        + +++G
Sbjct: 66  TRLLKANEKTRHIIIVALTAFAMKGDDAKASEAGCDGYITKPIDTRKLAGQVAEFLG 122


>gi|315645559|ref|ZP_07898683.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus vortex V453]
 gi|315279037|gb|EFU42347.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus vortex V453]
          Length = 639

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 77/120 (64%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++I EDNE+N  + + ++E  GY +   +NG+EA+E  ++H  D++ MDIQ+  + G++
Sbjct: 517 RILIAEDNEVNQLVLKKMLEKLGYNSTTVQNGLEAVEAFKRHPYDIVFMDIQMPFMDGMD 576

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
             K IKE    +  P ++AVTA A+KGD ER  + G + Y+SKP+S+ +    I K++ E
Sbjct: 577 AVKAIKESISSERDPYIVAVTAHAIKGDRERYLEMGMDEYVSKPVSMHMISGIIDKFLAE 636


>gi|322419401|ref|YP_004198624.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320125788|gb|ADW13348.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 127

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 73/121 (60%), Gaps = 1/121 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K  +I+ED+  +M L   L+E  GY  +    G E +ELA +++ D II+DIQL ++ G
Sbjct: 1   MKTALIIEDHPDSMVLISRLLEKWGYRTIGAGTGREGIELALENRADFIILDIQLPDMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ + I+  +     PVIA+T++AM GD ER+   GC+ YI KPI   + +  I+  IG
Sbjct: 61  TEVLRSIRA-ALGHGTPVIAITSYAMSGDRERLLAAGCDGYIEKPIDPELVLSQIRGVIG 119

Query: 122 E 122
           E
Sbjct: 120 E 120


>gi|322421477|ref|YP_004200700.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320127864|gb|ADW15424.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 126

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 75/122 (61%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+DN+ N  L RD+++ SG+  L   NG E + LAR+H PD+I+MDIQ+  ++
Sbjct: 1   MPHTILVVDDNDQNRVLLRDVLQMSGFDVLLAENGEETVHLAREHHPDLILMDIQMPVMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE  K ++ D   ++I ++A++   M  D++     G + YI KPI + +  +TI KY+
Sbjct: 61  GLEAGKLLRGDPRTKDICILALSCVLMVEDKDDFFATGFDGYIDKPIDIRMLPKTIIKYL 120

Query: 121 GE 122
             
Sbjct: 121 AN 122


>gi|159897626|ref|YP_001543873.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890665|gb|ABX03745.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 131

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 70/115 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IV+D++ N  +    ++  G+     + G+E L LA Q KPD+I+MD+ + E+ G  
Sbjct: 2   HILIVDDDQDNRTILTTRLQRRGFQISTAKTGIEGLMLALQLKPDLILMDMSMPELHGWG 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T Q+K   + + IPVIA+TA+ + GD ER    GC+AY+ KPI  +  + TI++
Sbjct: 62  ATAQLKASPQTRAIPVIAITAYTLSGDRERCMAVGCDAYVEKPIDFNHLLSTIQR 116


>gi|304322210|ref|YP_003855853.1| two-component response regulator [Parvularcula bermudensis
           HTCC2503]
 gi|303301112|gb|ADM10711.1| two-component response regulator [Parvularcula bermudensis
           HTCC2503]
          Length = 132

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N+++    ++  G+  +  R+G EAL++A    PD+I+MDI +  +SG+E 
Sbjct: 3   ILIAEDNEDNLEILTRRLKRKGHDLICARDGQEALDMACDALPDIILMDISMPILSGIEA 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T+QI++   LQE P+IA+TA AM  D E+    GC  + +KPI     +  I++   E
Sbjct: 63  TQQIRKHPPLQETPIIALTAHAMASDREKCLSAGCTEFATKPIDFKALLGIIERLTKE 120


>gi|113477435|ref|YP_723496.1| response regulator receiver protein [Trichodesmium erythraeum
           IMS101]
 gi|110168483|gb|ABG53023.1| response regulator receiver protein [Trichodesmium erythraeum
           IMS101]
          Length = 125

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLF-RDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+++VEDNE+N  +  R LI     + +   NG+E +E++    PD+I+MD+ L E+ G 
Sbjct: 3   KILLVEDNEMNRDMLSRRLIRKKFEVVIAI-NGVEGVEMSISEIPDIILMDMSLPELDGW 61

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E TK+IK + + ++IPVIA+TA AM GD E+  + GC+ Y +KP+     +E I   I
Sbjct: 62  EATKKIKANQQTKDIPVIAITAHAMTGDREKCLQAGCDDYDTKPVEFPRLLEKINNLI 119


>gi|323699566|ref|ZP_08111478.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. ND132]
 gi|323459498|gb|EGB15363.1| multi-sensor hybrid histidine kinase [Desulfovibrio desulfuricans
           ND132]
          Length = 953

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 73/117 (62%), Gaps = 5/117 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH--KPDVIIMDIQLQEISGL 62
           +++ +DN +N K  +  +   G+  +   NG+EALE+ R      DV++MD+Q+ E+SGL
Sbjct: 697 ILLADDNPMNRKYLQHFLTMFGHTVVTAENGLEALEVLRDRGRTVDVVLMDVQMPEMSGL 756

Query: 63  EITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E T+ I+E    Q    IP+IA+TA+AMKGD ER+ + G + Y+SKP+ +    E I
Sbjct: 757 EATRAIRESDGRQYDRRIPIIALTAYAMKGDRERMLEAGMDDYVSKPVDMHALSEAI 813


>gi|91202233|emb|CAJ75293.1| very similar to histidine kinase [Candidatus Kuenenia
           stuttgartiensis]
          Length = 542

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 76/118 (64%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IVEDNE N+ +  +++E   +  +  RNG EA+E+A+QHKP++I+MDI++  + GL
Sbjct: 421 RRILIVEDNERNLAMTVEMLEVHNHQVVVARNGQEAIEMAKQHKPELILMDIRMPVMDGL 480

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T++++   E    P+IA+TA      E+     GC A+++KPI +      +KKY+
Sbjct: 481 EATQRLRAIPEFVNTPIIAMTASTGAEAEKTYLAKGCTAHLAKPIHVKQLYAVLKKYL 538


>gi|20088917|ref|NP_614992.1| response regulator receiver [Methanosarcina acetivorans C2A]
 gi|19913761|gb|AAM03472.1| response regulator receiver [Methanosarcina acetivorans C2A]
          Length = 126

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 78/119 (65%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IVEDN LN+ +  DL+++ GY   + +NG EALE+  + K D+++MD++L ++ G
Sbjct: 1   MPEILIVEDNLLNLVIEADLLKSCGYDPKKAKNGFEALEVLSKVKVDLVLMDMELPKMHG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE+ ++IK + E Q I V+AVT       E+   K GC A +SKPI+  +F   +K+++
Sbjct: 61  LELLQRIKCNPETQGIRVVAVTGHCDPESEQEFLKAGCHAVLSKPINFDLFGAQVKEFL 119


>gi|308275109|emb|CBX31708.1| hypothetical protein N47_E52200 [uncultured Desulfobacterium sp.]
          Length = 1266

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 73/115 (63%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDN  N ++   ++E +G +     NG EA++  R+ + D ++MDIQ+  + G E
Sbjct: 919  RVLVAEDNITNQEIALAILEEAGLVVKIVNNGKEAVDAVRESQFDALLMDIQMPVMDGYE 978

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T+QI++D+E +++P+IA+TA AMKGDEE   K G   YI KP+S  +    + +
Sbjct: 979  ATRQIRKDAEFKDLPIIAMTAHAMKGDEEECLKAGMNGYIPKPVSQDMLFNVLWR 1033



 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-----ARQHKPDVIIMDIQLQEI 59
           V++V+D + +  +   ++E+ G+      +   +L+       R++  D+++MD  +  +
Sbjct: 771 VLVVDDCKDSQNIMEKMLESFGFKVESISSAQASLQRLREDETRENPIDLVMMDWLMPGL 830

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E +  I++D +L  +P+I +TAF  +       K G   +++KPI  S   + I   
Sbjct: 831 DGIEASSIIRDDLKLN-VPIIMMTAFGNETQMLYAEKVGVNGFLTKPICQSTLFDAIMDA 889

Query: 120 IGE 122
            G+
Sbjct: 890 FGK 892


>gi|146294229|ref|YP_001184653.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens CN-32]
 gi|145565919|gb|ABP76854.1| PAS/PAC sensor hybrid histidine kinase [Shewanella putrefaciens
            CN-32]
          Length = 1771

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+V++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRVLLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLSQQSYDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T  I++  EL  +PVIA+TA AM GD+E   + G   +I+KPI ++I  +T+ KY+G+
Sbjct: 1484 QATMAIRQRPELAHLPVIAMTANAMAGDKEMCLRAGMNGHIAKPIEVNILYQTLLKYLGD 1543



 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+DN     + R  +E+ G+     R G EA+    QH+  V ++D ++  + GLE 
Sbjct: 1284 VLVVDDNATARDIMRTALESMGFNVDTVRTGEEAVSRCIQHEYAVALIDWKMPSMDGLEA 1343

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +QI++ ++     ++ V+A A      +I + G   YISKPIS S  ++ I   +G A
Sbjct: 1344 ARQIQQQAKAAP-RILMVSAHANHEFLTQIEQLGLAGYISKPISASRLLDGIMNALGRA 1401


>gi|319427574|gb|ADV55648.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens 200]
          Length = 1770

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+V++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRVLLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLSQQSYDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T  I++  EL  IPVIA+TA AM GD+E   + G   +I+KPI ++I  +T+ KY+G+
Sbjct: 1484 QATMAIRQRPELAHIPVIAMTANAMAGDKEMCLRAGMNDHIAKPIEVNILYQTLLKYLGD 1543



 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+DN     + R  +E+ G+     R G EA+    QH+  V ++D ++  + GLE 
Sbjct: 1284 VLVVDDNATARDIMRTALESMGFNVDTVRTGEEAVSRCMQHEYAVALIDWKMPSMDGLEA 1343

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +QI++ ++     ++ V+A A      +I + G   YISKPIS S  ++ I   +G A
Sbjct: 1344 ARQIQQQAKAAP-RILMVSAHANHEFLTQIEQLGLAGYISKPISASRLLDGIMNALGRA 1401


>gi|148265171|ref|YP_001231877.1| response regulator receiver protein [Geobacter uraniireducens Rf4]
 gi|146398671|gb|ABQ27304.1| response regulator receiver protein [Geobacter uraniireducens Rf4]
          Length = 124

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 76/119 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED E  +KL   L+ + GY+     +G  ALE  + ++PD++I+DI L EI G E
Sbjct: 5   KILVVEDEESLLKLESILLTSKGYLVTGVMDGRAALEEIKTNRPDLVILDIMLPEIDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+IKE++E + IPV+ +TA     D ER R+ G +AYI+KP   +  ME I+  IG+
Sbjct: 65  VCKRIKENNETKSIPVVMLTAKKSNQDVERGRQVGADAYITKPFRSARVMEVIEGLIGK 123


>gi|330840625|ref|XP_003292313.1| hypothetical protein DICPUDRAFT_157014 [Dictyostelium purpureum]
 gi|325077455|gb|EGC31166.1| hypothetical protein DICPUDRAFT_157014 [Dictyostelium purpureum]
          Length = 1589

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 49/127 (38%), Positives = 77/127 (60%), Gaps = 7/127 (5%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQ 57
            +KV++ EDN +N KL + L+   G+     ++G +AL+   + K      D I+MDIQ+ 
Sbjct: 1436 QKVLVAEDNTMNQKLIKTLLTKKGFDITIAKDGKQALDFYHESKVKSTLYDCILMDIQMP 1495

Query: 58   EISGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             ++GLE T  I+E   +E   IP+IAVTA AMKGD+E+  + G + Y++KPI+  +  E 
Sbjct: 1496 NLNGLEATSAIREIEANEGGHIPIIAVTAHAMKGDKEKFLESGVDDYVTKPINPKLLYEV 1555

Query: 116  IKKYIGE 122
            I   IG+
Sbjct: 1556 INTQIGK 1562


>gi|300868057|ref|ZP_07112695.1| response regulator receiver protein [Oscillatoria sp. PCC 6506]
 gi|300333977|emb|CBN57873.1| response regulator receiver protein [Oscillatoria sp. PCC 6506]
          Length = 141

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 68/116 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ++ K+++VEDNE+N  +    +   G+  L   +G E +E+AR   PD+I+MD+ L  + 
Sbjct: 16  LMAKILLVEDNEMNRDMLSRRLARKGHEVLIAVDGAEGVEMARSKVPDLILMDMSLPVLD 75

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           G + T+QIK   E   IPVIA+TA AM GD E+    GC+ Y +KP+     +  I
Sbjct: 76  GWQATQQIKATPETNTIPVIALTAHAMAGDREKCLAAGCDDYDTKPVEFPRLLGKI 131


>gi|37521253|ref|NP_924630.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
 gi|35212249|dbj|BAC89625.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
          Length = 136

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++ ED   N+ L + ++E+SGY+    +NG EA++L     PD+++MD+ L  + G 
Sbjct: 4   KHILVAEDVADNLLLIQSILESSGYMVSVAQNGAEAIDLVTSKLPDLVLMDLSLPIVDGW 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           E T+ +K     + IP+IA+TA AM+GD E+    GC+ Y+SKPI +
Sbjct: 64  EATRVLKAQDATRHIPIIALTAHAMQGDREKALLAGCDDYLSKPIDI 110


>gi|113969059|ref|YP_732852.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
 gi|113883743|gb|ABI37795.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
          Length = 1767

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 77/119 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRILLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLAQQSFDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+ I++  EL E+PVIA+TA AM GD+E   K G   +I+KPI +++  +T+ KY+G
Sbjct: 1484 QATQAIRKRPELAELPVIAMTANAMAGDKEMCLKAGMNDHIAKPIEVNLLYQTLLKYLG 1542



 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ +DN     + R  +E+ G+     R+G EA+    Q +  V ++D ++  + G+E 
Sbjct: 1284 ILVADDNATARDIMRTTLESMGFRVDTVRSGEEAVTRCSQQEYAVALIDWKMPNLDGIET 1343

Query: 65   TKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             KQIK+ +  +  P ++ V+A A +    +I   G   YISKPIS S  ++ I   +G A
Sbjct: 1344 AKQIKQLA--KNAPRILMVSAHATQEFLSQIEALGLAGYISKPISASRLLDGIMNSLGRA 1401


>gi|114048796|ref|YP_739346.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
 gi|113890238|gb|ABI44289.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
          Length = 1767

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 77/119 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRILLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLAQQSFDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+ I++  EL E+PVIA+TA AM GD+E   K G   +I+KPI +++  +T+ KY+G
Sbjct: 1484 QATQAIRKRPELAELPVIAMTANAMAGDKEMCLKAGMNDHIAKPIEVNLLYQTLLKYLG 1542



 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ +DN     + R  +E+ G+     R+G EA+    Q +  V ++D ++  + G+E 
Sbjct: 1284 ILVADDNATARDIMRTTLESMGFRVDTVRSGEEAVTRCSQQEYAVALIDWKMPNLDGIET 1343

Query: 65   TKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             KQIK+ +  +  P ++ V+A A +    +I   G   YISKPIS S  ++ I   +G A
Sbjct: 1344 AKQIKQLA--KNAPRILMVSAHATQEFLSQIEALGLAGYISKPISASRLLDGIMNSLGRA 1401


>gi|167625694|ref|YP_001675988.1| PAS/PAC sensor-containing hybrid histidine kinase [Shewanella
            halifaxensis HAW-EB4]
 gi|167355716|gb|ABZ78329.1| PAS/PAC sensor hybrid histidine kinase [Shewanella halifaxensis
            HAW-EB4]
          Length = 1203

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 76/117 (64%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY      NG  AL++  + + D ++MDIQ+  + GL  
Sbjct: 1081 VLLVEDNFINQQVATELLKSAGYTVDVAENGQIALDMIDKTQYDAVLMDIQMPVMDGLTA 1140

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            TK++++    +E+PVIA+TA AM GD E+    G  A+I+KPI L+   ET+  +IG
Sbjct: 1141 TKELRKRYSTEELPVIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFETLSHWIG 1197



 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++++DN   ++++  ++    +      +G E L    ++  D++++D  + E+ G+E
Sbjct: 937  KTLVIDDNPTALQIYSSVLRDFHFNVDTAASGPEGLYKLGKNPVDLLLLDWMMPEMDGIE 996

Query: 64   ITKQIK---EDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKK 118
            + KQI     D  L++ P +I +TA+  +   + + +    A + KP   S +F E I  
Sbjct: 997  VIKQIDAMVADGRLEKRPIIIMMTAYTAEPMHKDVEQANVYALLQKPFKASALFDEVISA 1056

Query: 119  YIGE 122
            +  E
Sbjct: 1057 FADE 1060


>gi|218264827|ref|ZP_03478515.1| hypothetical protein PRABACTJOHN_04225 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221769|gb|EEC94419.1| hypothetical protein PRABACTJOHN_04225 [Parabacteroides johnsonii
           DSM 18315]
          Length = 794

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 75/120 (62%), Gaps = 6/120 (5%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  L R +++   Y  L  RNG EA+ L  +H PD+I+MD+++ ++ G E 
Sbjct: 671 LLIAEDNESNYILIRAILKE--YDLLHARNGNEAVRLYHEHHPDLILMDLKMPDMDGYEA 728

Query: 65  TKQI-KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           T +I KEDS   +IP+IAVTAFA   DE+R+R+ G   Y +KPI  +   + I +Y+   
Sbjct: 729 TAEIRKEDS---DIPIIAVTAFAFAEDEQRVRQSGFNGYAAKPIKPAELKKIIVQYLSST 785


>gi|16264091|ref|NP_436883.1| putative histidine kinase protein [Sinorhizobium meliloti 1021]
 gi|307300056|ref|ZP_07579841.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|307316591|ref|ZP_07596034.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|15140216|emb|CAC48743.1| putative two-component response regulator [Sinorhizobium meliloti
           1021]
 gi|306897789|gb|EFN28532.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306904945|gb|EFN35528.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 121

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 69/120 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +   G+  L   NG   +ELA   KPD+I+MD+ L  + G
Sbjct: 1   MTKILLVEDNEMNRDMLSRRLSRRGFDVLIAENGRAGVELAESQKPDLILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T++IK +     IPVIA+TA AM  D E   + GC+ Y SKP+ L   +  I++ + 
Sbjct: 61  WEATRRIKANPLTSAIPVIALTAHAMASDREMALEAGCDDYDSKPVDLPQLVRKIEQLLA 120


>gi|24372448|ref|NP_716490.1| sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
 gi|24346431|gb|AAN53935.1|AE015531_1 sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
          Length = 1765

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 77/119 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRILLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLAQQSFDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + TK I++  EL ++PVIA+TA AM GD+E   + G   +I+KPI +++  +T+ KY+G
Sbjct: 1484 QATKAIRQRPELAQLPVIAMTANAMAGDKEMCLRAGMNDHIAKPIEVNLLYQTLLKYLG 1542



 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ +DN     + R  +E+ G+     R+G EA+    Q +  V ++D ++  + G+E 
Sbjct: 1284 ILVADDNATARDIMRTTLESMGFNVDTVRSGDEAIMRCSQQEYAVALIDWKMPNLDGIET 1343

Query: 65   TKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             KQIK+  + +  P ++ V+A A +    +I + G   YISKPIS S  ++ I   +G +
Sbjct: 1344 AKQIKQ--QTKNAPRILMVSAHANQDFLTQIEQLGLAGYISKPISASRLLDGIMNALGRS 1401


>gi|120597632|ref|YP_962206.1| multi-sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
 gi|120557725|gb|ABM23652.1| PAS/PAC sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
          Length = 1771

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 76/120 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+V++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRVLLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLSQQSYDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T  I++  EL  +PVIA+TA AM GD+E   + G   +I+KPI ++I  +T+ KY+G+
Sbjct: 1484 QATMAIRQRPELAHLPVIAMTANAMAGDKEMCLRAGMNDHIAKPIEVNILYQTLLKYLGD 1543



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+DN     + R  +E+ G+     R G EA+    QH+  V ++D ++  + GLE 
Sbjct: 1284 VLVVDDNATARDIMRTALESMGFNVDTVRTGEEAVSRCIQHEYAVALIDWKMPSMDGLEA 1343

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +QI++ ++     ++ V+A A      +I + G   YISKPIS S  ++ I   +G A
Sbjct: 1344 ARQIQQQAKAAP-RILMVSAHANHEFLTQIEQLGLAGYISKPISASRLLDGIMNALGRA 1401


>gi|27377396|ref|NP_768925.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
 gi|27350540|dbj|BAC47550.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
          Length = 127

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 71/120 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +   GY  +   +G   + +A   +PD+I+MD+ L  I G
Sbjct: 1   MPKILLVEDNEMNRDMLSRRLVRGGYEVIIAEDGARGVAIATSDRPDLILMDMSLPVIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+QIK   EL++IP+IA+TA AM  D ++  K GC+ Y +KPI L   +  I+  + 
Sbjct: 61  WEATRQIKATPELRKIPIIALTAHAMATDRDKALKAGCDDYDTKPIELQRLLGKIETLLA 120


>gi|159897122|ref|YP_001543369.1| response regulator receiver sensor signal transduction histidine
           kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890161|gb|ABX03241.1| response regulator receiver sensor signal transduction histidine
           kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 397

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 69/118 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+ +EDN  N +L R ++ T GY  +   +G E  + A+  +PD+I+MDI L  ++G E
Sbjct: 6   RVLYIEDNHDNQRLVRRVLATRGYQIIIANDGNEGWKSAQTDRPDLILMDINLPGLNGYE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +T + K   +L  +P++A+TA    GD ER    GC+ YISKPI      + +  YIG
Sbjct: 66  LTTKFKATPQLASVPIVALTANTTPGDRERALAAGCDGYISKPIDPRALPDLVASYIG 123


>gi|301308093|ref|ZP_07214047.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
 gi|300833563|gb|EFK64179.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
          Length = 882

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYNLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E S  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKS--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|298374421|ref|ZP_06984379.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_19]
 gi|298268789|gb|EFI10444.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_19]
          Length = 882

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYNLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E S  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKS--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|87308528|ref|ZP_01090668.1| FOG: CheY-like receiver [Blastopirellula marina DSM 3645]
 gi|87288620|gb|EAQ80514.1| FOG: CheY-like receiver [Blastopirellula marina DSM 3645]
          Length = 954

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 74/118 (62%), Gaps = 3/118 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM+VED   N KL   L++  G+I ++  NG EALE  R  + DVI+MD+Q+  + GL+
Sbjct: 703 RVMLVEDTAANRKLVTSLLKKRGHIVVEAHNGREALEKFRDDEFDVILMDVQMPIMDGLQ 762

Query: 64  IT---KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T   +QI+ +   +  P+IA+TA AM+GD E+    G +AYISKPI +   + T++ 
Sbjct: 763 TTAAIRQIEREEGYEPTPIIAMTAHAMQGDREKCLGAGMDAYISKPIDIDDLLATLES 820



 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 63/119 (52%), Gaps = 7/119 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           +V++V+DNE N K+ R+L+ +    A  T +  EA+ L  + +      D++++D  +  
Sbjct: 559 QVLVVDDNETNRKILRELLRSWELDAFTTSDAEEAIRLFSEKQKVGDPFDLVLIDALMPG 618

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGD-EERIRKGGCEAYISKPISLSIFMETI 116
           I G ++ K++ E +  +  P++ + A + +    ER       + ++KPI+ S   +++
Sbjct: 619 IDGYDLCKRLGEVAG-KTPPIVLMAAPSDRHHFREREEDLPIRSTLAKPITASSLHDSL 676


>gi|196234682|ref|ZP_03133496.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
 gi|196221255|gb|EDY15811.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
          Length = 121

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 70/108 (64%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VEDNE+N  +    +E  GY  +   +G + +  A++H+PD+I+MD+ L  + G
Sbjct: 1   MKKLLLVEDNEMNRDMLSRRLERRGYQVVIAVDGEQGITAAKEHRPDLILMDMSLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            E T+++K++ + Q IPV+A+TA AM G+ ++    GC  Y +KP+  
Sbjct: 61  WESTRRLKQEPDTQAIPVLALTAHAMAGERDKALAAGCSDYDTKPVDF 108


>gi|220906813|ref|YP_002482124.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219863424|gb|ACL43763.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1977

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 72/119 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N+      ++  GY  L  +NG EA++L +  +PD+I+MDIQ+  + GL  
Sbjct: 1859 ILLAEDNEANISTISSYLKAKGYRVLVAKNGQEAIDLGQAAQPDLILMDIQMPGVDGLSA 1918

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +Q+++      +P+IA+TA AM GD +R    G   Y+SKP+ LS  +  I++ + ++
Sbjct: 1919 IQQLRQAPSSAHLPIIALTALAMNGDRDRCLAAGANEYLSKPVKLSQLVILIQQLLTQS 1977


>gi|254283237|ref|ZP_04958205.1| PAS fold family protein [gamma proteobacterium NOR51-B]
 gi|219679440|gb|EED35789.1| PAS fold family protein [gamma proteobacterium NOR51-B]
          Length = 1947

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 78/120 (65%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDNE+N +L  +++ T G       NG EAL+L   H+ D ++MD Q+  + G E
Sbjct: 1613 QVLLVEDNEINQELAVEILTTHGMTVQVANNGQEALDLIAAHQFDGVLMDCQMPVMDGYE 1672

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T+ I+ +   +++PV+A+TA AM GD+E++ + G   +I+KPI+L+   +T+ K+I  A
Sbjct: 1673 ATRHIRNNPATKDLPVLAMTANAMVGDKEKVIEAGMNDHIAKPINLADLFKTMAKWISPA 1732



 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 66/122 (54%), Gaps = 5/122 (4%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD----VIIMDIQLQEIS 60
            +++V+DN+   ++   ++E+ G+       G +A+E+ +    D    ++++D ++  + 
Sbjct: 1465 ILVVDDNQSAREILAAILESLGFQIKTASGGRQAVEMIKAADADEPFKLVMLDWRMPGLD 1524

Query: 61   GLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G++  + I+ED+ L+  P +I +TAF  +  +E         +++KP + S  ++ I + 
Sbjct: 1525 GVQTGQLIQEDTTLKNQPKIIMITAFGREEMQEGAGGLAISGFLTKPATASSLLDEIMRA 1584

Query: 120  IG 121
            +G
Sbjct: 1585 MG 1586


>gi|332521562|ref|ZP_08398016.1| response regulator receiver [Lacinutrix algicola 5H-3-7-4]
 gi|332042961|gb|EGI79160.1| response regulator receiver [Lacinutrix algicola 5H-3-7-4]
          Length = 122

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 72/114 (63%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+I+EDNE NM +   L+ + G+   +  NG + +ELA++++P++I+MDIQL ++ 
Sbjct: 1   MKPTVLIIEDNEQNMYMLAYLLASKGFEVSKAFNGKDGIELAKKNQPNLILMDIQLPDMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
           G +I   ++ +   +   +IAVT++AM GD E+  K G   YI KPI+   F++
Sbjct: 61  GYQICSALRNNGLPKSTVIIAVTSYAMSGDREKALKSGANGYIEKPINPETFIQ 114


>gi|298291977|ref|YP_003693916.1| response regulator receiver protein [Starkeya novella DSM 506]
 gi|296928488|gb|ADH89297.1| response regulator receiver protein [Starkeya novella DSM 506]
          Length = 123

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 69/120 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +  +G+  L   NG E ++LA   +P +I+MD+ L  + G
Sbjct: 1   MTKILLVEDNEMNRDMLSRRLSRNGFEVLIAVNGQEGVDLALAERPALILMDMSLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+++K D     IPVIA+TA AM  D E     GC+ + +KP+ L   M  IK  +G
Sbjct: 61  WEATRRVKADPTTATIPVIALTAHAMAKDREDAMAAGCDDFDTKPVELPRLMGKIKALLG 120


>gi|114565936|ref|YP_753090.1| sensory box histidine kinase/response regulator [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114336871|gb|ABI67719.1| Hpt sensor hybrid histidine kinase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 497

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 75/117 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN LN K+   ++   G+  +   NG+EAL + +    ++++MD+Q+  + G E
Sbjct: 280 RVLLVEDNPLNQKIVGQMLYNYGFEVIMASNGLEALRILQDKPVNIVLMDMQMPVMDGYE 339

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I++ S+ ++IP+IA+TA ++ GD E+    GC +YI+KP      ++ +K+YI
Sbjct: 340 ATQFIRQHSKWRDIPIIAITAHSLPGDREKCLACGCTSYIAKPFKAHELVQLMKEYI 396


>gi|17231589|ref|NP_488137.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17133232|dbj|BAB75796.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 965

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDN+ N+      +E+ GY  +   NG +AL+ AR+  PD+IIMDIQ+  ++GLE 
Sbjct: 835 ILLAEDNQANIDTISSYLESRGYEMVLAENGQQALDFAREKCPDLIIMDIQMPGMNGLEA 894

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +QI+ + +  +IP+IA+TA AM  D       G   Y++KPI L   + TI++ +
Sbjct: 895 IRQIRNEQKFIDIPIIALTALAMPSDRTTCLAAGANEYLTKPIKLKQLVLTIQQLL 950


>gi|21227430|ref|NP_633352.1| two-component response regulator [Methanosarcina mazei Go1]
 gi|20905797|gb|AAM31024.1| Two-component response regulator [Methanosarcina mazei Go1]
          Length = 126

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 77/119 (64%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IVEDN LN+ +  DL+++ GY  ++ +NG EALE+  + K D+I+MD++L ++ G
Sbjct: 1   MPEILIVEDNLLNLVVESDLLKSCGYDPIKAKNGFEALEVLSKVKVDLILMDMELPKMHG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE+ +QIK + + + I V+AVT        +   K GC A +SKPI+   F   +K+++
Sbjct: 61  LELLQQIKCNPDTESIKVVAVTGNCDPESRQEFLKAGCHAVLSKPINFDRFGSQVKEFL 119


>gi|193084136|gb|ACF09802.1| chemotaxis protein CheV [uncultured marine group III euryarchaeote
           SAT1000-53-B3]
          Length = 119

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    +   GY  +   +G EA+++A+   PD+I+MD+ L   +G
Sbjct: 1   MTKILLVEDNEMNKDMLSRRLMKKGYDIVFAMDGQEAIDMAKSEMPDIILMDMGLPVKNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           L+ TK+IK DS    IPVIA+TA AM    +     GC+ Y +KP+ L   +E I+++
Sbjct: 61  LQATKEIKADSSTSSIPVIALTAHAMDEHRQEAMDAGCDEYETKPVRLPSLLEKIEQF 118


>gi|29346857|ref|NP_810360.1| two-component system sensor histidine kinase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|29338754|gb|AAO76554.1| two-component system sensor histidine kinase [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 785

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 79/120 (65%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED + N  L +++I    Y  L  ++G EA+E+ +Q +PD+I+MDI++  + G
Sbjct: 669 IKKILVAEDVDSNFVLIKNMI-GKDYTLLWAKDGFEAVEMYKQFQPDLILMDIKMPRMGG 727

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE T+ I+  S  +EIPVIA+TA+A + D+E+  + GC  +++KP+S +   E + K  G
Sbjct: 728 LEATRIIRSYS--KEIPVIALTAYAFEADKEQALEAGCNDFVTKPVSKAALEEALGKCCG 785


>gi|262382637|ref|ZP_06075774.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_33B]
 gi|262295515|gb|EEY83446.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_33B]
          Length = 882

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYSLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E +  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKN--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|197118912|ref|YP_002139339.1| response receiver [Geobacter bemidjiensis Bem]
 gi|197088272|gb|ACH39543.1| response receiver [Geobacter bemidjiensis Bem]
          Length = 126

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 71/120 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V+++EDN  N+ L R  +E +GY       G   + +A +   D+II+DI L +  G
Sbjct: 1   MKQVLVIEDNRDNLGLIRFALERAGYKVTSAETGAAGVSVALESSFDLIIVDINLPDFDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+T++I++ S  +  P++A+T+ AM GD E+    GC+ Y  KPI     +E I+K +G
Sbjct: 61  YEVTRRIRKASPDKAAPIVAITSNAMTGDREKTLAAGCDGYFEKPIDPITIVEQIEKAVG 120


>gi|283853302|ref|ZP_06370551.1| GAF sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283571283|gb|EFC19294.1| GAF sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 575

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++ VED+ +N    + L+ T+G+      +G EALEL RQ   D+I+MDIQL  + G+E 
Sbjct: 453 ILFVEDDAVNALSGKSLLRTAGFSLDLAMDGREALELLRQKHFDLILMDIQLPVLDGVEA 512

Query: 65  TKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+   E +    +P+IA+TA+AM GD E+  K G +AY+SKP ++    +TI  +I
Sbjct: 513 TRVIRSAKEFESQSRVPIIAMTAYAMAGDREKFLKAGFDAYLSKPFTMEELNDTILNFI 571


>gi|261405183|ref|YP_003241424.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus sp. Y412MC10]
 gi|261281646|gb|ACX63617.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus sp. Y412MC10]
          Length = 642

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I EDNE+N  + + +IE  GY +    NG+EA+E  +++  D++ MDIQ+  + G+E
Sbjct: 517 KILIAEDNEVNQLVLKKMIEKLGYNSTTVLNGLEAVEAFKRYPYDMVFMDIQMPFMDGME 576

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
             + IKE +     P ++AVTA A+KGD E+    G + Y+SKP+SL++    I +++ E
Sbjct: 577 AVQLIKESAPPDHQPYIVAVTAHAIKGDREKYLGMGMDEYVSKPVSLNVISAIIDRFLAE 636


>gi|255012665|ref|ZP_05284791.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_7]
          Length = 882

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYNLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E +  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKN--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|288942776|ref|YP_003445016.1| integral membrane sensor hybrid histidine kinase [Allochromatium
           vinosum DSM 180]
 gi|288898148|gb|ADC63984.1| integral membrane sensor hybrid histidine kinase [Allochromatium
           vinosum DSM 180]
          Length = 623

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 74/117 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+DN  N+ +F   +   G       +G EA+ L+R  +PDVI+MD+Q+  + GLE
Sbjct: 495 RVLLVDDNPGNLDMFATYLRIRGCDVRTAGSGAEAIALSRMPRPDVILMDVQMPGMDGLE 554

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++++ D  L+ +P+IA+TA AM GD E+  + G + Y++KP+ L     T+ +++
Sbjct: 555 TTRRLRSDPALRAVPIIALTALAMPGDREQCLEAGMDDYLTKPLGLKELHATVAQWV 611


>gi|117921856|ref|YP_871048.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
 gi|117614188|gb|ABK49642.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
          Length = 1767

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 77/119 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1424 KRILLVEDNEMNLEVATEFLEQVGIILSIATNGQIALDKLEQQSFDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+ +++  EL E+PV+A+TA AM GD+E   + G   +I+KPI +++  +T+ KY+G
Sbjct: 1484 QATQALRKRPELTELPVVAMTANAMAGDKEMCLRAGMNDHIAKPIEVNLLYQTLLKYLG 1542



 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ +DN     + R  +E+ G+     R+G EA+    Q +  V ++D ++  + G+E 
Sbjct: 1284 ILVADDNATARDIMRTTLESMGFRVDTVRSGEEAVTRCIQQEYAVALIDWKMPNLDGIET 1343

Query: 65   TKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             KQIK+  + ++ P ++ V+A A +    +I + G   YISKPIS S  ++ I   +G A
Sbjct: 1344 AKQIKQ--QAKKAPRILMVSAHANQDFLSQIEELGLAGYISKPISASRLLDGIINSLGRA 1401


>gi|159901706|ref|YP_001547952.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894745|gb|ABX07824.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 134

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VED  +N  +     E  GY      NG EA+ +A+   PDVI+MD+ L  + G  
Sbjct: 6   HILLVEDQAMNRDMLTRRFERHGYTVSLALNGAEAVVMAQAVMPDVIVMDMSLPVMDGWS 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+++K    +Q+IP+IAVTA+AM GD ER    GC  Y +KPI     +E I+++ G
Sbjct: 66  ATQRLKAIPIVQDIPIIAVTAYAMTGDRERCFAVGCSEYEAKPIQFGRLVEKIERWGG 123


>gi|256838871|ref|ZP_05544381.1| two-component system sensor histidine kinase [Parabacteroides sp.
           D13]
 gi|256739790|gb|EEU53114.1| two-component system sensor histidine kinase [Parabacteroides sp.
           D13]
          Length = 882

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYNLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E +  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKN--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|322421491|ref|YP_004200714.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320127878|gb|ADW15438.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 124

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 72/120 (60%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++I+EDN+ N++L   ++   G+  +   NG E +E+AR+   D+II DI L  + 
Sbjct: 1   MQARILIIEDNQQNLELMSYILRAFGHTVVSACNGAEGIEMARREMLDLIICDIHLPIVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+   +K    L+++P++AVTA AM GD E++   G + YI KPI    F+  I+ ++
Sbjct: 61  GYEVANHLKRHPVLRQLPLVAVTALAMVGDREKVLSAGFDGYIDKPIEPEKFVGQIEAFL 120


>gi|150010061|ref|YP_001304804.1| two-component system sensor histidine kinase [Parabacteroides
           distasonis ATCC 8503]
 gi|149938485|gb|ABR45182.1| two-component system sensor histidine kinase [Parabacteroides
           distasonis ATCC 8503]
          Length = 882

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   NG +A++L  +++PD+I+MD+++  + G E 
Sbjct: 771 LLIAEDNESNYTLFQAMLK--DYNLIHAWNGEQAIDLFNKYQPDLILMDLKMPIVDGYEA 828

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E +  Q IP+IAVTAFA   DEER+++ G  +YI+KPI     +  I  Y+
Sbjct: 829 TRVIREKN--QSIPIIAVTAFAFAEDEERVKQSGFSSYIAKPIKPDKLIACINTYL 882


>gi|218780747|ref|YP_002432065.1| response regulator receiver protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762131|gb|ACL04597.1| Response regulator receiver domain protein (CheY-like)
           [Desulfatibacillum alkenivorans AK-01]
          Length = 129

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 74/121 (61%), Gaps = 1/121 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTR-NGMEALELARQHKPDVIIMDIQLQEI 59
           M KKV++VED+E N  L  DL+E   Y ++    NG + LE+A+   PD+I+MD+ L  +
Sbjct: 1   MEKKVLVVEDSETNRVLLHDLLEKVCYCSVSVAVNGKQGLEIAQADLPDLILMDLGLPVL 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E TK +K D++ + IP+IA+T F    DEER+   G + ++ KP  +   ++ +  Y
Sbjct: 61  DGMEATKILKADAKTRSIPIIALTGFVSNEDEERMMDAGFDGFLPKPFDVRKLLDKVCLY 120

Query: 120 I 120
           +
Sbjct: 121 L 121


>gi|309791219|ref|ZP_07685751.1| two-component hybrid sensor and regulator [Oscillochloris
           trichoides DG6]
 gi|308226781|gb|EFO80477.1| two-component hybrid sensor and regulator [Oscillochloris
           trichoides DG6]
          Length = 657

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDNE N+ L  D +   GY     RNG EAL+LAR+  PD I+MDIQ+  + G+E 
Sbjct: 537 ILLAEDNEDNISLLLDFLPFHGYALTIARNGQEALDLARECHPDAILMDIQMPVMDGIEA 596

Query: 65  TKQIKEDSE--LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            ++++ D +  L   PVIA+TA AM GD +R    G +AYI KP+ L
Sbjct: 597 IRRLRADPDPGLAHTPVIALTALAMPGDRDRCLAAGADAYIVKPLVL 643


>gi|329930043|ref|ZP_08283668.1| PAS domain S-box protein [Paenibacillus sp. HGF5]
 gi|328935442|gb|EGG31914.1| PAS domain S-box protein [Paenibacillus sp. HGF5]
          Length = 642

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I EDNE+N  + + +IE  GY +    NG+EA+E  +++  D++ MDIQ+  + G+E
Sbjct: 517 KILIAEDNEVNQLVLKKMIEKLGYNSTTVLNGLEAVEAFKRYPYDMVFMDIQMPFMDGME 576

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
             + IKE +     P ++AVTA A+KGD E+    G + Y+SKP+SL++    I +++ E
Sbjct: 577 AVQLIKESAPPDHQPYIVAVTAHAIKGDREKYLGMGMDEYVSKPVSLNVISAIIDQFLAE 636


>gi|152993487|ref|YP_001359208.1| two-component sensor histidine kinase/response regulator
           [Sulfurovum sp. NBC37-1]
 gi|151425348|dbj|BAF72851.1| two-component sensor histidine kinase/response regulator
           [Sulfurovum sp. NBC37-1]
          Length = 1065

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ EDN +N KL + ++E  G       NG+E+ E  R +  D+I MDIQ+  + G+E
Sbjct: 792 KVLVTEDNIINQKLIKRILEEHGITVDLANNGLESFEKRRNNDYDLIFMDIQMPVMDGIE 851

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T +I   +ED E+  +P++A+TA A+KGD ER    G + YI+KPI  S  +  + K++
Sbjct: 852 ATHEILDYEEDEEVPHVPIVALTANALKGDRERFLGEGMDEYITKPIETSELLYVLNKFL 911

Query: 121 G 121
            
Sbjct: 912 A 912


>gi|298386496|ref|ZP_06996052.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_14]
 gi|298260873|gb|EFI03741.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_14]
          Length = 785

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 79/120 (65%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED + N  L +++I    Y  L  ++G EA+E+ +Q +PD+I+MDI++  + G
Sbjct: 669 IKKILVAEDVDSNFVLIKNMI-GKDYTLLWAKDGFEAVEMYKQFQPDLILMDIKMPRMGG 727

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE T+ I+  S  +EIPVIA+TA+A + D+E+  + GC  +++KP+S +   E + K  G
Sbjct: 728 LEATRIIRSYS--KEIPVIALTAYAFEADKEQALEAGCNDFVTKPVSKAALEEALGKCSG 785


>gi|253572318|ref|ZP_04849721.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_6]
 gi|251838093|gb|EES66181.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_6]
          Length = 785

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 79/120 (65%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED + N  L +++I    Y  L  ++G EA+E+ +Q +PD+I+MDI++  + G
Sbjct: 669 IKKILVAEDVDSNFVLIKNMI-GKDYTLLWAKDGFEAVEMYKQFQPDLILMDIKMPRMGG 727

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE T+ I+  S  +EIPVIA+TA+A + D+E+  + GC  +++KP+S +   E + K  G
Sbjct: 728 LEATRIIRSYS--KEIPVIALTAYAFEADKEQALEAGCNDFVTKPVSKAALEEALGKCSG 785


>gi|242280141|ref|YP_002992270.1| cache sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
           2638]
 gi|242123035|gb|ACS80731.1| Cache sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
           2638]
          Length = 755

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 77/119 (64%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +KV+++EDN+ N  LF+  I  S +I     NG E +E+ ++ +PD+I MDI++  + G 
Sbjct: 627 RKVLLIEDNKSNRLLFKHFISDSPHIMKCASNGEEGIEIYKEFQPDIIFMDIEMPVMDGY 686

Query: 63  EITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + T++I++      L  +P+IA++A A+KG  E  R+ GC +Y++KPI+   F+E I++
Sbjct: 687 KATEEIRDWERIIGLSPVPIIALSAHAIKGTAEAAREAGCTSYMTKPITKLQFLERIER 745


>gi|242280792|ref|YP_002992921.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio salexigens
           DSM 2638]
 gi|242123686|gb|ACS81382.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio salexigens
           DSM 2638]
          Length = 719

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 72/118 (61%), Gaps = 3/118 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISGL 62
           ++++ EDN  N       +   G+      NG+EAL+L     P DVI+MD+Q+ E+ GL
Sbjct: 599 RILLAEDNATNQLYIAHFLTEQGFEVETAENGLEALDLLDNSGPFDVILMDVQMPEMDGL 658

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E TK+I+E     EIP+IA+TA+AM+GD E+    G +AY SKP+++   ++ I K +
Sbjct: 659 EATKKIREQG--NEIPIIALTAYAMEGDREKFLSNGMDAYSSKPVNIDELVQIIGKLV 714


>gi|313204634|ref|YP_004043291.1| multi-sensor hybrid histidine kinase [Paludibacter propionicigenes
           WB4]
 gi|312443950|gb|ADQ80306.1| multi-sensor hybrid histidine kinase [Paludibacter propionicigenes
           WB4]
          Length = 1000

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVEDN+ NM   + +I     I  +  +G++ + +A++H PD I+MDI L  + G+E 
Sbjct: 883 VLIVEDNQDNMTTVKAIIGEKFKI-FEAVDGIQGVIMAQKHIPDFILMDIALPGVDGIEA 941

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            K I+ D +L  IP+IA+TA AM  D E I   G +AY+SKPI   +F +TI K +
Sbjct: 942 FKAIRNDGKLSHIPIIALTASAMTSDRETILAYGFDAYLSKPIDEKVFFKTINKVL 997



 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 1/104 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++VED+E  +   +D +E SGY  L    G EAL++     PD +I+D+ + E+ G 
Sbjct: 741 KTILLVEDSEPAIIQIKDFLEESGYNILTATGGSEALDIISHTIPDAMILDLMMPEVDGF 800

Query: 63  EITKQIKEDSELQEIPVIAVTA-FAMKGDEERIRKGGCEAYISK 105
           E+ K ++E      IPV+ +TA    K D + ++K      I K
Sbjct: 801 EVLKTLREAEPTAHIPVLILTAKHITKEDLKFLKKNNIHQLIQK 844


>gi|255523302|ref|ZP_05390272.1| histidine kinase [Clostridium carboxidivorans P7]
 gi|255512956|gb|EET89226.1| histidine kinase [Clostridium carboxidivorans P7]
          Length = 190

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEISGL 62
           K  + +DNE+N +    LI   GY      +G+EAL L +Q  K D+I+MDIQ+  ++GL
Sbjct: 66  KCFLEDDNEINQRFISTLISKKGYNYFTAFDGIEALNLLKQVKKIDLILMDIQMPNLNGL 125

Query: 63  EITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK I+  E +    IP+IA+TA+AM GD E+    G + YISKPI  +   + I K++
Sbjct: 126 NTTKNIRNIEINTGNHIPIIAMTAYAMIGDREKFLSAGMDDYISKPIDYTTLYKLIDKFL 185

Query: 121 GE 122
             
Sbjct: 186 SN 187


>gi|148240607|ref|YP_001225994.1| CheY-like domain-containing protein [Synechococcus sp. WH 7803]
 gi|147849146|emb|CAK24697.1| CheY-like receiver domain [Synechococcus sp. WH 7803]
          Length = 124

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 67/116 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNELN  +    +   G+      +G  A+E A   +PD+I+MDI L  I G + 
Sbjct: 4   ILLVEDNELNRDMLSRRLTRKGFTVEMAFDGAAAIERANALQPDLILMDIGLPVIDGFDA 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+++K+D + Q IPVIA+TA AM  D E     GC+ + +KPI L   +E I   +
Sbjct: 64  TRRLKDDPQTQAIPVIALTAHAMMQDREACLSAGCDDFDTKPIDLPRLLEKINNLL 119


>gi|299136566|ref|ZP_07029749.1| multi-sensor hybrid histidine kinase [Acidobacterium sp. MP5ACTX8]
 gi|298601081|gb|EFI57236.1| multi-sensor hybrid histidine kinase [Acidobacterium sp. MP5ACTX8]
          Length = 931

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N KL + L+E  G+      NG EAL    +   D+++MD+Q+ E+ GLE
Sbjct: 683 NILLAEDNAINQKLAKRLLEKRGHKVSVAENGKEALAALEKSSFDLVLMDVQMPEMDGLE 742

Query: 64  ITKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T+ ++E  +L     PV+A+TA AMKGD+ER  + G + Y+SKPIS
Sbjct: 743 ATRTLREREKLTGFHCPVVAMTALAMKGDQERCLEAGMDGYLSKPIS 789



 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 58/111 (52%), Gaps = 9/111 (8%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-------DVIIMDIQL 56
           KV+IV+DN  N ++   L+   G +      G EAL  A+ H         D+++ D+Q+
Sbjct: 533 KVLIVDDNRTNRRILEGLLTRWGMVPTVVSGGEEAL--AKLHAAVQSGVPYDLVLTDMQM 590

Query: 57  QEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             + G  + + IK+ +++    ++ +T+ + +GD  R  + G  AY+ KP+
Sbjct: 591 PNMDGFGLVENIKQKADISTATIMMLTSGSKRGDTARCAELGIAAYLLKPV 641


>gi|119944738|ref|YP_942418.1| sensor histidine kinase [Psychromonas ingrahamii 37]
 gi|119863342|gb|ABM02819.1| sensor histidine kinase with ATPase domain, two fused [Psychromonas
            ingrahamii 37]
          Length = 1574

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 10/127 (7%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++V+DNE+N ++ R+ +E +G +     NG EA+   + H  D ++MD+Q+ EI G E
Sbjct: 1222 KILLVDDNEINRQVAREFLENAGLLVTTATNGREAVNSVKSHVFDAVLMDVQMPEIDGYE 1281

Query: 64   ITKQI----KEDSELQE------IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFM 113
             T++I    K   +LQ       +P+IA+TA AM+GD+ER    G   Y++KPI      
Sbjct: 1282 ATQKIRRWEKTRVDLQPTDGSPVLPIIAMTAHAMEGDKERCLAAGMNDYVTKPIDTRQLF 1341

Query: 114  ETIKKYI 120
            E + ++I
Sbjct: 1342 EALSRWI 1348



 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 67/121 (55%), Gaps = 5/121 (4%)

Query: 6    MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ----HKPDVIIMDIQLQEISG 61
            ++V+DN + +K+   ++    +    T +G +AL +       +  D+ I+D Q+  I G
Sbjct: 1075 LVVDDNPVTLKVIEKMLIHLKFNVTTTESGEKALSVLENALGNNTVDLAIIDWQMGGIDG 1134

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKG-DEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +E  K+IKE+  + ++P++ ++     G   ++ ++ G ++++ KP++ SI +ETI    
Sbjct: 1135 IETAKKIKENPSIPKMPMVLMSGSDRDGLLGQKSKQVGFDSFVLKPVNRSILVETILTVF 1194

Query: 121  G 121
            G
Sbjct: 1195 G 1195


>gi|299146661|ref|ZP_07039729.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
 gi|298517152|gb|EFI41033.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
          Length = 785

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MD+++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDVKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +EIP+IA+TA+A + D+E   + GC  +++KPIS     + + KY
Sbjct: 726 LEATHIIRSYS--KEIPIIALTAYAFEADKELALEMGCNDFVTKPISERTLRKALDKY 781


>gi|160882913|ref|ZP_02063916.1| hypothetical protein BACOVA_00875 [Bacteroides ovatus ATCC 8483]
 gi|237722969|ref|ZP_04553450.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_2_4]
 gi|293372527|ref|ZP_06618909.1| putative CRISPR-associated protein Csc2 [Bacteroides ovatus SD CMC
           3f]
 gi|156111777|gb|EDO13522.1| hypothetical protein BACOVA_00875 [Bacteroides ovatus ATCC 8483]
 gi|229447491|gb|EEO53282.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_2_4]
 gi|292632336|gb|EFF50932.1| putative CRISPR-associated protein Csc2 [Bacteroides ovatus SD CMC
           3f]
          Length = 785

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MD+++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDVKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +EIP+IA+TA+A + D+E   + GC  +++KPIS     + + KY
Sbjct: 726 LEATHIIRSYS--KEIPIIALTAYAFEADKELALEMGCNDFVTKPISERTLRKALDKY 781


>gi|260173727|ref|ZP_05760139.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
 gi|315921992|ref|ZP_07918232.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
 gi|313695867|gb|EFS32702.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
          Length = 785

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MD+++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDVKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +EIP+IA+TA+A + D+E   + GC  +++KPIS     + + KY
Sbjct: 726 LEATHIIRSYS--KEIPIIALTAYAFEADKELALEMGCNDFVTKPISERTLRKALDKY 781


>gi|189424026|ref|YP_001951203.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
 gi|189420285|gb|ACD94683.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
          Length = 1245

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 74/116 (63%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN++N ++  +L+ ++G       NG  A+ELA QH+ D ++MDIQ+  + G E
Sbjct: 987  RVLLVEDNDMNQQVACELLTSAGIEVTVADNGHTAVELAAQHRFDTVLMDIQMPVMDGYE 1046

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             ++ I+ D   +++P+IA+TA AM  D +R  + G   Y+SKPI+      T++++
Sbjct: 1047 ASRLIRADQACRDLPIIAMTAHAMPQDRQRCLESGMNDYVSKPINPQELYSTLERW 1102


>gi|301057605|ref|ZP_07198685.1| PAS domain S-box protein [delta proteobacterium NaphS2]
 gi|300448329|gb|EFK12014.1| PAS domain S-box protein [delta proteobacterium NaphS2]
          Length = 828

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 73/118 (61%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE--LARQHKPDVIIMDIQLQEISGL 62
           +++ EDN +N KL R ++  +GY  +   NG EALE  +A     D+I MD+Q+ E+ GL
Sbjct: 679 ILLAEDNFVNQKLARMMLTKAGYRVVVANNGKEALEKYMASPDDFDLIFMDVQMPEMDGL 738

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK I+E      IP++A+TA AMKGD E+  + G + YI+KPI   +  E ++K++
Sbjct: 739 IATKTIREKG-FDAIPIVAMTAHAMKGDREKCLEAGMDDYITKPIKREVVFEVLEKWV 795



 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 75/124 (60%), Gaps = 7/124 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-----HKPDVIIMDIQLQ 57
           +++++V+DN  N+++   ++E +G   +  +NG   + + R+     +  D+ I DIQ+ 
Sbjct: 524 RRILVVDDNLRNLEILTHILEFAGMAVVALKNGEAVVPILRKALAAGNPFDLCISDIQMP 583

Query: 58  EISGLEITKQIK-EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            +SG E+ ++++ E+  L+++P+IA+++F M+ +    ++ G + ++SKPI     ++ +
Sbjct: 584 VMSGYEVARRVRNEEVPLRDLPMIALSSF-MEREAGLCKEAGFDGFLSKPIHREKLLQMM 642

Query: 117 KKYI 120
            + I
Sbjct: 643 ARLI 646


>gi|91791902|ref|YP_561553.1| ATP-binding region, ATPase-like protein [Shewanella denitrificans
            OS217]
 gi|91713904|gb|ABE53830.1| multi-sensor hybrid histidine kinase [Shewanella denitrificans OS217]
          Length = 1233

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 75/117 (64%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++VEDN +N ++  +L++++GY  +   NG  AL+L  + + D ++MDIQ+  + GL  
Sbjct: 1112 ILLVEDNFINQQVASELLKSAGYDVVIADNGQIALDLVAKQEFDAVLMDIQMPVMDGLTA 1171

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             K ++E    Q++P+IA+TA AM GD+E+    G  A+I+KPI L+   ET+  +I 
Sbjct: 1172 AKILRETYSTQQLPIIAMTAHAMSGDKEKSLNAGMNAHITKPIVLTELFETLAYWIA 1228


>gi|296188236|ref|ZP_06856628.1| PAS domain S-box domain-containing protein [Clostridium
           carboxidivorans P7]
 gi|296047362|gb|EFG86804.1| PAS domain S-box domain-containing protein [Clostridium
           carboxidivorans P7]
          Length = 859

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEISGL 62
           K  + +DNE+N +    LI   GY      +G+EAL L +Q  K D+I+MDIQ+  ++GL
Sbjct: 735 KCFLEDDNEINQRFISTLISKKGYNYFTAFDGIEALNLLKQVKKIDLILMDIQMPNLNGL 794

Query: 63  EITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK I+  E +    IP+IA+TA+AM GD E+    G + YISKPI  +   + I K++
Sbjct: 795 NTTKNIRNIEINTGNHIPIIAMTAYAMIGDREKFLSAGMDDYISKPIDYTTLYKLIDKFL 854

Query: 121 GE 122
             
Sbjct: 855 SN 856


>gi|222055255|ref|YP_002537617.1| response regulator receiver protein [Geobacter sp. FRC-32]
 gi|221564544|gb|ACM20516.1| response regulator receiver protein [Geobacter sp. FRC-32]
          Length = 124

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 72/118 (61%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++IVED E  +KL   L+ + GY  +   +G  ALE  + ++PD++++D+ L E+ G 
Sbjct: 4   KKILIVEDEESLLKLESILLSSKGYSVVGVMDGKAALEEVKANRPDLVVLDVMLPEMDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ + IKE+ E   IPV+ +TA     D ER ++ G EAYI+KP   +  +E I+  I
Sbjct: 64  EVCRHIKENPETSSIPVVMLTAKKSNNDVERGKQAGAEAYITKPFKSAKVIEVIEGLI 121


>gi|154491989|ref|ZP_02031615.1| hypothetical protein PARMER_01620 [Parabacteroides merdae ATCC
           43184]
 gi|154088230|gb|EDN87275.1| hypothetical protein PARMER_01620 [Parabacteroides merdae ATCC
           43184]
          Length = 794

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 76/118 (64%), Gaps = 6/118 (5%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  L R +++   Y  L   +G EA+ L R+H+PD+I+MD+++ ++ G E 
Sbjct: 671 LLIAEDNESNYILIRAVLKE--YDLLHAHDGNEAVRLYREHRPDLILMDLKMPDMDGYEA 728

Query: 65  TKQI-KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T +I KEDS   +IP+IAVTAFA   DE+R+++ G   Y +KPI  +   + I +Y+ 
Sbjct: 729 TVEIRKEDS---DIPIIAVTAFAFSEDEQRVKQNGFNGYAAKPIKPAELKKIIVQYLS 783


>gi|325110166|ref|YP_004271234.1| multi-sensor hybrid histidine kinase [Planctomyces brasiliensis DSM
            5305]
 gi|324970434|gb|ADY61212.1| multi-sensor hybrid histidine kinase [Planctomyces brasiliensis DSM
            5305]
          Length = 1273

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/125 (36%), Positives = 79/125 (63%), Gaps = 8/125 (6%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDNE+N  + +++IE +G+      NG EA++L ++ K D+++MD Q+    G  
Sbjct: 1003 RILVTEDNEINQIVTQEIIERAGFQCRLANNGQEAIDLLKKRKFDLVLMDCQMPVKDGFT 1062

Query: 64   IT---KQIKEDSEL-----QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             T   +QI+   EL     Q +P++A+TA A+KGD+ER  K G +AY++KPI   + + T
Sbjct: 1063 ATAEIRQIQPKGELNKDLPQHLPIVALTANAVKGDQERCLKAGMDAYVAKPIDPQLLIST 1122

Query: 116  IKKYI 120
            I+K +
Sbjct: 1123 IRKLL 1127



 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 8/113 (7%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE----LARQHKP-DVIIMDIQLQE 58
           +++ V+D E N  + +  I T G   +   +  EAL+     AR+ +P ++ I D  + E
Sbjct: 854 RILAVDDVETNRVILQTQIATWGAEVVTVSSANEALQELQTAAREERPFEICITDYNMPE 913

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEER-IRKGGCEAYISKPISLS 110
           + GL++++ +  D +L++   + +T  +  G E R + + G  A   KPI  S
Sbjct: 914 MDGLQLSRSVSNDPDLKDTRFLLLT--SSDGIERRQLEENGIHACSCKPIRPS 964


>gi|149374705|ref|ZP_01892479.1| Signal transduction histidine kinase [Marinobacter algicola DG893]
 gi|149361408|gb|EDM49858.1| Signal transduction histidine kinase [Marinobacter algicola DG893]
          Length = 962

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+ V+DN+ N+KL   L+   G +A    +G EAL  ARQH  D++ MD+Q+  + G
Sbjct: 685 VPRVLAVDDNDANLKLVMTLLNDCGVVAEGATSGFEALSKARQHSFDLVFMDLQMPGMDG 744

Query: 62  LEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +E T++++  D      P+IA+TA A+  +++R+ + G + Y++KPIS S  ++ I  Y 
Sbjct: 745 VETTERLRSLDGASHRTPIIALTAHALAEEQDRLIQQGFDGYLAKPISNSQLIDIIHDYT 804

Query: 121 G 121
           G
Sbjct: 805 G 805


>gi|298676196|ref|YP_003727945.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
 gi|298289184|gb|ADI75149.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
          Length = 123

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 73/116 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED++ N  L  D+++  GY      +G EAL   +  K ++II+DI+L +++G ++
Sbjct: 6   ILIVEDDKCNRDLISDILDLEGYYIDTAIDGEEALRKTKNKKYELIILDIKLPKLNGCDL 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++  E +  P+I +TA AM+GD+E+    GC+ Y+SKPI ++ F + +  Y+
Sbjct: 66  LSEFRKCPETKNTPIIVLTAHAMRGDKEKFESLGCDEYLSKPIDVTKFTKVVNNYV 121


>gi|227823949|ref|YP_002827922.1| putative two-component sensor protein/histidine protein kinase
           [Sinorhizobium fredii NGR234]
 gi|227342951|gb|ACP27169.1| putative two-component sensor protein/histidine protein kinase
           [Sinorhizobium fredii NGR234]
          Length = 123

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VEDNE+N  +    +   G+  L   NG + +E+A   +PD+I+MD+ L  + G
Sbjct: 1   MTRILLVEDNEMNRDMLSRRLSRRGFDVLIAENGKDGVEIAASERPDLILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T+QIK +     IPVIA+TA AM  D +     GC+ Y SKPI L   +  I++ +
Sbjct: 61  WEATRQIKANPVTCGIPVIALTAHAMASDRDMALDAGCDDYDSKPIDLPQLVRKIEQLL 119


>gi|218887769|ref|YP_002437090.1| multi-sensor hybrid histidine kinase [Desulfovibrio vulgaris str.
            'Miyazaki F']
 gi|218758723|gb|ACL09622.1| multi-sensor hybrid histidine kinase [Desulfovibrio vulgaris str.
            'Miyazaki F']
          Length = 1358

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 75/122 (61%), Gaps = 3/122 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VED+ +N      ++E  GY AL   +G  AL+  RQ + D ++MD+Q+  + GL+
Sbjct: 1218 RLLLVEDDHVNRLTVLWMLEKLGYDALAVGDGAAALQALRQGRFDAVLMDVQMPVMDGLQ 1277

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T  I+  ++L    E+PVIA+TA+AM+GD ER+   G + Y+ KP+ +      + +++
Sbjct: 1278 ATAAIRNATDLPGGAEVPVIALTAYAMEGDRERLLAAGMDDYVEKPVDVQALRRVLSRFV 1337

Query: 121  GE 122
            GE
Sbjct: 1338 GE 1339



 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VEDN   +    D++     +A+   +G E L  A   +PD+I+ D+ +  + G  +
Sbjct: 461 VLVVEDNRDMIAYIVDILRPHHQVAV-AFDGEEGLRKALDLRPDLIVCDVMMPRVDGQRM 519

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKPISLSIFMETI 116
            +Q++    + ++PV+ +TA A   DE R+    G  + YI KP + +  + ++
Sbjct: 520 VEQLRRYPGMADVPVLMLTAKA--DDELRVHLLHGAVQGYIQKPFTAAGLLASV 571


>gi|294139125|ref|YP_003555103.1| sensory box histidine kinase/response regulator [Shewanella violacea
            DSS12]
 gi|293325594|dbj|BAJ00325.1| sensory box histidine kinase/response regulator [Shewanella violacea
            DSS12]
          Length = 1235

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 75/116 (64%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY      NG  A+++  +   D ++MDIQ+  + GL  
Sbjct: 1113 VLLVEDNFINQQVATELLKSAGYEVDVADNGQIAIDMIAEKDFDAVLMDIQMPVMDGLTA 1172

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK+I++   LQE+P+IA+TA AM GD E+    G  A+I+KPI L+   +T+  +I
Sbjct: 1173 TKEIRKHFSLQELPIIAMTAHAMSGDREKSLSAGMNAHITKPIVLNELFDTLSYWI 1228



 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 61/124 (49%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++V+DN   ++++  ++    +      NG EAL    +   D++++D  + E+ G++
Sbjct: 968  KTLVVDDNPTALQIYATVMRDFHFEVDTAANGSEALYKLEKSSVDLLLLDWMMPEMDGIQ 1027

Query: 64   ITKQIKE---DSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKK 118
            + +++     D  L + P VI +T +A +  +E   +    A + KP   S +F E I  
Sbjct: 1028 VIEELDRMVADGRLDKRPIVIMMTGYAAEPLKEDADRSNIYAMLQKPFKASALFDEIISA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FTEE 1091


>gi|88706906|ref|ZP_01104605.1| two-component response regulator [Congregibacter litoralis KT71]
 gi|88698828|gb|EAQ95948.1| two-component response regulator [Congregibacter litoralis KT71]
          Length = 128

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 70/117 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDNELN  +    ++ +G+ AL   +G +AL+      PD++++D+ L  I G  
Sbjct: 5   QLLLVEDNELNRDMLSRRLKRAGFDALIAEDGAKALDCIESEHPDLVLLDMNLPLIDGWT 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + K+++ +S L   P+IA+TA AM  D ++    GC+ Y +KPI     +E IK+ +
Sbjct: 65  VCKRVRANSALAGTPIIALTAHAMPEDRDKAIAAGCDDYATKPIDFPALLEKIKRLL 121


>gi|256829193|ref|YP_003157921.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578369|gb|ACU89505.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 778

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED+  N    R L+E SG+      NG EAL+L R    D+++MDIQ+  + G E 
Sbjct: 650 VLMVEDDPSNQVATRKLLEKSGHAVTLAENGQEALDLLRTGDFDIVLMDIQMPVMGGQEA 709

Query: 65  TKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           TK+I+    L   + IPVIA+TA+AM GD E+    G + Y+ KP+SL      I+K+  
Sbjct: 710 TKEIRNSPGLAACKSIPVIALTAYAMTGDREKFLASGMDDYLVKPVSLENLQRMIEKHAP 769

Query: 122 EA 123
            A
Sbjct: 770 RA 771


>gi|189424607|ref|YP_001951784.1| Hpt sensor hybrid histidine kinase [Geobacter lovleyi SZ]
 gi|189420866|gb|ACD95264.1| Hpt sensor hybrid histidine kinase [Geobacter lovleyi SZ]
          Length = 929

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 71/106 (66%), Gaps = 3/106 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D E+N +L R ++E  G+  +Q  NG+EA++ AR+ + D++ MDIQ+  + G E 
Sbjct: 673 ILLVDDVEINRELARIILEKRGHRVVQAANGLEAVDAARKERFDLVFMDIQMPLMDGFEA 732

Query: 65  TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           T +I+       LQ +PVIA+TA+A++GD +R    G + YI+KPI
Sbjct: 733 TNEIRSFELSQGLQPVPVIAMTAYALQGDRDRCLAAGMDGYIAKPI 778



 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEA---LELARQHKP-DVIIMDIQLQEIS 60
            ++V+D  +N +L    +   G   L   +  EA   LE AR  +P  +++ D+Q+ +  
Sbjct: 529 ALVVDDIAINRQLLERFLTRWGMDVLTAGSAEEAFSMLEYARSRRPVQLLLTDLQMPDCD 588

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + +QI+ D    E+ ++ + +   +GD  R R+     Y++KP+  S   E +K  I
Sbjct: 589 GWGLVEQIRNDQRYDELKLVLLPSAGKRGDARRCRELKVNGYLTKPVIHSELYEALKAII 648


>gi|294646931|ref|ZP_06724551.1| response regulator receiver domain protein [Bacteroides ovatus SD
           CC 2a]
 gi|292637730|gb|EFF56128.1| response regulator receiver domain protein [Bacteroides ovatus SD
           CC 2a]
          Length = 150

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MDI++  + G
Sbjct: 32  IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDIKMPRMDG 90

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +E+P+IA+TA+A + D+E   + GC  +++KP+S     + + KY
Sbjct: 91  LEATHIIRSYS--KEVPIIALTAYAFETDKELALEMGCNDFVTKPVSERTLRKALDKY 146


>gi|301312439|ref|ZP_07218355.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
 gi|300829622|gb|EFK60276.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
          Length = 1045

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 926  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFHQHKPQLILMDIKMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  I  + I
Sbjct: 985  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKILKDKI 1034


>gi|212633456|ref|YP_002309981.1| PAS domain-containing protein [Shewanella piezotolerans WP3]
 gi|212554940|gb|ACJ27394.1| PAS domain protein [Shewanella piezotolerans WP3]
          Length = 1203

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 73/119 (61%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++VEDN +N ++  +L++++GY      NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1081 ILLVEDNFINQQVATELLKSAGYTVDVAENGQIALDMIDSANYDAVLMDIQMPVMDGLTA 1140

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            TK++++     E+PVIA+TA AM GD E+    G  A+I+KPI L+   ET+  +I E 
Sbjct: 1141 TKELRKRYSATELPVIAMTAHAMSGDREKSLSAGMNAHITKPIVLNELFETLSHWIEEC 1199


>gi|294809962|ref|ZP_06768636.1| response regulator receiver domain protein [Bacteroides
           xylanisolvens SD CC 1b]
 gi|294442808|gb|EFG11601.1| response regulator receiver domain protein [Bacteroides
           xylanisolvens SD CC 1b]
          Length = 212

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MDI++  + G
Sbjct: 94  IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDIKMPRMDG 152

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +E+P+IA+TA+A + D+E   + GC  +++KP+S     + + KY
Sbjct: 153 LEATHIIRSYS--KEVPIIALTAYAFETDKELALEMGCNDFVTKPVSERTLRKALDKY 208


>gi|307153868|ref|YP_003889252.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
 gi|306984096|gb|ADN15977.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
          Length = 137

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 66/105 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED+ +N     D +E  GY  +   NG+EA+E A+Q +P +I+MDI + ++ GL+ 
Sbjct: 21  ILLAEDDFMNQLTICDYLEVFGYSLIVANNGIEAVEKAQQVQPKLILMDISMPKMDGLQA 80

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              I++  EL   P+IA+TAFAMKGD+E+    G   Y++KPI  
Sbjct: 81  IAAIRQIPELVNTPIIALTAFAMKGDQEKCLTAGANYYVTKPIKF 125


>gi|256838460|ref|ZP_05543970.1| two-component system sensor histidine kinase [Parabacteroides sp.
            D13]
 gi|256739379|gb|EEU52703.1| two-component system sensor histidine kinase [Parabacteroides sp.
            D13]
          Length = 1045

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 926  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFHQHKPQLILMDIKMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  I  + I
Sbjct: 985  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKILKDKI 1034


>gi|150009789|ref|YP_001304532.1| two-component hybrid sensor kinase/response regulator
            [Parabacteroides distasonis ATCC 8503]
 gi|149938213|gb|ABR44910.1| two-component system sensor histidine kinase, with response regulator
            receiver domain [Parabacteroides distasonis ATCC 8503]
          Length = 1045

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 926  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFHQHKPQLILMDIKMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  I  + I
Sbjct: 985  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKILKDKI 1034


>gi|261251052|ref|ZP_05943626.1| hypothetical protein VIA_001071 [Vibrio orientalis CIP 102891]
 gi|260937925|gb|EEX93913.1| hypothetical protein VIA_001071 [Vibrio orientalis CIP 102891]
          Length = 1319

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 77/119 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L++ +    L   NG +A+++  QH  D+++MD+Q+  + G+
Sbjct: 991  QTILLVEDNEVNQEVAIGLLKGTNVNVLTAENGQQAMDMLEQHPVDLVLMDMQMPVLDGV 1050

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              T+QI+ +   Q++P+IA+TA AM+ D ER    G  ++++KPI++    +T+ +Y+ 
Sbjct: 1051 SATEQIRRNPNWQQLPIIAMTANAMQSDVERCITAGMNSHLAKPINVHNLYKTLSQYLS 1109



 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 58/119 (48%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ ++V+DN+    +   L+    + A    NG EAL+  R+ + D+  +D  +  ++G+
Sbjct: 852 KRALVVDDNDSARNILVTLLNAMHFDAKAVSNGFEALDEIRRDQFDLFFVDWNMPGLNGI 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +  + +  LQ      VTA+  +   ++      ++ I KP++ S  ++ I    G
Sbjct: 912 ELLQTAQSERLLQHSKNFLVTAYGREISLDQANSKLVDSLIVKPVNPSNLLDAIMDSFG 970


>gi|256829408|ref|YP_003158136.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
 gi|256578584|gb|ACU89720.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
          Length = 1070

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 75/120 (62%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++VED+ +NM + R ++E  G+  +  RNG EAL+  +    D+++MDIQ+ E+ G+E 
Sbjct: 951  ILLVEDDVVNMTMARRMLEKMGHSVICARNGQEALDTLQAPGVDLVLMDIQMPEMDGIEA 1010

Query: 65   TKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ ++ D   +    +P+IA+TA AM GDEE+    G +AY+SKP   +   E + ++ G
Sbjct: 1011 TEIVRNDPLFTPYARVPIIALTAHAMGGDEEKFLSHGMDAYLSKPFDHARLQELLHRFFG 1070


>gi|309791211|ref|ZP_07685743.1| response regulator receiver [Oscillochloris trichoides DG6]
 gi|308226773|gb|EFO80469.1| response regulator receiver [Oscillochloris trichoides DG6]
          Length = 127

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 68/118 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++V+DN  N  +   +++ SG+  +   NG+ ALE+A   +PD+I+MD+ +  + G
Sbjct: 1   MKTILVVDDNTDNRNIIAQMLKISGFQVVCAINGVHALEVAASERPDLIMMDMAMPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              T  +K D EL  IPVIAVT    + +  R    GCE  I+KPI     ++ +++Y
Sbjct: 61  WSATGHLKADPELNRIPVIAVTGHVTQNEINRALNMGCEDVITKPIDFETMIQKVRRY 118


>gi|237715073|ref|ZP_04545554.1| two-component system sensor histidine kinase [Bacteroides sp. D1]
 gi|262408978|ref|ZP_06085523.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_22]
 gi|229444906|gb|EEO50697.1| two-component system sensor histidine kinase [Bacteroides sp. D1]
 gi|262353189|gb|EEZ02284.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_22]
          Length = 785

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MDI++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDIKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  +E+P+IA+TA+A + D+E   + GC  +++KP+S     + + KY
Sbjct: 726 LEATHIIRSYS--KEVPIIALTAYAFETDKELALEMGCNDFVTKPVSERTLRKALDKY 781


>gi|256829206|ref|YP_003157934.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
 gi|256578382|gb|ACU89518.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
          Length = 1050

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 3/121 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED+ +NM   R ++  +G+      NG +A+EL R+ + D+I+MD+Q+  + GLE
Sbjct: 906  RILLAEDDPVNMFAARRILGKAGHAVTPATNGGQAVELLRESEFDLILMDVQMPVMDGLE 965

Query: 64   ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T  I+ D+ L E   IP++A+TA+AM GD E+   G  + YI+KP+S     E I   I
Sbjct: 966  ATAMIRGDATLGEKSRIPIVAMTAYAMSGDREKFLAGSMDGYIAKPLSCETLYEIISNVI 1025

Query: 121  G 121
             
Sbjct: 1026 A 1026


>gi|319957220|ref|YP_004168483.1| integral membrane sensor hybrid histidine kinase [Nitratifractor
           salsuginis DSM 16511]
 gi|319419624|gb|ADV46734.1| integral membrane sensor hybrid histidine kinase [Nitratifractor
           salsuginis DSM 16511]
          Length = 1054

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL R  +E  G       NG EA EL +Q+  D+I MDIQ+  ++G+E
Sbjct: 760 KILVAEDNPINQKLIRTTLEQFGADVTLASNGKEAFELRKQNDYDLIFMDIQMPVMNGIE 819

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I   ++ + L  IP++A+TA A+ GD ER  + G + YI KPI++    + I  Y 
Sbjct: 820 ATREILHYEQVNHLPHIPIVALTANALTGDRERYLEAGLDNYIPKPINIPELKQIISLYY 879

Query: 121 GE 122
            E
Sbjct: 880 QE 881


>gi|313159680|gb|EFR59037.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein [Alistipes
            sp. HGB5]
          Length = 1049

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN+ N +LF  ++    Y  L   NG+E +E+ RQ +P +++MDI +  ++G E 
Sbjct: 930  ILIAEDNDSNYRLFESILRKE-YTLLHAWNGLETVEIYRQRRPHLVLMDINMPVMNGYEA 988

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T +I++ SE   +P+IAVTAFA   DE+++ + G + Y++KPI+
Sbjct: 989  TAEIRKLSE--SVPIIAVTAFAFASDEQKVLQSGFDGYMAKPIN 1030


>gi|268638179|ref|XP_002649186.1| histidine kinase [Dictyostelium discoideum AX4]
 gi|256013041|gb|EEU04134.1| histidine kinase [Dictyostelium discoideum AX4]
          Length = 1732

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 78/131 (59%), Gaps = 11/131 (8%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQ 57
            +KV++ EDN +N KL + L+   G+     ++G +AL+   + K      D I+MDIQ+ 
Sbjct: 1550 QKVLVAEDNTMNQKLIKTLLTKRGFDITIAKDGKQALDFYHESKNKSILYDCILMDIQMP 1609

Query: 58   EISGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             +SGLE T  I+E   +E   IP+IAVTA AMKGD+E+  + G + Y++KPI+  +  E 
Sbjct: 1610 VLSGLEATCAIREIEANEGGHIPIIAVTAHAMKGDKEKFLESGVDDYVTKPINPKLLYEV 1669

Query: 116  IK----KYIGE 122
            I     KYI E
Sbjct: 1670 INTQICKYIEE 1680


>gi|78484480|ref|YP_390405.1| response regulator receiver domain-containing protein
           [Thiomicrospira crunogena XCL-2]
 gi|78362766|gb|ABB40731.1| response regulator receiver domain protein (CheY-like)
           [Thiomicrospira crunogena XCL-2]
          Length = 132

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VEDN +N K+   L+E  GY A  T NG EAL+   Q   D+I+MD Q+    G E
Sbjct: 5   KILLVEDNLVNQKVALALLEKMGYQADVTANGQEALDTLAQTPYDLILMDCQMPVKDGYE 64

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+ I+  D  L +IP+IA+TA AM GD+E+  + G   Y++KPI+  +  E I  +  +
Sbjct: 65  TTRAIRALDGPLSDIPIIAMTANAMAGDDEKCYEAGMNDYMTKPINSKLMAEKIGAFANQ 124


>gi|262382892|ref|ZP_06076029.1| two-component system sensor histidine kinase [Bacteroides sp.
            2_1_33B]
 gi|262295770|gb|EEY83701.1| two-component system sensor histidine kinase [Bacteroides sp.
            2_1_33B]
          Length = 1021

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 902  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFHQHKPQLILMDIKMPVMDGYEA 960

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  +  + I
Sbjct: 961  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKVLKDKI 1010


>gi|298374183|ref|ZP_06984141.1| two-component system sensor histidine kinase [Bacteroides sp. 3_1_19]
 gi|298268551|gb|EFI10206.1| two-component system sensor histidine kinase [Bacteroides sp. 3_1_19]
          Length = 1045

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 926  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFYQHKPQLILMDIKMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  I  + I
Sbjct: 985  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKILKDKI 1034


>gi|127514128|ref|YP_001095325.1| multi-sensor hybrid histidine kinase [Shewanella loihica PV-4]
 gi|126639423|gb|ABO25066.1| PAS/PAC sensor hybrid histidine kinase [Shewanella loihica PV-4]
          Length = 1768

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 76/120 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N ++  + +E  G I     NG  ALE       D+++MD Q+  + G 
Sbjct: 1424 KRILLVEDNEMNQEVASEFLEQVGVILSIAENGQVALEKLAMQSFDLVLMDCQMPVMDGY 1483

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T ++++  EL ++PVIA+TA AM GD+E   + G   +I+KPI +S+  +T+ +Y+G+
Sbjct: 1484 QATAELRKRPELADLPVIAMTANAMAGDKEMCLRAGMNDHIAKPIEVSLLYKTLLEYLGD 1543



 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ +DN     + R  +E+ G+     R+G EAL   ++    V ++D ++ E+ GLE
Sbjct: 1283 RILVADDNATARDILRSTLESMGFTVDTVRSGAEALSRCQETDYGVALIDWRMPEMDGLE 1342

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDE-ERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              +++   SE    P   + +    GD  ++  +     YI+KPIS S  ++ I   +G+
Sbjct: 1343 TARRLL--SERTNPPKTLIVSAHADGDFIDKAEQAEISGYITKPISASRLLDGIMSALGK 1400


>gi|298387248|ref|ZP_06996801.1| two-component system sensor histidine kinase [Bacteroides sp. 1_1_14]
 gi|298259917|gb|EFI02788.1| two-component system sensor histidine kinase [Bacteroides sp. 1_1_14]
          Length = 1039

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N KLF  +++   Y  L   +G EA+ + ++H P +I+MDI +  + G E 
Sbjct: 920  ILIAEDNESNYKLFESILKYD-YHLLHAWDGQEAVNMFKEHNPQIILMDINMPVLDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            TK+I++ S   ++P+IA+TAFA   DE+R+ + G + Y+ KPI+
Sbjct: 979  TKEIRKYSA--KVPIIAITAFAYASDEQRVMESGFDGYMPKPIN 1020


>gi|255012920|ref|ZP_05285046.1| two-component hybrid sensor kinase/response regulator [Bacteroides
            sp. 2_1_7]
          Length = 1045

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDN  N +LF  +++   Y  +   NG EA+EL  QHKP +I+MDI++  + G E 
Sbjct: 926  ILIAEDNSSNYRLFESILKPE-YKLIHAWNGKEAVELFYQHKPQLILMDIKMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I++ S    +P+IAVTA+A   DE+RI   G +AY +KPI+  I  + I
Sbjct: 985  TAEIRKVS--ASVPIIAVTAYAFAQDEQRIINSGFDAYTAKPINGKILKDKI 1034


>gi|125972809|ref|YP_001036719.1| GAF sensor hybrid histidine kinase [Clostridium thermocellum ATCC
            27405]
 gi|125713034|gb|ABN51526.1| GAF sensor hybrid histidine kinase [Clostridium thermocellum ATCC
            27405]
          Length = 1160

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K +MIV+D+  N+ +    +E  G   +   NG  ALEL R +K D+I+MDI +  + G 
Sbjct: 1039 KTIMIVDDDHRNVFVLAAALEDYGANIIAAENGKMALELLRTNKVDLILMDIMMPVMDGY 1098

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            E  + IK D EL+ IPVIAVTA ++K D+E+  + G + YISKP+   + +  IK +  +
Sbjct: 1099 ETIRAIKGDKELKGIPVIAVTAKSLKSDKEKCIEAGADDYISKPVDYDVLIRLIKAWTAK 1158



 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 51/81 (62%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++++EDNE   K  +++ +  G+  +   +G E LE A+  + D I++DI L ++SG+
Sbjct: 792 KVILVIEDNENFAKYLKEINDGMGFDTIIAGSGKEGLETAKNTRVDGILLDIMLPDMSGI 851

Query: 63  EITKQIKEDSELQEIPVIAVT 83
           E+ +++K   EL +IPV  ++
Sbjct: 852 EVLRELKSIVELGKIPVHVIS 872


>gi|29346674|ref|NP_810177.1| two-component system sensor histidine kinase [Bacteroides
            thetaiotaomicron VPI-5482]
 gi|253568722|ref|ZP_04846133.1| two-component system sensor histidine kinase [Bacteroides sp. 1_1_6]
 gi|29338571|gb|AAO76371.1| two-component system sensor histidine kinase [Bacteroides
            thetaiotaomicron VPI-5482]
 gi|251842795|gb|EES70875.1| two-component system sensor histidine kinase [Bacteroides sp. 1_1_6]
          Length = 1039

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N KLF  +++   Y  L   +G EA+ + ++H P +I+MDI +  + G E 
Sbjct: 920  ILIAEDNESNYKLFESILKYD-YHLLHAWDGQEAVNMFKEHNPQIILMDINMPVLDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            TK+I++ S   ++P+IA+TAFA   DE+R+ + G + Y+ KPI+
Sbjct: 979  TKEIRKYSA--KVPIIAITAFAYASDEQRVMESGFDGYMPKPIN 1020


>gi|298675746|ref|YP_003727496.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
 gi|298288734|gb|ADI74700.1| response regulator receiver protein [Methanohalobium evestigatum
           Z-7303]
          Length = 134

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRD---LIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQ 57
           ++  ++++EDN+LN +L  D   LI++  Y  +   NG+EAL+    +K D+I++DIQL 
Sbjct: 11  VMHNILVIEDNKLNRQLMNDFIELIDSDSYNIINVENGLEALKKVDYYKLDLILLDIQLP 70

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            I GLE+  + KE   ++  P+IAVTA+AM+GD E+    GC+ Y+ KP+ +  F + IK
Sbjct: 71  LIDGLELLSKFKEKPNVKNTPIIAVTAYAMEGDREKFLNAGCDEYLPKPLDVDDFEDKIK 130

Query: 118 KYI 120
           K++
Sbjct: 131 KFL 133


>gi|281417008|ref|ZP_06248028.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum JW20]
 gi|281408410|gb|EFB38668.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum JW20]
          Length = 1160

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 72/120 (60%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K +MIV+D+  N+ +    +E  G   +   NG  ALEL R +K D+I+MDI +  + G 
Sbjct: 1039 KTIMIVDDDHRNVFVLAAALEDYGANIIAAENGKMALELLRTNKVDLILMDIMMPVMDGY 1098

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            E  + IK D EL+ IPVIAVTA ++K D+E+  + G + YISKP+   + +  IK +  +
Sbjct: 1099 ETIRAIKGDKELKGIPVIAVTAKSLKSDKEKCIEAGADDYISKPVDYDVLIRLIKAWTAK 1158



 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 51/81 (62%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++++EDNE   K  +++ +  G+  +   +G E LE A+  + D I++DI L ++SG+
Sbjct: 792 KVILVIEDNENFAKYLKEINDGMGFDTIIAGSGKEGLETAKNTRVDGILLDIMLPDMSGI 851

Query: 63  EITKQIKEDSELQEIPVIAVT 83
           E+ +++K   EL +IPV  ++
Sbjct: 852 EVLRELKSIVELGKIPVHVIS 872


>gi|300869424|ref|ZP_07114009.1| hypothetical protein OSCI_4080003 [Oscillatoria sp. PCC 6506]
 gi|300332554|emb|CBN59207.1| hypothetical protein OSCI_4080003 [Oscillatoria sp. PCC 6506]
          Length = 229

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L  +++ EDNE N+      ++  GY  L  +NG EA+ L     PD+I+MDIQ+  + G
Sbjct: 106 LPLILLAEDNEANISTVSSYLKAKGYRILLAKNGAEAIALTNSENPDLILMDIQMPGMDG 165

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE    I+       +P+IA+TA AM  D +R    G   Y++KP+ L     TI++ + 
Sbjct: 166 LEAIDHIRSAPNSVNVPIIALTALAMTSDRDRCLAAGANDYLTKPVKLKQLATTIQQLLA 225

Query: 122 E 122
            
Sbjct: 226 S 226


>gi|17230218|ref|NP_486766.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17131819|dbj|BAB74425.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 140

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 65/109 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK+++IVEDN++N  L  D +  SGY      +G    +     +PD+I++D++L ++ G
Sbjct: 17  LKRILIVEDNDINRMLLSDYLSYSGYHVQSLSDGSIFFKTIENFQPDLILLDLKLPDVDG 76

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
             + KQI++  +   IPVI V+ FA K D+ER  K G   Y  KPI+L+
Sbjct: 77  YYLLKQIQQQQDFARIPVIVVSGFAFKVDQERAIKLGARGYFVKPINLN 125


>gi|295087809|emb|CBK69332.1| PAS domain S-box [Bacteroides xylanisolvens XB1A]
          Length = 785

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MDI++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDIKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  ++IP+IA+TA+A + D+E   + GC  +++KP+S     + + KY
Sbjct: 726 LEATHIIRSYS--KDIPIIALTAYAFETDKELALEMGCNDFVTKPVSERTLRKALDKY 781


>gi|224540067|ref|ZP_03680606.1| hypothetical protein BACCELL_04980 [Bacteroides cellulosilyticus DSM
            14838]
 gi|224518298|gb|EEF87403.1| hypothetical protein BACCELL_04980 [Bacteroides cellulosilyticus DSM
            14838]
          Length = 1039

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN  N KLF  +++   Y  +   +GMEA+E+ R+H P +++MDI +  + G E 
Sbjct: 920  ILVAEDNASNYKLFESILKYD-YHLIHAWDGMEAVEMFRKHNPQIVLMDINMPVMDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   +IP+IAVTAFA   DE+++ + G + Y+ KPI+
Sbjct: 979  TREIRKYS--AKIPIIAVTAFAYASDEQKVMESGFDGYMPKPIN 1020


>gi|217972048|ref|YP_002356799.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
 gi|217497183|gb|ACK45376.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
          Length = 1792

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1445 KRILLVEDNEMNLEVASEFLEQVGIILSIATNGQIALDKLSQQHFDLVLMDCQMPVMDGY 1504

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+ I++  EL  +PV+A+TA AM GD +   + G   +I+KPI +++  +T+ KY+  
Sbjct: 1505 QATQAIRKRPELANLPVVAMTANAMAGDRDMCIRAGMNDHIAKPIEVNVLYQTLLKYLAP 1564

Query: 123  A 123
            A
Sbjct: 1565 A 1565



 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 56/135 (41%), Gaps = 17/135 (12%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             V++V+DN     + R  +E+ G+     R+G EA+        +V ++D ++  + GLE
Sbjct: 1286 SVLVVDDNATARDIMRTTLESMGFRVDTVRSGEEAISRCLLQAYEVALIDWKMPNMDGLE 1345

Query: 64   ITK-----------------QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
              +                    +     +  ++ V+A A      +I +     YISKP
Sbjct: 1346 TARQIQLQAQSQSQSQSQPQSHPQPQPQPQPKILMVSAHADHEFLTQIEQLALAGYISKP 1405

Query: 107  ISLSIFMETIKKYIG 121
            IS S  ++ I   IG
Sbjct: 1406 ISASRLLDGIMNAIG 1420


>gi|14133650|gb|AAK54090.1|AF362371_1 histidine kinase DhkI [Dictyostelium discoideum]
          Length = 1736

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 78/131 (59%), Gaps = 11/131 (8%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQ 57
            +KV++ EDN +N KL + L+   G+     ++G +AL+   + K      D I+MDIQ+ 
Sbjct: 1550 QKVLVAEDNPMNQKLIKTLLTKRGFDITIAKDGKQALDFYHESKNKSILYDCILMDIQMP 1609

Query: 58   EISGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             +SGLE T  I+E   +E   IP+IAVTA AMKGD+E+  + G + Y++KPI+  +  E 
Sbjct: 1610 ILSGLEATCAIREIEANEGGHIPIIAVTAHAMKGDKEKFLESGVDDYVTKPINPKLLYEV 1669

Query: 116  IK----KYIGE 122
            I     KYI E
Sbjct: 1670 INTQICKYIEE 1680


>gi|298481842|ref|ZP_07000032.1| two-component system sensor histidine kinase [Bacteroides sp. D22]
 gi|298272064|gb|EFI13635.1| two-component system sensor histidine kinase [Bacteroides sp. D22]
          Length = 785

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L ++LI    Y  L  ++G+EA+E+ +Q++PD+I+MDI++  + G
Sbjct: 667 IKKILVAEDVESNFILLKNLIGRE-YTLLWAKDGVEAIEMYKQYQPDLILMDIKMPRMDG 725

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T  I+  S  ++IP+IA+TA+A + D+E   + GC  +++KP+S     + + KY
Sbjct: 726 LEATHIIRSYS--KDIPIIALTAYAFETDKELALEMGCNDFVTKPVSERTLRKALDKY 781


>gi|183220127|ref|YP_001838123.1| putative two-component sensor protein [Leptospira biflexa serovar
            Patoc strain 'Patoc 1 (Paris)']
 gi|189910247|ref|YP_001961802.1| two component response regulator sensor histidine kinase/response
            regulator subunits [Leptospira biflexa serovar Patoc
            strain 'Patoc 1 (Ames)']
 gi|167774923|gb|ABZ93224.1| Sensor histidine kinase and response regulator of a two component
            complex [Leptospira biflexa serovar Patoc strain 'Patoc 1
            (Ames)']
 gi|167778549|gb|ABZ96847.1| Putative two-component sensor protein [Leptospira biflexa serovar
            Patoc strain 'Patoc 1 (Paris)']
          Length = 1164

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 77/119 (64%), Gaps = 2/119 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            KVMIVEDN +NM L + ++       I ++  NG+EA+E  ++ +PD+I+MDIQ+ E++G
Sbjct: 1043 KVMIVEDNPVNMMLTKTIVSKILQSAIIIEATNGLEAVEHFKKTEPDLILMDIQMPEMNG 1102

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + T++I++ +    +P+IA+TA  +  +E R  + G   YISKP+ L+   E +K ++
Sbjct: 1103 YDATREIRKLNIGHNVPIIALTAGTLSDEENRCLESGMNDYISKPVVLNTIAEKLKHWL 1161



 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 64/122 (52%), Gaps = 10/122 (8%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEIS 60
            ++KVM+V+DNE N+ + ++++           + + AL +  + +  DVII D  + E++
Sbjct: 896  IQKVMVVDDNETNLSVVKEMLSYKNIETYTFNSPILALQDFQKGNNYDVIISDYNMPEMN 955

Query: 61   GLEITKQIKED--SELQEIPVIAVTAFAMKGDEERIRKGGCEAYIS----KPISLSIFME 114
            GLE   Q+K    ++ +++P   + +     +E+ I + G E  +     KPI  +I  E
Sbjct: 956  GLEFIAQLKNMALTKKEKLPFFTIHS---SSNEDIIYEKGKELGVGVILLKPIQTNILYE 1012

Query: 115  TI 116
            ++
Sbjct: 1013 SL 1014


>gi|66822471|ref|XP_644590.1| histidine kinase [Dictyostelium discoideum AX4]
 gi|74860532|sp|Q86AT9|DHKI_DICDI RecName: Full=Hybrid signal transduction histidine kinase I
 gi|60472742|gb|EAL70692.1| histidine kinase [Dictyostelium discoideum AX4]
          Length = 1736

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 78/131 (59%), Gaps = 11/131 (8%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQ 57
            +KV++ EDN +N KL + L+   G+     ++G +AL+   + K      D I+MDIQ+ 
Sbjct: 1550 QKVLVAEDNTMNQKLIKTLLTKRGFDITIAKDGKQALDFYHESKNKSILYDCILMDIQMP 1609

Query: 58   EISGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             +SGLE T  I+E   +E   IP+IAVTA AMKGD+E+  + G + Y++KPI+  +  E 
Sbjct: 1610 ILSGLEATCAIREIEANEGGHIPIIAVTAHAMKGDKEKFLESGVDDYVTKPINPKLLYEV 1669

Query: 116  IK----KYIGE 122
            I     KYI E
Sbjct: 1670 INTQICKYIEE 1680


>gi|309790134|ref|ZP_07684707.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides DG6]
 gi|308227859|gb|EFO81514.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides DG6]
          Length = 1034

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 72/116 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+ + +  D +    +  +  RNG EA+E A++++P +I++DIQ+  + GL  
Sbjct: 902  ILLAEDNEMTIDVVSDYLHYLNFEVVVARNGYEAIERAQEYRPALILIDIQMPVMDGLHA 961

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++++     +  P+IA+TA AM+GD ER    G   Y+SKPISL   +E I++ +
Sbjct: 962  IRELRALPAFRTTPIIALTALAMQGDRERCLAAGANEYLSKPISLHGLVEVIQQIL 1017


>gi|304411121|ref|ZP_07392737.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|307301756|ref|ZP_07581514.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
 gi|304350656|gb|EFM15058.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|306913794|gb|EFN44215.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
          Length = 1784

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1437 KRILLVEDNEMNLEVASEFLEQVGIILSIATNGQIALDKLSQQHFDLVLMDCQMPVMDGY 1496

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+ I++  EL  +PV+A+TA AM GD +   + G   +I+KPI +++  +T+ KY+  
Sbjct: 1497 QATQAIRKRPELANLPVVAMTANAMAGDRDMCIRAGMNDHIAKPIEVNVLYQTLLKYLAP 1556

Query: 123  A 123
            A
Sbjct: 1557 A 1557



 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 9/127 (7%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             V++V+DN     + R  +E+ G+     R+G EA+        +V ++D ++  + GLE
Sbjct: 1286 SVLVVDDNATARDIMRTTLESMGFRVDTVRSGEEAISRCLLQAYEVALIDWKMPNMDGLE 1345

Query: 64   ITK---------QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
              +            +     +  ++ V+A A      +I +     YISKPIS S  ++
Sbjct: 1346 TARQIQLQAQSQSQSQPQSHPQPKILMVSAHADHEFLTQIEQLALAGYISKPISASRLLD 1405

Query: 115  TIKKYIG 121
             I   IG
Sbjct: 1406 GIMNAIG 1412


>gi|189465571|ref|ZP_03014356.1| hypothetical protein BACINT_01929 [Bacteroides intestinalis DSM
            17393]
 gi|189437845|gb|EDV06830.1| hypothetical protein BACINT_01929 [Bacteroides intestinalis DSM
            17393]
          Length = 1039

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN  N KLF  +++   Y  +   +GMEA+E+ R+H P +++MDI +  + G E 
Sbjct: 920  ILVAEDNASNYKLFESILKYD-YHLIHAWDGMEAVEMFREHNPQIVLMDINMPVMDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   +IP+IAVTAFA   DE+++ + G + Y+ KPI+
Sbjct: 979  TREIRKYS--AKIPIIAVTAFAYASDEQKVMESGFDGYMPKPIN 1020


>gi|303246719|ref|ZP_07332997.1| Hpt sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
 gi|302492059|gb|EFL51937.1| Hpt sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
          Length = 625

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 73/120 (60%), Gaps = 3/120 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDN +N    ++L+E  G+  +    G  ALE+ R+ + DVI+MDIQ+ E+ GLE 
Sbjct: 374 ILLAEDNPINQIYAQELLEMDGHRVMVAHTGRRALEMLRRQRFDVILMDIQMPEMDGLEA 433

Query: 65  TKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+ I++D+      +IP++A+TA A+KGD E   + G   Y+SKP+S       + + +G
Sbjct: 434 TRAIRQDTTGDFDPQIPIVALTAHALKGDRETFLRAGMNEYLSKPVSPESLAAALSRAMG 493


>gi|152999371|ref|YP_001365052.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS185]
 gi|151363989|gb|ABS06989.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS185]
          Length = 1782

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1435 KRILLVEDNEMNLEVASEFLEQVGIILSIATNGQIALDKLSQQHFDLVLMDCQMPVMDGY 1494

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+ I++  EL  +PV+A+TA AM GD +   + G   +I+KPI +++  +T+ KY+  
Sbjct: 1495 QATQAIRKRPELANLPVVAMTANAMAGDRDMCIRAGMNDHIAKPIEVNVLYQTLLKYLAP 1554

Query: 123  A 123
            A
Sbjct: 1555 A 1555



 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             V++V+DN     + R  +E+ G+     R+G EA+        +V ++D ++  + GLE
Sbjct: 1286 SVLVVDDNATARDIMRTTLESMGFRVDTVRSGEEAISRCLLQAYEVALIDWKMPNMDGLE 1345

Query: 64   ITKQIKEDSELQEI-------PVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              +QI+  ++ Q          ++ V+A A +    +I +     YISKPIS S  ++ I
Sbjct: 1346 TARQIQLQAQSQSQSQPQSQPKILMVSAHADREFLTQIEQLALAGYISKPISASRLLDGI 1405

Query: 117  KKYIG 121
               IG
Sbjct: 1406 MNAIG 1410


>gi|126175702|ref|YP_001051851.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
 gi|125998907|gb|ABN62982.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
          Length = 1784

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1437 KRILLVEDNEMNLEVASEFLEQVGIILSIATNGQIALDKLSQQHFDLVLMDCQMPVMDGY 1496

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+ I++  EL  +PV+A+TA AM GD +   + G   +I+KPI +++  +T+ KY+  
Sbjct: 1497 QATQAIRKRPELANLPVVAMTANAMAGDRDMCIRAGMNDHIAKPIEVNVLYQTLLKYLAP 1556

Query: 123  A 123
            A
Sbjct: 1557 A 1557



 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 9/127 (7%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             V++V+DN     + R  +E+ G+     R+G EA+        +V ++D ++  + GLE
Sbjct: 1286 SVLVVDDNATARDIMRTTLESMGFRVDTVRSGEEAISRCLLQAYEVALIDWKMPNMDGLE 1345

Query: 64   ITK---------QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
              +            +     +  ++ V+A A      +I +     YISKPIS S  ++
Sbjct: 1346 TARQIQLQAQSQSQSQPQSHPQPKILMVSAHADHEFLTQIEQLALAGYISKPISASRLLD 1405

Query: 115  TIKKYIG 121
             I   IG
Sbjct: 1406 GIMNAIG 1412


>gi|160873991|ref|YP_001553307.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|160859513|gb|ABX48047.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|315266220|gb|ADT93073.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS678]
          Length = 1786

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N+++  + +E  G I     NG  AL+   Q   D+++MD Q+  + G 
Sbjct: 1439 KRILLVEDNEMNLEVASEFLEQVGIILSIATNGQIALDKLSQQHFDLVLMDCQMPVMDGY 1498

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+ I++  EL  +PV+A+TA AM GD +   + G   +I+KPI +++  +T+ KY+  
Sbjct: 1499 QATQAIRKRPELANLPVVAMTANAMAGDRDMCIRAGMNDHIAKPIEVNVLYQTLLKYLAP 1558

Query: 123  A 123
            A
Sbjct: 1559 A 1559



 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 55/129 (42%), Gaps = 11/129 (8%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             V++V+DN     +    +E+ G+     R+G EA+        +V ++D ++  + GLE
Sbjct: 1286 SVLVVDDNATARDIMCTTLESMGFRVDTVRSGEEAISRCLLQAYEVALIDWKMPNMDGLE 1345

Query: 64   ITK-----------QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIF 112
              +              +     +  ++ V+A A      +I +     YISKPIS S  
Sbjct: 1346 TARQIQLQAQSQSQSQSQPQSHPQPKILMVSAHADHEFLTQIEQLALAGYISKPISASRL 1405

Query: 113  METIKKYIG 121
            ++ I   IG
Sbjct: 1406 LDGIMNAIG 1414


>gi|114566853|ref|YP_754007.1| signal transduction histidine kinase-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114337788|gb|ABI68636.1| PAS/PAC sensor hybrid histidine kinase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 763

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 75/121 (61%), Gaps = 2/121 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNE+N  +  +L+ + G+      NG+EALEL  ++  D++ MDI +  + GLE 
Sbjct: 535 ILVVEDNEVNQMVLSNLLRSQGHQVEVAANGVEALELLDKNNYDLVFMDILMPVMDGLET 594

Query: 65  TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T++I+E  E+    IP+IA+TA A+ GD E+    G + Y++KP+ +    + I K I +
Sbjct: 595 TRRIREQEEITGFHIPIIAITAHAIHGDREKFLAAGMDDYLAKPVQMEELNQAISKIIKK 654

Query: 123 A 123
           A
Sbjct: 655 A 655


>gi|163750485|ref|ZP_02157724.1| sensory box histidine kinase/response regulator [Shewanella benthica
            KT99]
 gi|161329806|gb|EDQ00794.1| sensory box histidine kinase/response regulator [Shewanella benthica
            KT99]
          Length = 1235

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 74/116 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY      NG  A+++  +   D ++MDIQ+  + GL  
Sbjct: 1113 VLLVEDNVINQQVATELLKSAGYEVDVADNGQIAIDMLAEKDFDAVLMDIQMPVMDGLTA 1172

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I++   L E+P+IA+TA AM GD E+    G  A+I+KPI LS   +T+  +I
Sbjct: 1173 TREIRKHFSLHELPIIAMTAHAMSGDREKSLSAGMNAHITKPIVLSELFDTLSFWI 1228



 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++V+DN   ++++  ++    +      NG EAL    +   D++++D  + E+ G++
Sbjct: 968  KALVVDDNPTALQIYSTVMRDFHFEVDTAANGSEALYKLEKSSVDLLLLDWMMPEMDGIQ 1027

Query: 64   ITKQIKE---DSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKK 118
            +  ++     D  L + P VI +TA+A +  +E + +    A + KP   S +F E I  
Sbjct: 1028 VIDELDRMVADGRLDKRPIVIMMTAYAAEPLKEDVDRSNIYAMLQKPFKASALFNEIIGA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FAEE 1091


>gi|23016213|ref|ZP_00055971.1| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 788

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 75/118 (63%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGL 62
           +V++VEDNE+N +L  +L+  +G   +   +G +AL+ LAR ++ D I+MD Q+  + G 
Sbjct: 454 RVLLVEDNEMNQELATELLSQAGMEVVVAVHGQDALDILARDNRFDGILMDCQMPVMDGY 513

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+ +  L  IPVIA+TA AM GD E++ + G   +I+KP++L     T+ K+I
Sbjct: 514 TATRAIRANPALSAIPVIAMTANAMAGDREKVMEAGMLDHIAKPLNLETMFSTMAKWI 571



 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELA----RQHKP-DVIIMDIQLQE 58
           +V++V+DN    ++   + +  G       +G +ALE+     R+  P D+I+MD ++  
Sbjct: 303 RVLVVDDNAAAREILSAMAKGFGLEVDSAWDGTQALEMVAAAERKDLPYDLILMDWKMPI 362

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGC--EAYISKPISLSIFMETI 116
           + G+E  ++++     +   VI VTA+  +       + G   +  ++KP++ +  +E I
Sbjct: 363 MDGVETVQKLQHGDHARIPAVIMVTAYGREEAATNAEERGVVMKTVLTKPVTAASLLEAI 422

Query: 117 KKYIGEA 123
            + +G+ 
Sbjct: 423 GETLGKG 429


>gi|255523233|ref|ZP_05390204.1| PAS/PAC sensor hybrid histidine kinase [Clostridium carboxidivorans
           P7]
 gi|296186196|ref|ZP_06854601.1| PAS domain S-box domain-containing protein [Clostridium
           carboxidivorans P7]
 gi|255513101|gb|EET89370.1| PAS/PAC sensor hybrid histidine kinase [Clostridium carboxidivorans
           P7]
 gi|296049464|gb|EFG88893.1| PAS domain S-box domain-containing protein [Clostridium
           carboxidivorans P7]
          Length = 779

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 74/115 (64%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED++LN ++   +++  GY+     NG+EA+++    K D+I+MDIQ+  ++G+E 
Sbjct: 544 ILLVEDDKLNQQVIGRMLKERGYLVDIAGNGLEAIKMYENKKYDIILMDIQMPVMNGIET 603

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           TK I+E      IP+IA+TA+A+KGD+E+    G + YI KP+ +      I+ +
Sbjct: 604 TKIIREKEIENHIPIIAITAYALKGDKEKFLSKGMDDYIPKPVKMDKLFNVIESH 658


>gi|114776328|ref|ZP_01451373.1| CheY-like receiver protein [Mariprofundus ferrooxydans PV-1]
 gi|114553158|gb|EAU55556.1| CheY-like receiver protein [Mariprofundus ferrooxydans PV-1]
          Length = 121

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+DN LN++L RD++E  G+       G E + + R++ PD+++MD+++  ISG
Sbjct: 1   MSRILIVDDNALNLELARDILELDGFEVETASAGDEGVAMVRRNPPDLVLMDLRMPGISG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE    +++D    ++PV+ +TA  MKG++ER+   G   ++ KPI  + F + +  ++
Sbjct: 61  LEALAILRKDG-FDDLPVVVLTASVMKGEKERLLDMGFNGFLQKPIDAASFSDEVSSFL 118


>gi|119776261|ref|YP_929001.1| sensory box histidine kinase/response regulator [Shewanella
            amazonensis SB2B]
 gi|119768761|gb|ABM01332.1| multi-sensor hybrid histidine kinase [Shewanella amazonensis SB2B]
          Length = 1236

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 72/118 (61%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY      NG  +LE+  +   D I+MDIQ+  + GL  
Sbjct: 1111 VLLVEDNFINQQVATELLKSAGYEVDVADNGQISLEMVGKRSYDAILMDIQMPVMDGLTA 1170

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++     E+P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +IG 
Sbjct: 1171 ATELRKRYSFDELPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLSHWIGH 1228



 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  ++    +       G EAL    + + D++++D  + E+ G++
Sbjct: 968  RTLVVDDNPTALQIYSSVMRDFHFEVETASTGAEALYKLCKQQVDLVLLDWMMPEMDGIQ 1027

Query: 64   ITKQIKE---DSELQEIPVIAV-TAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIK 117
            +   I E   + +L   PVI + TA+A +  +  +      A + KP  + S+F E I+
Sbjct: 1028 VIDAIDEMVAEGKLAARPVIIIMTAYAAEPLKVDLDSDRVFAMLQKPFKASSLFDEIIR 1086


>gi|332702425|ref|ZP_08422513.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
 gi|332552574|gb|EGJ49618.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
          Length = 1143

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN +N +    ++  +G+ +    NG EAL+   +   D+++MD+Q+ E+ GLE 
Sbjct: 887  ILLAEDNRINQEFLVHMLGAAGHRSRVAANGREALQALAEETFDLVLMDVQMPEMDGLET 946

Query: 65   TKQIKE-DSELQE--IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I+E D  L +  IP+IAVTA+AMKGD+ER    G + Y+SKP+   +    + + +
Sbjct: 947  TRRIREHDGRLFDPAIPIIAVTAYAMKGDQERFLAAGMDGYVSKPVDFGLLSRVMARVL 1005


>gi|317150360|ref|XP_001823967.2| histidine kinase J7 [Aspergillus oryzae RIB40]
          Length = 1304

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 1110 ILLAEDNDVNQKLAVKILEKHNHKVSVVSNGLEAVEAVKQHRYDVILMDVQMPVMGGFEA 1169

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   +S L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1170 TGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1226


>gi|83772706|dbj|BAE62834.1| unnamed protein product [Aspergillus oryzae]
          Length = 1362

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 1149 ILLAEDNDVNQKLAVKILEKHNHKVSVVSNGLEAVEAVKQHRYDVILMDVQMPVMGGFEA 1208

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   +S L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1209 TGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1265


>gi|309791482|ref|ZP_07685986.1| two-component response regulator [Oscillochloris trichoides DG6]
 gi|308226479|gb|EFO80203.1| two-component response regulator [Oscillochloris trichoides DG6]
          Length = 121

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 70/120 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    ++  GY  +   +G + + +A+   PD+I+MD+ L  + G
Sbjct: 1   MSKILLVEDNEMNRDMLSRRLQRKGYEVVIATDGEQGVAMAQSELPDLILMDMSLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+ IK    +  +P+IA+TA AM GD+E+    GC+ Y +KP+ L   +  I+  + 
Sbjct: 61  WQATRMIKAQPTIASVPIIALTAHAMAGDQEKCFAAGCDDYDTKPVDLPRLLAKIEALLA 120


>gi|148655114|ref|YP_001275319.1| histidine kinase [Roseiflexus sp. RS-1]
 gi|148567224|gb|ABQ89369.1| histidine kinase [Roseiflexus sp. RS-1]
          Length = 258

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 69/119 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++++D+     +  D ++  GY      +G E L LA    PD++I+D++L+ + GL+
Sbjct: 134 HILLIDDDGKGSAVIGDYLQRCGYCVTHVVSGEEGLALAHHEPPDIVIVDLRLRGLDGLD 193

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++ D     +P+IA+TA AM GD ER  + G + Y+SKP+ L    E I   +G+
Sbjct: 194 VIRRLRADVAASTLPIIALTALAMPGDRERSLEAGADVYLSKPVRLRRLAEEIAALLGQ 252


>gi|238499603|ref|XP_002381036.1| two-component osmosensing histidine kinase (Bos1), putative
           [Aspergillus flavus NRRL3357]
 gi|220692789|gb|EED49135.1| two-component osmosensing histidine kinase (Bos1), putative
           [Aspergillus flavus NRRL3357]
          Length = 900

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDN++N KL   ++E   +      NG+EA+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 687 ILLAEDNDVNQKLAVKILEKHNHKVSVVSNGLEAVEAVKQHRYDVILMDVQMPVMGGFEA 746

Query: 65  TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           T +I+E   +S L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 747 TGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 803


>gi|262404023|ref|ZP_06080578.1| hypothetical protein VOA_002011 [Vibrio sp. RC586]
 gi|262349055|gb|EEY98193.1| hypothetical protein VOA_002011 [Vibrio sp. RC586]
          Length = 1323

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K V++VEDNE+N ++   L++ +G       NG EALE   Q + D+++MD+Q+  + G+
Sbjct: 992  KSVLLVEDNEVNQEVALGLLQDTGLRVTVANNGQEALEKIEQARFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              TK+I+ D   +++P++A+TA AM  D ER  + G   ++SKPI +  F   +K++
Sbjct: 1052 TATKRIRADKRWKDLPIVAMTANAMTVDIERCTQAGMNDHLSKPIDIDKFYSVLKQF 1108



 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 8/123 (6%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+V++V+DN+    +   L+    +  +   NG EAL   +  K D++ +D  +  ++G+
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEIQHKKFDMLFVDWNMPGMNGI 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFA----MKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           E+  +++     ++     VTA+     + G+  ++     +A I KP++ S  ++ I  
Sbjct: 912 ELLTRVQSLGLREKTKCFLVTAYGRDINLDGENGKL----VDALIVKPVNPSNLLDAIVT 967

Query: 119 YIG 121
             G
Sbjct: 968 SYG 970


>gi|320581795|gb|EFW96014.1| Histidine kinase osmosensor [Pichia angusta DL-1]
          Length = 1043

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 73/124 (58%), Gaps = 7/124 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG EA+E  +++  DVI+MD+Q+  + G E
Sbjct: 859 KILLAEDNLVNQKLAVKILENHGHSVEVVENGQEAVEAVKKNHYDVILMDVQMPIMGGFE 918

Query: 64  ITKQIKE-------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            T +I+E       DS     P++A+TA AM GD ER  K   + Y+SKP+  S+ ++TI
Sbjct: 919 ATAKIREWEKKKYVDSMAFRTPIVALTAHAMLGDRERCLKAQMDEYLSKPLKPSLLLQTI 978

Query: 117 KKYI 120
            K I
Sbjct: 979 SKCI 982


>gi|288941098|ref|YP_003443338.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Allochromatium vinosum DSM 180]
 gi|288896470|gb|ADC62306.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Allochromatium vinosum DSM 180]
          Length = 330

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 69/117 (58%), Gaps = 1/117 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D   N+ + R ++E   Y  L  RNG++A+ELA++H P +I++DIQ+  + G  
Sbjct: 5   RLLVVDDEPANLAVLRQILEPD-YSLLFARNGLDAVELAKRHHPSLILLDIQMPGMDGYS 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               +K D   + IPVI VT  +  GDEER    GC  Y+ KP++  I    ++ ++
Sbjct: 64  ACSALKADPSTEAIPVIFVTTLSQLGDEERGFDVGCVDYLVKPVTAGIVRARVRAHL 120


>gi|127511393|ref|YP_001092590.1| PAS/PAC sensor hybrid histidine kinase [Shewanella loihica PV-4]
 gi|126636688|gb|ABO22331.1| multi-sensor hybrid histidine kinase [Shewanella loihica PV-4]
          Length = 1230

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 76/117 (64%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N ++  +L++++GY      NG  AL++    + D ++MDIQ+  + GL 
Sbjct: 1111 QILLVEDNFINQQVATELLKSAGYEVDVAENGQVALDMVDAKQYDAVLMDIQMPVMDGLT 1170

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK++++    +E+PVIA+TA AM GD E+    G  A+I+KPI L+   +T+ ++I
Sbjct: 1171 ATKELRKRYTKEELPVIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFDTLAQWI 1227



 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISGL 62
            K ++V+DN   ++++   +    +      NG EAL    +H+P D++++D  + E+ G+
Sbjct: 968  KTLVVDDNPTALQIYSTAMRDFHFDVDTASNGAEAL-YKLEHRPVDLLLLDWMMPEMDGV 1026

Query: 63   EITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIK 117
            E+ K +     D  L++ PV I +TA+A +  +E +      A + KP   S +F E I 
Sbjct: 1027 EVIKALDAMVADGRLEKRPVIIMMTAYASEPLKEDLDDLDIYAMLQKPFKASALFDEIIA 1086

Query: 118  KYI 120
             +I
Sbjct: 1087 AFI 1089


>gi|163849119|ref|YP_001637163.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222527092|ref|YP_002571563.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
 gi|163670408|gb|ABY36774.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222450971|gb|ACM55237.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
          Length = 130

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 70/122 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+DN  N  +   +++ SG+      +   AL++AR  +P +I+MD+ +  + G
Sbjct: 1   MSYILVVDDNFDNRHIIGQMLQFSGFTVELVADAHSALQIARTRRPGLILMDLSMPGLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              T+ ++ D EL  IP++AV+    + D ER ++ GC  +++KPI     +E  ++Y G
Sbjct: 61  WTATEYVRRDPELHSIPIVAVSGHVTRNDIERAKRAGCVEFLAKPIDYEHLIEVARRYTG 120

Query: 122 EA 123
           +A
Sbjct: 121 QA 122


>gi|332704625|ref|ZP_08424713.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
 gi|332554774|gb|EGJ51818.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
          Length = 1051

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 79/121 (65%), Gaps = 1/121 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDN++N  L R+L+   G+ A     G+EAL+  RQ + D+++MDI++ +++GL+
Sbjct: 929  RVLVAEDNQINQVLIRELLGMQGHTASIVGTGLEALQALRQAEYDLVLMDIRMPDMNGLQ 988

Query: 64   ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++I+  ++   +IPVIA+TA+A++GD +R    G + Y++KPI +  F   ++   G 
Sbjct: 989  AVQRIRAGEAGKTDIPVIALTAYALEGDRKRFLAAGMDGYLAKPIRIEEFNTVLRDVAGR 1048

Query: 123  A 123
            A
Sbjct: 1049 A 1049


>gi|89902313|ref|YP_524784.1| PAS/PAC sensor hybrid histidine kinase [Rhodoferax ferrireducens
           T118]
 gi|89347050|gb|ABD71253.1| PAS/PAC sensor hybrid histidine kinase [Rhodoferax ferrireducens
           T118]
          Length = 1007

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIAL-QTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           L+ ++ VEDN  NM+L + LI     + L    +GM+ + LAR H P VI+MDI L  IS
Sbjct: 872 LRTLLYVEDNRANMELVKQLIARRPDMRLLSATDGMQGITLARIHLPKVILMDINLPGIS 931

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           GL+  K ++ED   + IPV+A++A AM  D E+  + G   Y++KPI ++ FME +
Sbjct: 932 GLQALKILREDPATRHIPVVAISANAMPRDIEKGLQAGFLRYLTKPIKVNEFMEVL 987


>gi|260946877|ref|XP_002617736.1| hypothetical protein CLUG_03180 [Clavispora lusitaniae ATCC 42720]
 gi|140083809|gb|ABO84860.1| histidine kinase receptor NIK1 [Clavispora lusitaniae]
 gi|238849590|gb|EEQ39054.1| hypothetical protein CLUG_03180 [Clavispora lusitaniae ATCC 42720]
          Length = 1082

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  R++K DV++MD+Q+  + G E
Sbjct: 866 KILLAEDNLVNQKLAVKILEKQGHKVHVVENGLEAFEAIRKNKYDVVLMDVQMPVMGGFE 925

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 926 ATEKIRQWEKKSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 985

Query: 116 IKKYI 120
           I K I
Sbjct: 986 IAKCI 990


>gi|291567579|dbj|BAI89851.1| two-component hybrid sensor and regulator [Arthrospira platensis
            NIES-39]
          Length = 1778

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 67/105 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N+      +   GY  +  ++G +A++LA+   P++I+MDIQ+  I GLE 
Sbjct: 1661 ILIAEDNEANIMSLSSYLGAKGYRLIIAKDGQQAIDLAQSESPNLILMDIQMPGIDGLEA 1720

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              +I++ + + ++P+IA+TA AM GD E+  + G   Y++KP+ L
Sbjct: 1721 INRIRQITTMSQVPIIALTALAMTGDREKCLEAGANDYVAKPVKL 1765


>gi|298491151|ref|YP_003721328.1| histidine kinase ['Nostoc azollae' 0708]
 gi|298233069|gb|ADI64205.1| histidine kinase ['Nostoc azollae' 0708]
          Length = 613

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED+  N +L R  +   GY     +N  E   +  Q +P VI+MD+ L   +GL +
Sbjct: 498 ILLVEDDLANSELIRVYLGRLGYQVTCVKNAQEMWTMLPQIEPAVILMDVSLPNANGLNL 557

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            KQ++++ E Q+IP+IA TA  MKGD E     G + YISKPI L +    + KY
Sbjct: 558 VKQLRDNIEYQQIPIIAQTAMTMKGDRETCLAAGVDDYISKPIDLQLLGSIVAKY 612


>gi|242280332|ref|YP_002992461.1| Hpt sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
           2638]
 gi|242123226|gb|ACS80922.1| Hpt sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
           2638]
          Length = 923

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 75/117 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN +N ++   ++E +G       NG EA+ + ++   D+++MDIQ+ E+ G E
Sbjct: 666 RLLLVEDNPINQQVAEQILEPTGIEISSAPNGAEAVRMVQEAGYDIVLMDIQMPEMDGYE 725

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T  I+ D +++E+P+IA+TA AM+GD+E+    G + YI KPI   + +  I+ ++
Sbjct: 726 ATTIIRNDLKMKELPIIAMTAHAMRGDKEKCIASGMDDYIPKPIDKELMISIIRNHL 782



 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD---VIIMDIQLQEI 59
           K V++V+DN     +    ++  G+      +  EA+++    K D   ++I+D++L  +
Sbjct: 522 KPVLVVDDNFAVRSVLVRYLKQFGFQPTSVASAEEAIKIIEDRKDDQFKLLIIDLKLPGM 581

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +G E + +I++    +E+P++ +TA  +     + +       ISKP+  +    +I + 
Sbjct: 582 NGDEASIEIRKTYSKEELPILMITATELNSALSKAQNAQINRMISKPLKQATLFNSIMET 641

Query: 120 IG 121
            G
Sbjct: 642 FG 643


>gi|251771347|gb|EES51928.1| response regulator receiver protein [Leptospirillum
           ferrodiazotrophum]
          Length = 126

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (63%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED+++  ++ +  +E  GY     + G E+LE  R   PD+++MD+ +  I G E 
Sbjct: 4   ILLVEDHDMAREIMQRRLEREGYRVETAQTGKESLEKIRNISPDLVLMDMSMPMIDGWEA 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           T++IK D EL+ IPV+A+TA A++GD ER    GC+ Y +KP+  
Sbjct: 64  TRRIKADPELKRIPVMALTANAIEGDRERCLAAGCDDYETKPVDF 108


>gi|171060137|ref|YP_001792486.1| multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
 gi|170777582|gb|ACB35721.1| multi-sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
          Length = 1333

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 73/118 (61%), Gaps = 2/118 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQEISGL 62
            V++VEDN +N+++ R ++E  G +     NG EAL+L  AR    D+++MD+Q+  + G 
Sbjct: 985  VLVVEDNSINLEMARLILEREGALVNAAGNGREALDLLQARPDAFDIVLMDLQMPVMDGF 1044

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E  + ++E ++LQ +PVIA+TA A+  D ER    G   +ISKP  +   + T++ ++
Sbjct: 1045 EAVRLMRERADLQAVPVIALTAGALPSDRERAHAVGMSDFISKPFEVEHLVRTVRAHV 1102


>gi|218515897|ref|ZP_03512737.1| response regulator receiver protein [Rhizobium etli 8C-3]
          Length = 49

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 45/49 (91%)

Query: 1  MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDV 49
          M K+VMIVEDNELNMKLFRDLIE SGY  +QTRNGMEAL+LAR+H+PD+
Sbjct: 1  MPKQVMIVEDNELNMKLFRDLIEASGYTTIQTRNGMEALDLARKHRPDL 49


>gi|117926684|ref|YP_867301.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117610440|gb|ABK45895.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 2654

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 76/117 (64%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            KV++VEDNE+N +L  +L+  +G +A    NG+EAL+  ++   D ++MD+Q+  + G  
Sbjct: 2237 KVLLVEDNEINQELALELLANAGILAKLAENGVEALQALQREPFDGVLMDVQMPIMDGYT 2296

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T++I++ +  +++PVIA+TA  M  D E+ +  G +A++SKPI +     T+ ++I
Sbjct: 2297 ATREIRKQAAFKDLPVIAMTANVMAADLEKAKAAGMQAHVSKPIDVREMFTTMAQWI 2353



 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 69/126 (54%), Gaps = 12/126 (9%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ----HKP-DVIIMDIQLQEI 59
            +++V+DN    ++  ++ ++ G+      +G  AL         + P  V++MD ++ ++
Sbjct: 2088 LLVVDDNSTAREILAEMAQSFGFRVDTAESGAAALAKVEAAAALNDPVQVVLMDWKMPDM 2147

Query: 60   SGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKG-GCE--AYISKPISLSIFMET 115
             GL+  + ++ + +LQE+P VI VTA+   G EE ++   G E   +++KP+S S  ++ 
Sbjct: 2148 DGLQTARAMQHNDDLQELPMVIMVTAY---GREEAVQAATGVELKGFLTKPVSPSTLLDA 2204

Query: 116  IKKYIG 121
            +   +G
Sbjct: 2205 VMGALG 2210


>gi|150017917|ref|YP_001310171.1| PAS/PAC sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149904382|gb|ABR35215.1| PAS/PAC sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 754

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 76/115 (66%), Gaps = 1/115 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++ VEDN ++ ++  ++I ++GY  +   NG EA+ + + +K D+I+MDIQ+ E++G 
Sbjct: 634 KVILYVEDNLISQEVMENIIRSNGYKYISAYNGNEAINILKNNKVDLILMDIQMPELNGF 693

Query: 63  EITKQIK-EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E T+ I+ E+ E + IP+IA+TA+AM+ D+E+  K   + YISKP  +   +  I
Sbjct: 694 ETTQAIRVEELEGKHIPIIAITAYAMREDKEKCIKAKMDDYISKPFEIENLLNII 748


>gi|303247947|ref|ZP_07334214.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
 gi|302490671|gb|EFL50574.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
          Length = 838

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED  +N    + ++E +GY      +G E L L  +   D I+MDI++   +GLE
Sbjct: 710 RILLAEDEAINRLAAQKMLEKAGYAVTPAGSGEEILRLLAERPFDCILMDIRMPGKNGLE 769

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +T++I+    L     IP+IAVTA+AM GD E+    G + Y+SKPI ++  ME +K+ +
Sbjct: 770 VTREIRHSPRLGPMAAIPIIAVTAYAMSGDREKFLAAGMDGYVSKPIDIAHLMEELKRIM 829

Query: 121 GE 122
            +
Sbjct: 830 SD 831


>gi|120597472|ref|YP_962046.1| multi-sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
 gi|146294387|ref|YP_001184811.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens CN-32]
 gi|120557565|gb|ABM23492.1| multi-sensor hybrid histidine kinase [Shewanella sp. W3-18-1]
 gi|145566077|gb|ABP77012.1| multi-sensor hybrid histidine kinase [Shewanella putrefaciens CN-32]
 gi|319427741|gb|ADV55815.1| sensor histidine kinase for anaerobic respiratory control, ArcS
            [Shewanella putrefaciens 200]
          Length = 1234

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 72/116 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1112 VLLVEDNFINQQVATELLKSAGYEVVLADNGQVALDIIDSRPFDAVLMDIQMPVMDGLTA 1171

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E    +E+P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1172 ARALRERYSPEELPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1227


>gi|307299069|ref|ZP_07578871.1| multi-sensor hybrid histidine kinase [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306915494|gb|EFN45879.1| multi-sensor hybrid histidine kinase [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 935

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 79/119 (66%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEISGL 62
           ++++ EDNE N  L ++++E +GY      NG +A+E+ R  ++ ++I+MD+Q+  + G 
Sbjct: 695 RILLTEDNEANQLLIKEVLEKAGYSVDVAGNGKQAIEMVRNFNQYNLILMDMQMPIMDGY 754

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E TK +++  E  +IP++A+TA  M+GDEE+  + GC+ ++ KP+  S  +E ++ ++G
Sbjct: 755 EATKALRQ--EGYKIPIVALTAHTMQGDEEKTIEAGCDGFLGKPVRQSDLLEIVRYHLG 811


>gi|256829549|ref|YP_003158277.1| histidine kinase [Desulfomicrobium baculatum DSM 4028]
 gi|256578725|gb|ACU89861.1| histidine kinase [Desulfomicrobium baculatum DSM 4028]
          Length = 742

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++ ++VED+ +N      ++   G   +   NG+EA+E+ ++   D++ MD+Q+  + G+
Sbjct: 625 RRFLLVEDDSVNRMAMERILGKFGCEVISAGNGLEAVEILKRENVDLVFMDVQMPVMDGM 684

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E T+ I+E+  L ++P++A+TA+AM GD ER  +GG ++Y+SKP+ ++   ET+
Sbjct: 685 EATRIIREELGL-DVPIVAMTAYAMAGDRERFLQGGMDSYVSKPVDMARLKETV 737


>gi|293368956|ref|ZP_06615557.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
           [Bacteroides ovatus SD CMC 3f]
 gi|292635976|gb|EFF54467.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
           [Bacteroides ovatus SD CMC 3f]
          Length = 1014

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N KLF  +++   Y  +   +G EA+E+ +Q+ P +I+MDI +  + G E 
Sbjct: 895 ILIAEDNESNYKLFASILK-GEYQLIHAWDGQEAVEMFKQYNPQIILMDINMPVMDGYEA 953

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           TK+I++ S   ++P+IA+TAFA   DE+R+ + G + Y+ KPI+
Sbjct: 954 TKEIRKYS--AKVPIIAITAFAYASDEQRVMESGFDGYMPKPIN 995


>gi|315179123|gb|ADT86037.1| sensor histidine kinase/response regulator [Vibrio furnissii NCTC
           11218]
          Length = 915

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   NG +A+E ARQ   D+I+MDIQ+  + G+  
Sbjct: 650 VMAVDDNPANLKLITALLQERVEAVVSCTNGQDAIEQARQRHFDIILMDIQMPHMDGVTA 709

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    Q  PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 710 CKAIKQLELNQNTPVIAVTAHAMSGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 764


>gi|325278928|ref|YP_004251470.1| response regulator receiver protein [Odoribacter splanchnicus DSM
           20712]
 gi|324310737|gb|ADY31290.1| response regulator receiver protein [Odoribacter splanchnicus DSM
           20712]
          Length = 124

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDN  N  L   L++ + Y  +  +NG EA+   + H P +I+MDI++ E++G E 
Sbjct: 11  ILVAEDNASNYLLIEILLKHT-YRLIHAQNGREAVAFFQSHHPQLILMDIKMPEMNGYEA 69

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T +I++ S   +IP+IAVTA+A   DE+RI + G   Y+SKPI     ++ IK+++ 
Sbjct: 70  TSEIRKSS--ADIPIIAVTAYAFTEDEKRILENGFNGYLSKPIKAQTLLQKIKEFLN 124


>gi|23016075|ref|ZP_00055835.1| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 123

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 71/121 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VEDN +NMKL    +  +GY  +++ +G   ++L       VI+MDIQL + S
Sbjct: 1   MTGTVVVVEDNAMNMKLLEQALTIAGYTTVKSSDGDGLVDLTAGSGAGVILMDIQLPKYS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ++ D   +++PV+AVTAFA         + G    I+KPIS+   ++ + +Y 
Sbjct: 61  GIDLLKQLRADDRTKDVPVVAVTAFADPDSVAGFLEEGFNQVITKPISIRKLLDEVARYC 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|260771270|ref|ZP_05880197.1| BarA sensory histidine kinase [Vibrio furnissii CIP 102972]
 gi|260613867|gb|EEX39059.1| BarA sensory histidine kinase [Vibrio furnissii CIP 102972]
          Length = 933

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   NG +A+E ARQ   D+I+MDIQ+  + G+  
Sbjct: 668 VMAVDDNPANLKLITALLQERVEAVVSCTNGQDAIEQARQRHFDIILMDIQMPHMDGVTA 727

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    Q  PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 728 CKAIKQLELNQNTPVIAVTAHAMSGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 782


>gi|256829207|ref|YP_003157935.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
 gi|256578383|gb|ACU89519.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
          Length = 1096

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 73/118 (61%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VED+ ++M   R ++E +G+      +G E L L R H  DVI+MD+QL  + GL+
Sbjct: 970  RILLVEDDSVSMFAARRVLEKAGHTVSMATDGSEVLPLLRAHDFDVILMDVQLPVMDGLQ 1029

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T  I+ ++ L     IP++A+TA+AM GD E+    G + YI+KP+S    ++ +++
Sbjct: 1030 ATAGIRSETSLGDKSRIPIVAMTAYAMSGDREKFLAAGMDDYIAKPVSAPELLDVLRR 1087


>gi|38505595|ref|NP_942216.1| two-component hybrid sensor and regulator [Synechocystis sp. PCC
            6803]
 gi|38423619|dbj|BAD01830.1| two-component hybrid sensor and regulator [Synechocystis sp. PCC
            6803]
          Length = 1209

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 73/116 (62%), Gaps = 1/116 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N ++   ++E  GY      NG+EAL++  Q   DVI+MD+++ E+ GL 
Sbjct: 937  RILLVEDNNINQRVALLMLEKLGYRPDIAGNGLEALQVLHQASYDVILMDVEMPEMDGLS 996

Query: 64   ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             TK I++D    E P +IAVTA+AM+GD E     G   YI+KPI  +  ++ +++
Sbjct: 997  ATKAIRQDFPADEQPWIIAVTAYAMQGDRETCLAAGMNDYITKPIRENDLLDALQR 1052



 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 62/116 (53%), Gaps = 2/116 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K+++IV+DN+L+ +  + L+   G  A  T +G EA    RQ +  D+ I+D+Q++E+ G
Sbjct: 776 KRLLIVDDNQLSCEGLKQLVTAWGLQAQATTSGWEAFSWLRQGECFDLAIIDLQMEEVDG 835

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG-GCEAYISKPISLSIFMETI 116
           L++ + ++     + +P++ +T       E   R      A +S PI  S+  E +
Sbjct: 836 LQLAEALRTLPTGESLPLVILTPSPTSLAELSARTDISIAACLSSPIKKSLVYEVL 891


>gi|302795646|ref|XP_002979586.1| hypothetical protein SELMODRAFT_419211 [Selaginella moellendorffii]
 gi|300152834|gb|EFJ19475.1| hypothetical protein SELMODRAFT_419211 [Selaginella moellendorffii]
          Length = 862

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 78/120 (65%), Gaps = 5/120 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKP-DVIIMDIQLQEIS 60
           K+V++VEDN +N K+   L++  G++ +   +G+EA+E L   HK  D+++MDIQ+  + 
Sbjct: 728 KRVLLVEDNLVNQKVASRLLQKYGHVVITVSDGLEAVEALKSDHKAYDLVLMDIQMPGMD 787

Query: 61  GLEITKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           GLE T++I++D   S  Q+IP+I +TA AMKG ++   + G + Y+ KP  +   + TI+
Sbjct: 788 GLEATRRIRKDELGSGWQKIPIIGLTANAMKGYQDICYEAGMDGYLPKPFDIKQVLSTIR 847


>gi|319956174|ref|YP_004167437.1| integral membrane sensor hybrid histidine kinase [Nitratifractor
           salsuginis DSM 16511]
 gi|319418578|gb|ADV45688.1| integral membrane sensor hybrid histidine kinase [Nitratifractor
           salsuginis DSM 16511]
          Length = 800

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 77/120 (64%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDN +N KL ++++E  G       NG+EA EL R +  D+I MDIQ+  ++G+E
Sbjct: 521 KVLVVEDNIINQKLVKNILEGLGLDVDIANNGLEAFELRRGNDYDLIFMDIQMPVMNGIE 580

Query: 64  ITK---QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T    + +ED EL  +P++A+TA A+KGD ER    G + YISKPI +S  +  + K++
Sbjct: 581 ATHEILEYEEDEELPHVPIVALTANALKGDRERFLAEGMDEYISKPIEMSELIYILNKFL 640


>gi|319956676|ref|YP_004167939.1| response regulator receiver and hpt phospho transfer protein
           [Nitratifractor salsuginis DSM 16511]
 gi|319419080|gb|ADV46190.1| response regulator receiver and Hpt phospho transfer protein
           [Nitratifractor salsuginis DSM 16511]
          Length = 370

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 74/122 (60%), Gaps = 6/122 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD----VIIMDIQLQE 58
           ++++IVEDN +NMKL   L+E SG       NG +ALE  R   PD    +++MD+ +  
Sbjct: 114 RRLLIVEDNPVNMKLILKLLEGSGLEIETAENGQKALEKLR--APDARYEMVLMDVHMPV 171

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + GLE T+QI++D +L++IPVIA+TA   K + ERI + G   Y+ KP+ L       K 
Sbjct: 172 MDGLECTRQIRQDPQLKDIPVIALTASTQKDEVERILESGMNGYLDKPLVLGKLYSAFKI 231

Query: 119 YI 120
           ++
Sbjct: 232 FL 233


>gi|299149292|ref|ZP_07042352.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
 gi|298512726|gb|EFI36615.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
          Length = 992

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N KLF  +++   Y  +   +G EA+E+ +Q+ P +I+MDI +  + G E 
Sbjct: 873 ILIAEDNESNYKLFASILK-GEYQLIHAWDGQEAVEMFKQYNPQIILMDINMPVMDGYEA 931

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           TK+I++ S   ++P+IA+TAFA   DE+R+ + G + Y+ KPI+
Sbjct: 932 TKEIRKYS--AKVPIIAITAFAYASDEQRVMESGFDGYMPKPIN 973


>gi|160885842|ref|ZP_02066845.1| hypothetical protein BACOVA_03846 [Bacteroides ovatus ATCC 8483]
 gi|156108655|gb|EDO10400.1| hypothetical protein BACOVA_03846 [Bacteroides ovatus ATCC 8483]
          Length = 992

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N KLF  +++   Y  +   +G EA+E+ +Q+ P +I+MDI +  + G E 
Sbjct: 873 ILIAEDNESNYKLFASILK-GEYQLIHAWDGQEAVEMFKQYNPQIILMDINMPVMDGYEA 931

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           TK+I++ S   ++P+IA+TAFA   DE+R+ + G + Y+ KPI+
Sbjct: 932 TKEIRKYS--AKVPIIAITAFAYASDEQRVMESGFDGYMPKPIN 973


>gi|239905687|ref|YP_002952426.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795551|dbj|BAH74540.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 705

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I ED+++N  +    ++  G+I L   +G+EAL+L R  + D+I+MDIQ+  + GLE
Sbjct: 575 KILIAEDDKVNQLVISRFVKKIGHIPLCANDGLEALKLLRSEQFDLILMDIQMPNLDGLE 634

Query: 64  ITKQIKEDSE-LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            T +I+   E   +IP+IA+T+ AM+GD E+    G + Y+SKP+
Sbjct: 635 TTLEIRNSHETFSKIPIIALTSHAMRGDREKFISFGMDGYLSKPV 679


>gi|298528571|ref|ZP_07015975.1| histidine kinase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512223|gb|EFI36125.1| histidine kinase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 533

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 73/123 (59%), Gaps = 5/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ ED+ +N    ++L+   G+     +NG EA+EL ++H  D ++MDIQ+  ++G+E
Sbjct: 400 NILVAEDDPMNQIFIKNLLTKEGHNVSMAKNGREAVELVQEHSFDCVLMDIQMPVMTGVE 459

Query: 64  ITKQIKE---DSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T++I+    +  ++  +IP+IAVTA    GD E+    G + Y+ KP+SL  F    +K
Sbjct: 460 ATREIRNLGGNGSIRNVQIPIIAVTAHTQPGDREKFLDAGMDDYLGKPVSLEDFRNVFRK 519

Query: 119 YIG 121
           + G
Sbjct: 520 FFG 522


>gi|261854762|ref|YP_003262045.1| response regulator receiver protein [Halothiobacillus neapolitanus
           c2]
 gi|261835231|gb|ACX94998.1| response regulator receiver protein [Halothiobacillus neapolitanus
           c2]
          Length = 123

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 72/121 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VEDNE+N  +    +   GY  L   +G E + +A+  +PD+I+MD+ L  + G
Sbjct: 1   MARILLVEDNEMNRDMLSRRLARKGYEVLLAVDGGEGVAMAKSQQPDLILMDMSLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+ I+ +   + IP+IA+TA AM G+  +  + GC  + +KP+ L   +E I++ + 
Sbjct: 61  WEATRAIRAEPATEAIPIIALTAHAMDGERAKALEAGCNDFDTKPVDLPRLLEKIEQQMA 120

Query: 122 E 122
           +
Sbjct: 121 K 121


>gi|311747663|ref|ZP_07721448.1| sensor histidine kinase/response regulator fusion protein
           [Algoriphagus sp. PR1]
 gi|126575650|gb|EAZ79960.1| sensor histidine kinase/response regulator fusion protein
           [Algoriphagus sp. PR1]
          Length = 252

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 77/120 (64%), Gaps = 6/120 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIAL--QTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           K+V+IV+DN+LN KLF +LI   G +      +NG+EAL+L ++   D+IIMDIQ+  + 
Sbjct: 4   KRVLIVDDNDLNRKLFENLI---GQVCQFDSAKNGLEALDLLKKAAYDLIIMDIQMPLMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL   KQIK  S++ + P+IAVTAFA   D+      G + +++KPI    F+E +KK +
Sbjct: 61  GLTAMKQIKL-SKISDSPIIAVTAFAELEDKNTYLDQGFDDFVTKPIRPRDFLENVKKTL 119


>gi|114564655|ref|YP_752169.1| multi-sensor hybrid histidine kinase [Shewanella frigidimarina NCIMB
            400]
 gi|114335948|gb|ABI73330.1| multi-sensor hybrid histidine kinase [Shewanella frigidimarina NCIMB
            400]
          Length = 1236

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 74/117 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1112 VLLVEDNFINQQVASELLKSAGYEVVIADNGQVALDVIDSKPFDAVLMDIQMPVMDGLTA 1171

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T ++++    Q++P+IA+TA AM GD+E+    G  A+I+KPI L+   ET+  +I 
Sbjct: 1172 TAELRKRYSKQQMPIIAMTAHAMSGDKEKSLAAGMNAHITKPIVLTELFETLSHWIA 1228



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 65/123 (52%), Gaps = 5/123 (4%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
             ++V+DN   ++++  L+    +      +G +AL++ R+   D++++D  + E++G ++
Sbjct: 969  TLVVDDNPSALQIYSTLMTDFSFGVNTADSGQKALDILRKKPVDLLLLDWMMPEMNGCDV 1028

Query: 65   TKQIKE---DSELQEIPVIAV-TAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKKY 119
             K I E   D  + + P+I + TA+A +  +  ++K    A + KP   S +F E I  +
Sbjct: 1029 IKAIDEMVADGSIAKRPIIILMTAYAAEPLDHELQKNSVYAVLQKPFKASALFDEIINAF 1088

Query: 120  IGE 122
              E
Sbjct: 1089 AKE 1091


>gi|258406487|ref|YP_003199229.1| multi-sensor hybrid histidine kinase [Desulfohalobium retbaense DSM
            5692]
 gi|257798714|gb|ACV69651.1| multi-sensor hybrid histidine kinase [Desulfohalobium retbaense DSM
            5692]
          Length = 1316

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 75/122 (61%), Gaps = 6/122 (4%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN LN ++ ++++E +G        G  ALELA +H  DV++MDIQ+  + GL+ 
Sbjct: 1088 VLVVEDNLLNQEVAQEILEQAGMAVTLADTGERALELAAEHAFDVVLMDIQMPGMDGLQT 1147

Query: 65   TKQIKEDSE------LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T++++  ++      LQ +PVIA+T  AMK D+ R    G + +I+KP  +     T+++
Sbjct: 1148 TQELRRMADKTGKHFLQNLPVIAMTGHAMKSDQNRCLAAGMDDFIAKPFRIDQLFATLQR 1207

Query: 119  YI 120
            ++
Sbjct: 1208 WL 1209


>gi|219848610|ref|YP_002463043.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
 gi|219542869|gb|ACL24607.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
          Length = 131

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 71/122 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IVED++ N  L   LI+  G+  +   +G + + LAR  +PD+IIMD+ L  ++G
Sbjct: 1   MAKILIVEDDQNNRDLIARLIQLMGHEPILANDGAQGVALARSMQPDLIIMDMGLPVLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T +IK       IPV+A+TA+A+  D  R    GC+ + +KPI ++ F E +   + 
Sbjct: 61  WQATHRIKSQPATSHIPVLALTAYALNEDRLRALSSGCDDFETKPIDITRFREKVSAMLA 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|86358747|ref|YP_470639.1| two-component sensor histidine kinase/response regulator hybrid
            protein [Rhizobium etli CFN 42]
 gi|86282849|gb|ABC91912.1| probable two-component sensor histidine kinase/response regulator
            hybrid protein [Rhizobium etli CFN 42]
          Length = 1133

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ EDNE+N  +F  ++++SG   L  +NG EA+     H P +I+MD+ +  ++G E 
Sbjct: 1004 VLVAEDNEVNQIVFTQILQSSGLSFLVVKNGEEAVAAWESHTPRIIMMDVSMPVMNGHEA 1063

Query: 65   TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+ I+E  + Q   +P+I VTA A++ D E     G + Y+SKPIS  +  E I++++G+
Sbjct: 1064 TRTIREREKGQGHRVPIIGVTAHALESDRELCLDAGMDDYMSKPISPELLEEKIRQWLGK 1123



 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           ++++V+DNE+N ++  + +   G+  +    G   L +           D +++D  + +
Sbjct: 840 RILVVDDNEVNRRILTEQLSLWGFDGVAAEGGGTGLAILEAAADLGVTVDAVVLDYHMPD 899

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
           ++G  + ++++ D    ++P+I +T+  + G E+       +A++ KP   ++   T
Sbjct: 900 MNGANVARRLRADPRFVDLPIIFLTSMDISGTEKEFAALNGQAHLMKPARANVLRNT 956


>gi|304407980|ref|ZP_07389630.1| multi-sensor hybrid histidine kinase [Paenibacillus curdlanolyticus
           YK9]
 gi|304342999|gb|EFM08843.1| multi-sensor hybrid histidine kinase [Paenibacillus curdlanolyticus
           YK9]
          Length = 880

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 78/120 (65%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++VEDNE+N ++  +++   G       NG+EAL L    + DV++MD+Q+  + G+
Sbjct: 624 ERILLVEDNEINRQVAFEMLSGMGAAVDLASNGVEALRLLEHKRYDVVLMDLQMPVMDGM 683

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E +++I+E  +L  +P+IA+TA AMKG +E++ + G  AY++KP   +   E +++ + E
Sbjct: 684 EASRRIREREDLNNMPIIAMTADAMKGVKEKVLENGMNAYLTKPFDPASLYELLQRLMPE 743


>gi|284051659|ref|ZP_06381869.1| multi-sensor hybrid histidine kinase [Arthrospira platensis str.
            Paraca]
          Length = 1081

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 66/105 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N+      +   GY  +  ++G +A++LA+   P++I+MDIQ+  I GLE 
Sbjct: 964  ILIAEDNEANIMSLSSYLGAKGYRLIIAKDGQQAIDLAQSESPNLILMDIQMPGIDGLEA 1023

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              +I++   + ++P+IA+TA AM GD E+  + G   Y++KP+ L
Sbjct: 1024 INRIRQIPTMTQVPIIALTALAMTGDREKCLEAGANDYVAKPVKL 1068


>gi|332703722|ref|ZP_08423810.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553871|gb|EGJ50915.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 880

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 74/110 (67%), Gaps = 5/110 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDNE+N  L  +L++  G++     NG +AL +  + + D+++MD+Q+ EI+G+E
Sbjct: 754 RILLAEDNEINRFLALELLKERGHVVTAVENGRDALNMLAKERFDLVLMDVQMPEINGVE 813

Query: 64  ITKQIK----EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T++I+     D++   IP++A+TA+A+KGD E+    G + Y+SKP+ L
Sbjct: 814 ATRRIRAGKVPDTD-PRIPIVALTAYALKGDREKFMSAGMDDYLSKPLDL 862


>gi|78486407|ref|YP_392332.1| multi-sensor hybrid histidine kinase [Thiomicrospira crunogena
           XCL-2]
 gi|78364693|gb|ABB42658.1| PAS/PAC sensor hybrid histidine kinase [Thiomicrospira crunogena
           XCL-2]
          Length = 948

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGME-ALELARQHKPDVIIMDIQLQEISG 61
           K ++ +EDN  N+KL   ++    +  L T +  +  +ELA+ +KPD+I++DI +  +SG
Sbjct: 824 KTILYIEDNPANLKLVSHVLAKRDHTNLITAHEPQLGIELAKANKPDLILLDINMPGMSG 883

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E+ +  K+DS++ ++PV+A+TA AM  D  R ++ G + Y++KP+ +  F++ +++Y+
Sbjct: 884 YEVLEVFKKDSDVSKVPVVAITANAMSHDIRRGKRAGFDDYLTKPLDVENFLKVVERYL 942


>gi|317051354|ref|YP_004112470.1| response regulator receiver [Desulfurispirillum indicum S5]
 gi|316946438|gb|ADU65914.1| response regulator receiver [Desulfurispirillum indicum S5]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 67/115 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++++EDNELN  +    +   GY  +   +G E L  A +H+PD+I+MD+ L  + G
Sbjct: 1   MATILLIEDNELNCDMLTRRLTRKGYEVITAGDGAEGLRKATEHQPDLILMDMSLPVMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            E T++I+++     IPV+A+TA A+  D  R  + GC  + +KP+ L   +E I
Sbjct: 61  WEATRRIRDNQRTTHIPVLALTAHALPEDRRRAFEVGCSDFETKPVHLPQLLEKI 115


>gi|196232627|ref|ZP_03131479.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
 gi|196223389|gb|EDY17907.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
          Length = 129

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 74/118 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++++ED+  ++KL  +++   G++ +   +  +A+   +  KPDVI++D++L  I G  
Sbjct: 2   KILVIEDDPTSLKLASEVLHAGGHVVMLATSADQAILSIKAVKPDVILLDLRLPGIQGAG 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + +Q +E +E  +IP+IAVTAF+    +E+  K GC+AYI KPI+    +  I++ + 
Sbjct: 62  VARQCREGTETHDIPIIAVTAFSDDYGKEQAMKAGCDAYIVKPINTRTLLRQIEEVVA 119


>gi|209528198|ref|ZP_03276667.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209491364|gb|EDZ91750.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 1778

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 66/105 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N+      +   GY  +  ++G +A++LA+   P++I+MDIQ+  I GLE 
Sbjct: 1661 ILIAEDNEANIMSLSSYLGAKGYRLIIAKDGQQAIDLAQSESPNLILMDIQMPGIDGLEA 1720

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              +I++   + ++P+IA+TA AM GD E+  + G   Y++KP+ L
Sbjct: 1721 INRIRQIPTMTQVPIIALTALAMTGDREKCLEAGANDYVAKPVKL 1765


>gi|197336844|ref|YP_002158691.1| transcriptional regulator [Vibrio fischeri MJ11]
 gi|197314096|gb|ACH63545.1| transcriptional regulator [Vibrio fischeri MJ11]
          Length = 766

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VEDN  N  + ++ +  +GY     +NG EA+  A   + D+I MDI + E+ G+ 
Sbjct: 500 NILVVEDNHANQIVIKNTLNYAGYSIDIAQNGKEAITKAINTQYDLIFMDISMPEMDGMT 559

Query: 64  ITKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK+I+  S+  Q +P+IA+TA A+ GD+ER  + G   Y+SKP S S  +E + KY+
Sbjct: 560 ATKKIRSLSDTHQNMPIIALTAHALSGDKERFIEAGMTDYLSKPFSRSNLLECLAKYL 617


>gi|144900563|emb|CAM77427.1| PAS [Magnetospirillum gryphiswaldense MSR-1]
          Length = 1382

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 71/118 (60%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +KV++VEDNE+N  L  +L+   G +     NG + +   R    D+++MDIQ+  + GL
Sbjct: 946  RKVLLVEDNEINRDLAIELLSDLGLLVSIAENGQDGVARVRADPFDLVLMDIQMPVMDGL 1005

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK I+ D   +++P+IA+TA AM GD ER  + G   +I+KPI+     +T+ +++
Sbjct: 1006 TATKLIRADERFRDLPIIAMTAHAMSGDRERSLEAGMNDHITKPINPGHLTDTLIRWM 1063



 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 1/117 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++++D   N+ L  D+  +S Y  L    GM  LE+A    PD+I++D+ +  I G E
Sbjct: 1225 RILVIDDEPSNIDLLADIF-SSTYEVLAAEEGMGGLEIAATSMPDLILLDVMMPGIDGYE 1283

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + +++K +     IPVI +T       E    + G   +++KPI  +     +  +I
Sbjct: 1284 VCRRLKAEPLTSAIPVIFITGLGDDASETHGLELGAVDFVTKPICPATVRARVSNHI 1340



 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 75/127 (59%), Gaps = 6/127 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL----ELARQHKP-DVIIMDIQLQ 57
           K+V+IV+D++    +   ++  +G  A+ T++G EA+    E ++   P D+++MD ++ 
Sbjct: 798 KRVLIVDDSDSARDVLLAMLCANGINAIATKSGEEAMAVLAEASQAGTPFDLVLMDWRMP 857

Query: 58  EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + G+E + +IK D+ L +IP ++ V+AF  +   E    G  + ++ KP++ S+ ++TI
Sbjct: 858 GMDGIEASHRIKADATLSQIPSILMVSAFGREEMAEGSLGGDLDGFLIKPVNESVLIDTI 917

Query: 117 KKYIGEA 123
            +  G A
Sbjct: 918 SEMFGGA 924


>gi|77359688|ref|YP_339263.1| hybrid sensory histidine kinase BarA [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874599|emb|CAI85820.1| sensor protein barA [Pseudoalteromonas haloplanktis TAC125]
          Length = 918

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+DN+ N+KL   L+     +     NG +A  L++ HK DVI MDIQ+  + G+ 
Sbjct: 672 KVLVVDDNDANLKLIYTLLNEQVELIDTAHNGSQAYSLSKSHKYDVIFMDIQMPIMDGIT 731

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             K IKE S  ++ P+IAVTA A+  ++E++ K G E Y++KPI
Sbjct: 732 ACKLIKESSLNEDTPIIAVTAHALHSEKEQLLKDGFEGYLTKPI 775


>gi|148265997|ref|YP_001232703.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter uraniireducens Rf4]
 gi|146399497|gb|ABQ28130.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter uraniireducens Rf4]
          Length = 236

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 68/120 (56%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K+++V+D  L +++ +  +  S        NG EALE+ +  +PD+I MD+ + E+ G 
Sbjct: 4   RKILLVDDVALILEIEKSFLRNSPVRIFTAHNGKEALEIVKNDRPDLIFMDLNMPEMDGA 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
                IK D +L  IPV+ VT      D E  R+ GC+ +I+KPI   IF+E  +K++ +
Sbjct: 64  ACCATIKTDDQLCSIPVVMVTTAGKNEDRELCRQAGCDDFITKPIDRRIFLEKGRKFLPD 123


>gi|219847439|ref|YP_002461872.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
 gi|219541698|gb|ACL23436.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 68/116 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IV+DN  N  +   ++  SG+      N + A+ +ARQ +P +I+MD+ +  + G   
Sbjct: 4   ILIVDDNFDNRHILGQMLSFSGFPVEMAANALTAINIARQRRPSLILMDLSMPGLDGWTA 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ +K D +L++IPV+AV+    + D ER ++ GC  +++KPI     +   ++Y+
Sbjct: 64  TEYVKNDPDLRDIPVVAVSGHVTRNDIERAKRAGCVEFLAKPIDYDQLVTIARRYV 119


>gi|108758646|ref|YP_629804.1| response regulator [Myxococcus xanthus DK 1622]
 gi|108462526|gb|ABF87711.1| response regulator [Myxococcus xanthus DK 1622]
          Length = 136

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 73/116 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D +   +++ + +E SG+   + +NG EAL+ A + +PD+I+MD+ L  + G E 
Sbjct: 12  VLVVDDYQDAREMYAEYLEFSGFRVAEAKNGQEALDKAFELRPDIILMDLSLPIMDGWEA 71

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+++K D   + IPV+A+T  AM G  +  +  GC+++++KP      ++ +++ +
Sbjct: 72  TRRLKGDDRTRAIPVVALTGHAMTGQSDEAKGAGCDSFVTKPCLPDALVDEVRRVL 127


>gi|315127393|ref|YP_004069396.1| hybrid sensory histidine kinase BarA [Pseudoalteromonas sp. SM9913]
 gi|315015907|gb|ADT69245.1| hybrid sensory histidine kinase BarA [Pseudoalteromonas sp. SM9913]
          Length = 924

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+DN+ N+KL   L+     +     NG +A  L++ HK DVI MDIQ+  + G+ 
Sbjct: 672 KVLVVDDNDANLKLIYTLLNEQVELIDTAHNGSQAYSLSKSHKYDVIFMDIQMPIMDGIT 731

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             K IKE S  ++ P+IAVTA A+  ++E++ K G E Y++KPI
Sbjct: 732 ACKLIKESSLNEDTPIIAVTAHALNSEKEQLLKDGFEGYLTKPI 775


>gi|260461547|ref|ZP_05809794.1| PAS/PAC sensor hybrid histidine kinase [Mesorhizobium opportunistum
            WSM2075]
 gi|259032617|gb|EEW33881.1| PAS/PAC sensor hybrid histidine kinase [Mesorhizobium opportunistum
            WSM2075]
          Length = 1255

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 74/121 (61%), Gaps = 2/121 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N  +F  ++  +GY      NG +AL+   +  P +I+MD+ + E+SGLE 
Sbjct: 1127 ILVAEDNEVNQMVFTQILGETGYGFEIVSNGRKALDAFGKLNPCMILMDVSMPEMSGLEA 1186

Query: 65   TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T  I+  E+     +P++ VTA A+KGD ER  + G + Y+ KPIS    +E +++++G 
Sbjct: 1187 TAAIRRLEEDTGTHVPIVGVTAHALKGDRERCLEAGMDDYLPKPISPRALLEKVERWVGA 1246

Query: 123  A 123
            +
Sbjct: 1247 S 1247



 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-----ARQHKPDVIIMDIQLQE 58
            +V+IV+DN +N  +  + + +  + +    +G E L++     A     D +++D Q+  
Sbjct: 948  RVLIVDDNAVNRAILTEQMTSWTFDSCAAESGAEGLKVLIAAAAYGVPVDCVVLDYQMPG 1007

Query: 59   ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            +SG E+ + ++  + L   P+I +T+          R  G +A + KP   S+ +ET+
Sbjct: 1008 MSGAEMARIVRNTAGLANTPIIMLTSVDQSLANTSYRDLGIDAQLIKPARSSVLLETL 1065


>gi|256831239|ref|YP_003159967.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
 gi|256580415|gb|ACU91551.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum DSM
            4028]
          Length = 1078

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 73/118 (61%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED  +N    R L+E +G+     +NG E L+L R+   D ++MD+Q+  +SG+E
Sbjct: 954  RLLLAEDEAINQLAMRTLLEKAGHRVSIAQNGQEVLDLLREEDFDCVLMDVQMPVMSGIE 1013

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T++I+   EL   +++P+IA+TA AM GD E   + G + Y+SKP+ L   ++ I K
Sbjct: 1014 ATRRIRTSPELAARKDVPIIALTAHAMSGDRESFLQAGMDDYLSKPVGLDDLVKAIAK 1071


>gi|255009663|ref|ZP_05281789.1| putative two-component system histidne kinase/reponse regulator
           fusion protein [Bacteroides fragilis 3_1_12]
 gi|313147448|ref|ZP_07809641.1| two-component system sensor histidine kinase [Bacteroides fragilis
           3_1_12]
 gi|313136215|gb|EFR53575.1| two-component system sensor histidine kinase [Bacteroides fragilis
           3_1_12]
          Length = 1014

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N +LF  ++    Y  L   +G EA+E+ R+  P +I+MDI +  + G E 
Sbjct: 895 ILIAEDNESNFRLFESILR-QDYRLLHAWDGREAVEIFRKEDPQIILMDINMPVMDGYEA 953

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           TK+I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 954 TKEIRKYS--AKVPIIAVTAFAYASDEQRVMESGFDGYMPKPIN 995


>gi|73668523|ref|YP_304538.1| response regulator receiver [Methanosarcina barkeri str. Fusaro]
 gi|72395685|gb|AAZ69958.1| response regulator receiver [Methanosarcina barkeri str. Fusaro]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 77/116 (66%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVEDN LN+ +  DL+++ G+   + +NG EALE+  + K D+I++D++L ++ GLE+
Sbjct: 4   ILIVEDNLLNLTVEADLLKSIGHEPKKAKNGFEALEILNEAKIDLILLDMELPKMHGLEL 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            ++IK + E + I V+AVT ++    +E+  K GC A ++KPI+   F   ++ ++
Sbjct: 64  LQKIKLNPETRSIKVVAVTGYSDPESKEKFLKAGCYAVLAKPINFGDFGSQVEYFL 119


>gi|170741015|ref|YP_001769670.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168195289|gb|ACA17236.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 128

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 70/122 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V++VEDNELN  +    ++ SG+  L   +G +A++ A    PD+I+MD+ L  + G
Sbjct: 1   MTRVLLVEDNELNRDMLSRRLKRSGFEVLFAEDGQQAVDTAAAEMPDLILMDLSLPTMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+ ++ + +   + VIA+T+ AM GD ER    GC+ Y +KP+ L   +  +   + 
Sbjct: 61  FEATRALRANEKTAGLRVIALTSHAMSGDRERALAAGCDDYDTKPVDLPRLLGKMHALLD 120

Query: 122 EA 123
            A
Sbjct: 121 PA 122


>gi|157373767|ref|YP_001472367.1| histidine kinase [Shewanella sediminis HAW-EB3]
 gi|157316141|gb|ABV35239.1| Histidine kinase [Shewanella sediminis HAW-EB3]
          Length = 1200

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 75/119 (63%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN +N ++  +L++++GY      NG  A+++  + + D ++MDIQ+  + GL 
Sbjct: 1080 RVLLVEDNFINQQVATELLKSAGYEVDVAENGQIAIDMIEEKEFDAVLMDIQMPVMDGLT 1139

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
             TK++++     E+P+IA+TA AM GD E+    G  A+I+KPI L+   +T+  +I  
Sbjct: 1140 ATKELRKRYSSTELPIIAMTAHAMSGDREKSLSAGMNAHITKPIVLNELFDTLSHWINH 1198



 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++V+DN   ++++  +++   +      +G EA+    +   D++++D  + E+ G+ 
Sbjct: 937  KTLVVDDNPTALQIYSSVMQDFHFEVDTAASGSEAIYKLGRSSVDLLLLDWMMPEMDGIA 996

Query: 64   ITKQIKE---DSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKK 118
            +  ++     D  L + P VI +TA+A +  ++ + K    A + KP   S +F E I  
Sbjct: 997  VIDELDRMVADGRLDKRPIVIMMTAYAAEPLQKDVEKSNIFAMLQKPFKASALFDEIISA 1056

Query: 119  YIGE 122
            +  E
Sbjct: 1057 FADE 1060


>gi|189501026|ref|YP_001960496.1| multi-sensor hybrid histidine kinase [Chlorobium phaeobacteroides
           BS1]
 gi|189496467|gb|ACE05015.1| multi-sensor hybrid histidine kinase [Chlorobium phaeobacteroides
           BS1]
          Length = 993

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 78/123 (63%), Gaps = 5/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISGL 62
           ++++VED+E+N  +   +++  GY A   +NG EAL  LA+ H  D+++MD Q+ E+ G 
Sbjct: 731 RILLVEDSEVNQLVLLSMLQKEGYEADVVQNGTEALVALAKVHY-DLVLMDCQMPEMDGY 789

Query: 63  EITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           E T+ I+    +    E+P++A+TA AM GD ER  + G + Y++KP+ +S F   ++KY
Sbjct: 790 EATRCIRRGQGNVMNPEVPIVAITANAMTGDRERCLQAGMDDYMAKPVRMSDFTAMLEKY 849

Query: 120 IGE 122
            GE
Sbjct: 850 SGE 852


>gi|220907616|ref|YP_002482927.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864227|gb|ACL44566.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 887

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 75/117 (64%), Gaps = 1/117 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L ++++ EDN +N K+   L++  GY A   +NG++ LE  RQ   DVI+MD+Q+ E+ G
Sbjct: 761 LLRILLAEDNAVNQKVALHLLKRLGYGADVAKNGIQVLEALRQQSYDVILMDVQMPEMDG 820

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           L  T+QI+  S L +  +IA+TA A++GD E   + G + Y+SKPI L   +E ++K
Sbjct: 821 LTATQQIRR-SGLPQPRIIAMTANAVQGDREACLEAGMDDYVSKPIRLPDLVEALQK 876



 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 58/116 (50%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D +    L R+ +E+ GY   +  NG + L+  +Q +PD++++D  +  + G   
Sbjct: 13  ILVVDDAKTVRALLREHLESVGYQLAEAVNGEDCLKSFQQLRPDIVLLDAVMPGMDGFNC 72

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             +++   +  + P++ +T        ER    G   YI+KPI  ++    + + I
Sbjct: 73  CARLRRLPQGMDTPILMITGLDDPSSVERAFAAGATDYITKPIHWAVLRMRVSRLI 128



 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
           K+++IV+DN    K+     +  G +      G EAL  L +Q   D+ I+D +L ++ G
Sbjct: 620 KRLLIVDDNPTYRKILSLYSQFWGTLPYTFAAGSEALRRLQQQPGFDLAIIDDRLADMDG 679

Query: 62  LEITKQIKEDSELQEIPVIAVT 83
           L + +QI++  +   +P+I +T
Sbjct: 680 LSLVEQIRQLPQTATLPLIFLT 701


>gi|152993440|ref|YP_001359161.1| hypothetical protein SUN_1857 [Sulfurovum sp. NBC37-1]
 gi|151425301|dbj|BAF72804.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 1156

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 77/119 (64%), Gaps = 3/119 (2%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            KKV++VED + N      ++E   +      NG+EA+E  +Q+  D+I+MD  + +++G+
Sbjct: 1034 KKVLLVEDVKTNQLFMSIILEGLHFEVATADNGIEAVEAFKQNSYDLILMDEHMPKMNGI 1093

Query: 63   EITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            E TKQI   + ++ L   P+IA+TA A+KGD ER  K G + Y++KPI+ +IF++ ++K
Sbjct: 1094 EATKQILAIEGENNLPHTPIIALTANAIKGDRERFLKAGMDEYVTKPINQNIFVKVLRK 1152


>gi|16330590|ref|NP_441318.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
 gi|1653081|dbj|BAA17998.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
          Length = 950

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 69/116 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNE+N +   DL+ + G       NG EAL L   +  D I+MDIQ+  ++G + 
Sbjct: 720 ILLVEDNEINREFAHDLLTSKGLRVQVANNGQEALTLLTSNTYDAILMDIQMPMLNGYDA 779

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I++    + +P+IA+TA AM GD+E+    G   +++KPI   +  +T+  +I
Sbjct: 780 TRAIRQQEYHRNLPIIAMTANAMAGDQEKALDAGMNDHLTKPIKPDLLFQTLAHWI 835


>gi|218128652|ref|ZP_03457456.1| hypothetical protein BACEGG_00223 [Bacteroides eggerthii DSM 20697]
 gi|217989107|gb|EEC55422.1| hypothetical protein BACEGG_00223 [Bacteroides eggerthii DSM 20697]
          Length = 983

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I ED+E N +LF  +++   +  +  R+G EA+EL   H P++I+MDI +  ++G E 
Sbjct: 864 ILIAEDDESNYRLFHSILQKD-FQLIHARDGKEAVELYSLHHPNLILMDINMPNMNGYEA 922

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           T QI+E S  + IP+IAVTA+A   D+++I + G   Y+SKP++
Sbjct: 923 THQIRELS--KSIPIIAVTAYAYASDKQKIMESGFTGYMSKPLN 964


>gi|309791782|ref|ZP_07686270.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides
           DG6]
 gi|308226188|gb|EFO79928.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides
           DG6]
          Length = 854

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 67/114 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++ +DN    +L    +   G+  +  R+G+EA+ +A    PD+I+MD+Q+ ++ GL
Sbjct: 735 KLLLLADDNTDTRELLSHYLTQKGFRVITARHGLEAVRMANTEHPDLILMDVQMPQLDGL 794

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             T+ I+E   L  +P+IA+TA  M GD ER    G   Y++KP+ LS  ++ I
Sbjct: 795 AATRLIREMPALHNVPIIALTALVMPGDRERCLAAGANDYLTKPVPLSQLLKLI 848


>gi|239905559|ref|YP_002952298.1| putative two-component hybrid sensor and regulator [Desulfovibrio
            magneticus RS-1]
 gi|239795423|dbj|BAH74412.1| putative two-component hybrid sensor and regulator [Desulfovibrio
            magneticus RS-1]
          Length = 2025

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 79/122 (64%), Gaps = 7/122 (5%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VED+ ++ +  + L+E +GY      +G +ALE+ R+ K D ++MD+Q+  + G+  
Sbjct: 1900 VLLVEDDSISQRSIQRLLEKAGYHVTVAGDGSQALEILRRAKFDCVLMDVQMPVLDGVTA 1959

Query: 65   TKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            TK+I+ D   +  + IP++A+TAFAM GD++   K G + Y+SKP+SL    E +K+ I 
Sbjct: 1960 TKRIRSDVSGAVDRTIPIVALTAFAMSGDQDIFLKAGMDGYLSKPVSL----EKMKQAID 2015

Query: 122  EA 123
            +A
Sbjct: 2016 QA 2017


>gi|317475553|ref|ZP_07934815.1| hsp90-like protein [Bacteroides eggerthii 1_2_48FAA]
 gi|316908257|gb|EFV29949.1| hsp90-like protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 912

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I ED+E N +LF  +++   +  +  R+G EA+EL   H P++I+MDI +  ++G E 
Sbjct: 793 ILIAEDDESNYRLFHSILQKD-FQLIHARDGKEAVELYSLHHPNLILMDINMPNMNGYEA 851

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           T QI+E S  + IP+IAVTA+A   D+++I + G   Y+SKP++
Sbjct: 852 THQIRELS--KSIPIIAVTAYAYASDKQKIMESGFTGYMSKPLN 893


>gi|77458871|ref|YP_348377.1| multi-sensor hybrid histidine kinase [Pseudomonas fluorescens Pf0-1]
 gi|77382874|gb|ABA74387.1| multi-sensor hybrid histidine kinase [Pseudomonas fluorescens Pf0-1]
          Length = 1163

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            +KV++V+D+  N+      +ET G + +  RNG EA+E L      D+++MD+ + E+ G
Sbjct: 1039 RKVLLVDDDVRNIFALTSALETKGAVVVIGRNGREAIEKLNEVEDIDLVLMDVMMPEMDG 1098

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1099 FEATMEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGANDYLAKPIDLDRLFSLIRVWL 1157



 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED      +  DL    GY  L      E  +LA++  PD I++D++L + SGL +
Sbjct: 773 ILVVEDEPNFAHILYDLAHELGYQCLVAHGADEGYDLAKEFVPDAILLDMRLPDHSGLTV 832

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP +
Sbjct: 833 LQRLKEHAGTRHIPVHVISV------EDRVEAAMHMGAIGYAVKPTT 873



 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED++L  +    LI              +ALEL R    D +++D++L ++ G
Sbjct: 892 VKRVLLVEDDDLQRESIARLIGDDDIEITAVGLAQDALELLRTTIFDCMVIDLKLPDMLG 951

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            ++ K++  +      PVI  T   +  DEE
Sbjct: 952 NDLLKRMSTEDICSFPPVIVYTGRNLTRDEE 982


>gi|78355304|ref|YP_386753.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78217709|gb|ABB37058.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 847

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED E+N      L+   G+      +G+  +EL + H+PD I+MDIQ+ ++ G+E
Sbjct: 711 RILLAEDEEVNRMAATYLLRKMGHTVTAATSGLHVIELLQDHEPDCILMDIQMPDMDGIE 770

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            TK I+  + + L+ IP+IA+TA AMKGD+E     G + YISKPI
Sbjct: 771 TTKVIRGGQIAGLENIPIIALTAHAMKGDKEIFLAAGMDGYISKPI 816


>gi|187933060|ref|YP_001885916.1| metal dependent phosphohydrolase, HD region with Response Regulator
           Receiver modulation [Clostridium botulinum B str. Eklund
           17B]
 gi|187721213|gb|ACD22434.1| metal dependent phosphohydrolase, HD region with Response Regulator
           Receiver modulation [Clostridium botulinum B str. Eklund
           17B]
          Length = 302

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+I++DN+ N ++ +DL+ T GY      +G +  ELAR  KPDVI++D+ L  ++G E
Sbjct: 3   KVLIIDDNKQNCEIIKDLLYTWGYCVYLAFDGFDGFELARSVKPDVILLDVMLPGMNGFE 62

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             K++KE  E Q IP+I +T  +   D  R    G + ++SKPI
Sbjct: 63  ACKKLKETEETQNIPIIMLTVLSEVEDRIRGFNVGADVFLSKPI 106


>gi|311748172|ref|ZP_07721957.1| sensory box histidine kinase/response regulator [Algoriphagus sp.
            PR1]
 gi|126576660|gb|EAZ80908.1| sensory box histidine kinase/response regulator [Algoriphagus sp.
            PR1]
          Length = 1356

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            KK+++V+DNE N  +   ++E +  + +   NG EA++ A+ H  D+I+MD+Q+  + G+
Sbjct: 1111 KKILVVDDNEFNRLVATTILEQNEMLTITANNGEEAIQAAKDHSLDLILMDVQMPVMDGM 1170

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
              TK I++D +  +IP+IA+TAFAMKGD E+    G + +++KP 
Sbjct: 1171 MATKVIRDDLQ-SKIPIIALTAFAMKGDREKYLSHGMDDFLAKPF 1214


>gi|146284264|ref|YP_001174417.1| type IV pilus response regulator PilH [Pseudomonas stutzeri A1501]
 gi|145572469|gb|ABP81575.1| type IV pilus response regulator PilH [Pseudomonas stutzeri A1501]
 gi|327482647|gb|AEA85957.1| type IV pilus response regulator PilH [Pseudomonas stutzeri DSM
           4166]
          Length = 121

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 71/115 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M     ++E  G++ L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMYKLTAMLEKHGHVVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +DSE   IPVI VT    + D+   ++ G + Y++KP+  +  ++T+
Sbjct: 61  FQATRQLTKDSETSHIPVIIVTTKDQETDKVWGKRQGAKDYLTKPVDEATLLKTL 115


>gi|67531559|ref|XP_662083.1| hypothetical protein AN4479.2 [Aspergillus nidulans FGSC A4]
 gi|40741632|gb|EAA60822.1| hypothetical protein AN4479.2 [Aspergillus nidulans FGSC A4]
          Length = 1300

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1109 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1168

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   DS L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1169 TGKIREYERDSGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1225


>gi|259482698|tpe|CBF77424.1| TPA: Histidine kinase J7 [Source:UniProtKB/TrEMBL;Acc:Q6WJ24]
            [Aspergillus nidulans FGSC A4]
          Length = 1297

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1109 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1168

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   DS L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1169 TGKIREYERDSGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1225


>gi|241957485|ref|XP_002421462.1| histidine kinase, putative; nuclear response regulator and
            transcription factor, putative [Candida dubliniensis
            CD36]
 gi|223644806|emb|CAX40799.1| histidine kinase, putative [Candida dubliniensis CD36]
          Length = 1070

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 878  KILLAEDNLVNQKLAVRILEKQGHQVEVVENGLEAFEAIKKNKYDVVLMDVQMPVMGGFE 937

Query: 64   ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 938  ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 997

Query: 116  IKKYI 120
            I K I
Sbjct: 998  INKCI 1002


>gi|209523399|ref|ZP_03271954.1| histidine kinase [Arthrospira maxima CS-328]
 gi|209496141|gb|EDZ96441.1| histidine kinase [Arthrospira maxima CS-328]
          Length = 728

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR------QHKPDVIIMDIQLQ 57
           ++++VED   N  L  +++E  GY      +G   L++        +  PD+I+MDIQL 
Sbjct: 604 RILVVEDQIFNQLLITEVLELEGYEVELIADGYTMLDMINSTLAKPELLPDLILMDIQLP 663

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ G E+ +++K+ S  + +PV+AVTA  M GD ER    G + Y+SKP+ +   + T+K
Sbjct: 664 EVDGFELIRRLKQSSLWKVVPVVAVTAMVMSGDRERCLAAGADGYLSKPLDVDQVLATVK 723

Query: 118 KYI 120
           K++
Sbjct: 724 KFV 726


>gi|73539168|ref|YP_299535.1| PAS [Ralstonia eutropha JMP134]
 gi|72122505|gb|AAZ64691.1| PAS [Ralstonia eutropha JMP134]
          Length = 1060

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 71/119 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++VEDN +N ++ + L+  +G    Q  NG  AL L  Q + D+++MD+Q+  + GL
Sbjct: 788 RTVLLVEDNPINQEVAQALLTQAGMQVTQANNGQHALGLLAQGRFDLVLMDVQMPMLDGL 847

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E T++I+ D     +PV+A+TA A++ D +R    G + Y+SKPI      + + + +G
Sbjct: 848 ETTQRIRRDPRHASMPVVALTASALEDDRQRCLAAGMDDYVSKPIEPRKLYQVMARLVG 906


>gi|237710942|ref|ZP_04541423.1| two-component system sensor histidine kinase [Bacteroides sp.
            9_1_42FAA]
 gi|229454786|gb|EEO60507.1| two-component system sensor histidine kinase [Bacteroides sp.
            9_1_42FAA]
          Length = 1029

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 910  ILVAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHNPQIILMDINMPVMDGYEA 968

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y++KPIS
Sbjct: 969  TREIRKLS--LDVPIIAVTAFAYASDEQRVMENGFDGYMAKPIS 1010


>gi|298528782|ref|ZP_07016186.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
 gi|298512434|gb|EFI36336.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
          Length = 1037

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             +++ ED  LN K    L++  G+  +   NG +A+E   +H  D ++MDIQ+ E++GLE
Sbjct: 911  NILLAEDEPLNQKFMVTLLKKFGHNVVLAPNGKQAVEEFFRHDFDCVLMDIQMPEMTGLE 970

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+E       +++P+IAVTA    GD ER    G + YI KP+S   F     K+ 
Sbjct: 971  ATRAIREAKSAGSKRDVPIIAVTAHTQSGDRERFLDAGMDDYIGKPVSSQDFQRVFDKFF 1030

Query: 121  G 121
            G
Sbjct: 1031 G 1031


>gi|33466074|gb|AAQ19476.1| histidine kinase J7 [Emericella nidulans]
          Length = 1297

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1109 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1168

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   DS L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1169 TGKIREYERDSGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1225


>gi|212634252|ref|YP_002310777.1| PAS domain-containing protein [Shewanella piezotolerans WP3]
 gi|212555736|gb|ACJ28190.1| PAS domain protein [Shewanella piezotolerans WP3]
          Length = 1572

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 71/117 (60%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++ EDN+LN +L  +L+ ++G   +   NG E L+   Q + D ++MD Q+  + G  
Sbjct: 1233 KLLVAEDNDLNQELIVELLSSNGITPVLANNGQEVLDFLEQEQFDGVLMDCQMPIMDGYT 1292

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T++I+++ + + +PV+A+T  AM GD ER  + G   +I KPI++     TI K++
Sbjct: 1293 ATRRIRDNEQFEHLPVLAMTENAMAGDRERALESGMNDHIPKPINVDELFTTIAKWV 1349


>gi|307153463|ref|YP_003888847.1| ATP-binding region ATPase domain-containing protein [Cyanothece sp.
            PCC 7822]
 gi|306983691|gb|ADN15572.1| ATP-binding region ATPase domain protein [Cyanothece sp. PCC 7822]
          Length = 2003

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 76/119 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +KV+IV+D   N  +  +L++  G+   + ++G+EAL+ A + +PD+I+MD+ +  + G 
Sbjct: 1794 QKVLIVDDKGTNRSVLENLLKPLGFNVKEAKDGLEALKCALEFEPDIILMDLVMPNLDGF 1853

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+Q++   +L+E+ VIA +A     D+++  K GC  +I KPI  S  +E ++K++G
Sbjct: 1854 EATRQLRMLPQLKEVVVIATSASVFNFDQQQSLKVGCNDFIPKPIRESELLEKLRKHLG 1912


>gi|83313199|ref|YP_423463.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82948040|dbj|BAE52904.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 123

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 70/121 (57%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VEDN +NMKL    +  +GY  +++ +G   ++L       VI+MDIQL + S
Sbjct: 1   MTGTVVVVEDNAMNMKLLEQALTIAGYTTVKSSDGDGLVDLTAGSGAGVILMDIQLPKYS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ++ D   + +PV+AVTAFA         + G    I+KPIS+   ++ + +Y 
Sbjct: 61  GIDLLKQLRADDRTKGVPVVAVTAFADPDSVAGFLEEGFNQVITKPISIRKLLDEVARYC 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|332702972|ref|ZP_08423060.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553121|gb|EGJ50165.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 736

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED +LN +     +   G+      NG EAL+L  +   DV++MD+Q+ E+ GLE
Sbjct: 610 RILLAEDEQLNREFVTFFLLGEGHTVTTATNGCEALDLLERQDFDVVLMDVQMPELDGLE 669

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++I+  E  +   +P+IA+TA+AMK D ER+   G + Y+SKP+ +     ++ + + 
Sbjct: 670 ATRRIRSLEKPDKAHVPIIALTAYAMKEDRERVMAAGMDDYLSKPLDMDELRRSLARILA 729

Query: 122 E 122
           E
Sbjct: 730 E 730


>gi|265750529|ref|ZP_06086592.1| two-component system sensor histidine kinase [Bacteroides sp.
            3_1_33FAA]
 gi|263237425|gb|EEZ22875.1| two-component system sensor histidine kinase [Bacteroides sp.
            3_1_33FAA]
          Length = 1045

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILVAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHNPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRVMENGFDGYMAKPIS 1026


>gi|237727241|ref|ZP_04557722.1| two-component system sensor histidine kinase [Bacteroides sp. D4]
 gi|229434097|gb|EEO44174.1| two-component system sensor histidine kinase [Bacteroides dorei
            5_1_36/D4]
          Length = 1045

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILVAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHNPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRVMENGFDGYMAKPIS 1026


>gi|323494892|ref|ZP_08099984.1| sensory box sensor histidine kinase/response regulator [Vibrio
            brasiliensis LMG 20546]
 gi|323310856|gb|EGA64028.1| sensory box sensor histidine kinase/response regulator [Vibrio
            brasiliensis LMG 20546]
          Length = 1318

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 77/118 (65%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L++ +    L   NG +A+ +  QH  D+++MD+Q+  + G+
Sbjct: 991  QTILLVEDNEVNQEVAIGLLKGTNVNVLTADNGQQAINMLEQHPVDLVLMDMQMPVLDGV 1050

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              T+QI+ + + Q++P+IA+TA AM+ D +R    G  ++++KPI++    +T+ +++
Sbjct: 1051 SATEQIRRNPDWQQLPIIAMTANAMQSDVDRCIAAGMNSHLAKPINVRNLYQTLSQHL 1108



 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 58/119 (48%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ ++V+DN+    +   L+    + A    NG EAL+  R  + D++ +D  +  ++G+
Sbjct: 852 KRALVVDDNDSARNILVTLLNAMHFDAKAVSNGFEALDEIRNSQFDLLFVDWNMPGLNGI 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +  + +  L+      VTA+  +   ++      ++ I KP++ S  ++ I    G
Sbjct: 912 ELLQTAQNEQLLEHSKNFLVTAYGREISLDQASSKLVDSLIVKPVNPSNLLDAIMDSFG 970


>gi|212694788|ref|ZP_03302916.1| hypothetical protein BACDOR_04322 [Bacteroides dorei DSM 17855]
 gi|212662642|gb|EEB23216.1| hypothetical protein BACDOR_04322 [Bacteroides dorei DSM 17855]
          Length = 1045

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILVAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHNPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRVMENGFDGYMAKPIS 1026


>gi|253569669|ref|ZP_04847078.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_6]
 gi|251840050|gb|EES68132.1| two-component system sensor histidine kinase [Bacteroides sp.
           1_1_6]
          Length = 635

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L++   Y  L  RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 520 KKILVVEDIESNFAQLNILLKKE-YTILWVRNGQEAINSFIREKPDLILMDIRMPVMDGI 578

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 579 QATEKIRTIS--LSVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLEKLKETIETYIG 635


>gi|3850150|emb|CAA21950.1| histidine kinase [Candida albicans]
 gi|238883421|gb|EEQ47059.1| hypothetical protein CAWG_05614 [Candida albicans WO-1]
          Length = 1081

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|257458984|ref|ZP_05624103.1| sensor histidine kinase/response regulator [Campylobacter gracilis
            RM3268]
 gi|257443369|gb|EEV18493.1| sensor histidine kinase/response regulator [Campylobacter gracilis
            RM3268]
          Length = 1517

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 4/123 (3%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISGL 62
            K++I EDNE+N KL +  + +         NG+ ALE  + +   D+I MDI +  + G+
Sbjct: 1225 KILIAEDNEINQKLMKHTLNSFNMNLTIVENGLLALEARKANNDYDLIFMDISMPVMDGI 1284

Query: 63   EITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            E TKQIK+   ++ L+ IP++AVTA A+KGD E+    G + Y +KPI   I  + +  +
Sbjct: 1285 ESTKQIKQYEHENNLRHIPIVAVTANALKGDREKFMAAGLDEYCTKPIKKDILAQMLDNF 1344

Query: 120  IGE 122
            IG+
Sbjct: 1345 IGD 1347


>gi|254506216|ref|ZP_05118360.1| PAS fold family protein [Vibrio parahaemolyticus 16]
 gi|219551034|gb|EED28015.1| PAS fold family protein [Vibrio parahaemolyticus 16]
          Length = 1319

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 76/118 (64%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + V++VEDNE+N ++   L+  +    L   +G EA+++   HK  +++MD+Q+  + G+
Sbjct: 992  QTVLLVEDNEVNQEVALGLLSDTNLDVLVANHGQEAIKMLGHHKVSLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               ++I++  E QE+P++A+TA AM+ D ER    G   +I+KPI+++   +T+++Y+
Sbjct: 1052 TACQEIRKKDEWQELPIVAMTANAMQSDVERCINAGMNGHIAKPINVANLYQTLQQYL 1109



 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ +IV+DN+    + R L+    + A    N  EAL+  ++   D++ +D  +  ++GL
Sbjct: 853 KRALIVDDNDSARSILRTLLTAMHFDAKAVSNAYEALDELKERAYDMLFVDWTMPGMNGL 912

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ ++  ++  L    V  VTA+  +           +A I KP++ S  ++ +    G
Sbjct: 913 ELLQKAHDERLLPHCKVFLVTAYGRELSLTEQSSKLIDALIVKPVNPSNLLDAVMDSFG 971


>gi|77022892|ref|XP_888890.1| hypothetical protein CaO19_5181 [Candida albicans SC5314]
 gi|76573703|dbj|BAE44787.1| hypothetical protein [Candida albicans]
          Length = 1081

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|261211547|ref|ZP_05925835.1| BarA sensory histidine kinase [Vibrio sp. RC341]
 gi|260839502|gb|EEX66128.1| BarA sensory histidine kinase [Vibrio sp. RC341]
          Length = 925

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A++   D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVECVIACASGQEAIEQAQERHFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    QE PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKSIKQLHGYQETPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|2911164|dbj|BAA24952.1| CaNIK1 [Candida albicans]
          Length = 1081

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|3851457|gb|AAC72284.1| Nik1p [Candida albicans]
          Length = 1081

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|3243089|gb|AAC23929.1| histidine kinase [Candida albicans]
          Length = 1081

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|68477999|ref|XP_717003.1| hypothetical protein CaO19.5181 [Candida albicans SC5314]
 gi|68478134|ref|XP_716936.1| hypothetical protein CaO19.12648 [Candida albicans SC5314]
 gi|46438625|gb|EAK97953.1| hypothetical protein CaO19.12648 [Candida albicans SC5314]
 gi|46438696|gb|EAK98023.1| hypothetical protein CaO19.5181 [Candida albicans SC5314]
          Length = 1081

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 875 KILLAEDNLVNQKLAVRILEKQGHSVEVVENGLEAYEAIKRNKYDVVLMDVQMPVMGGFE 934

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 935 ATEKIRQWEKKSNPIDSLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 994

Query: 116 IKKYI 120
           I K I
Sbjct: 995 INKCI 999


>gi|217974881|ref|YP_002359632.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
 gi|217500016|gb|ACK48209.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS223]
          Length = 1238

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL+       D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVLAGNGQVALDTIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E     E+P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADELPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1229



 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSTLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMMPEMDGSD 1027

Query: 64   ITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  L + PV I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VVSAIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|332703725|ref|ZP_08423813.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553874|gb|EGJ50918.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 946

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDNE+N  L  +L++  G++     NG +AL +  + + D+++MD+Q+ E++G+E
Sbjct: 822 KILLAEDNEINRFLALELLKERGHVVTAVENGRDALNMLAKERFDLVLMDVQMPEVNGVE 881

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T++I   K       IP++A+TA+A+KGD E+    G + Y+SKPI +
Sbjct: 882 ATRRIRAGKVPGTDPRIPIVALTAYALKGDREKFMSAGMDDYLSKPIDM 930


>gi|332704569|ref|ZP_08424657.1| histidine kinase [Desulfovibrio africanus str. Walvis Bay]
 gi|332554718|gb|EGJ51762.1| histidine kinase [Desulfovibrio africanus str. Walvis Bay]
          Length = 549

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ EDNE+N  +  DL+   G+     +NG+EALE  R     +++MD+++  + G+E
Sbjct: 432 KVLLAEDNEINRLVALDLLRMRGHTVTAVKNGLEALEALRHEPFSLVLMDVRMPWMDGIE 491

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            TK+I+  ++    +P++A+TA+A+ GD ER    G + Y+SKPI +
Sbjct: 492 ATKRIRAGEAGDPRVPIVALTAYALDGDRERFLAAGMDDYLSKPIDM 538


>gi|153002294|ref|YP_001367975.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS185]
 gi|151366912|gb|ABS09912.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS185]
          Length = 1238

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL+       D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVLAGNGQVALDTIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E     E+P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADELPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1229



 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSTLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMMPEMDGSD 1027

Query: 64   ITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  L + PV I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VVSAIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|322421121|ref|YP_004200344.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M18]
 gi|320127508|gb|ADW15068.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M18]
          Length = 239

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 69/116 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+M+V+D  L ++L +  ++ S    +   NG+EALEL R+  PD+I MD+ +  + G+ 
Sbjct: 5   KIMLVDDTRLILELEKSFLKFSHVDVVTAGNGVEALELIRKDPPDLIFMDLNMPAMDGIS 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
               +K D  L  IPV+ +T    + D ER ++ GC+ +++KPI   +F++  +KY
Sbjct: 65  CCTLLKADPFLCGIPVVMLTTAGNEQDRERAKQAGCDDFLTKPIDRRLFLDIARKY 120


>gi|126738369|ref|ZP_01754090.1| sensor histidine kinase/response regulator [Roseobacter sp.
           SK209-2-6]
 gi|126720866|gb|EBA17571.1| sensor histidine kinase/response regulator [Roseobacter sp.
           SK209-2-6]
          Length = 764

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+  EDN+ N  +FR ++++         NG+EAL L    KPD+I MDI + E+ G E
Sbjct: 633 RVLAAEDNKTNQLVFRKMVKSYNIDLCFANNGLEALNLYESFKPDLIFMDISMPEMDGKE 692

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T++I+  E    + +P++A+TA AM GD E I   G + Y++KP+   +  E I+ Y
Sbjct: 693 ATQEIRKIEAETGKHVPIVALTAHAMSGDSEGILAAGLDHYLTKPLRKGLIGEKIEGY 750


>gi|29349960|ref|NP_813463.1| two-component system sensor histidine kinase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|29341871|gb|AAO79657.1| two-component system sensor histidine kinase [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 635

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L++   Y  L  RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 520 KKILVVEDIESNFAQLNILLKKE-YTILWVRNGQEAINSFIREKPDLILMDIRMPVMDGI 578

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 579 QATEKIRTIS--LSVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLEKLKETIETYIG 635


>gi|291566270|dbj|BAI88542.1| two-component hybrid sensor and regulator [Arthrospira platensis
           NIES-39]
          Length = 728

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHK------PDVIIMDIQLQ 57
           ++++VED   N  L  +++E  GY      +G   L++           PD+I+MDIQL 
Sbjct: 604 RILVVEDQLFNQLLITEVLELEGYQVELIADGNTMLDMINSTMVKPEILPDLILMDIQLP 663

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ G E+ +++K+ S  + +PV+AVTA  M GD ER    G + Y+SKP+ +   +ET+K
Sbjct: 664 EVDGFELIRRLKQSSLWKVVPVVAVTAMVMSGDRERCLVAGADGYLSKPLDVDQVLETVK 723

Query: 118 KYI 120
            ++
Sbjct: 724 DFL 726


>gi|124009209|ref|ZP_01693890.1| sensory box histidine kinase/response regulator [Microscilla marina
           ATCC 23134]
 gi|123985194|gb|EAY25128.1| sensory box histidine kinase/response regulator [Microscilla marina
           ATCC 23134]
          Length = 1055

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 75/119 (63%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIE--TSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           K++IVEDN +NM+L + +++        ++  NG EA+++ +Q  PD I+MDIQ+ +++G
Sbjct: 824 KMLIVEDNAVNMQLSKVIVQGIMPDTTIVEACNGQEAIDVCKQELPDFIVMDIQMPQMNG 883

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T  I++    +  P+IA+TA  +KG+++R    G   YISKPI    F++ I K++
Sbjct: 884 YEATTYIRKIKGAENTPIIALTAGTLKGEKDRCLAAGMNDYISKPIVKHEFVQMINKWV 942



 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 3/82 (3%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEIS 60
           ++KV+IV+DN+ N ++  +++      A +  NG++ALE LA   K D++ +D  +  + 
Sbjct: 679 IEKVLIVDDNKNNRQILAEMLTIKDIEAEEVTNGLDALERLAAGKKYDIVFVDYHMPFMD 738

Query: 61  GLEITKQIKEDSEL--QEIPVI 80
           GLE  K I+++  +  Q+ P++
Sbjct: 739 GLETIKNIRQELAITAQDQPIV 760


>gi|311693679|gb|ADP96552.1| multi-sensor hybrid histidine kinase [marine bacterium HP15]
          Length = 957

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 72/121 (59%), Gaps = 1/121 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+ V+DN+ N+KL   L+E     A    +G EAL  ARQ   D++ MD+Q+  + G
Sbjct: 681 VPRVLAVDDNDANLKLVMTLLEDCQLDAESASSGFEALSKARQKPFDLVFMDLQMPGMDG 740

Query: 62  LEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +E T +++E D+     P+IA+TA A+  ++ER+ K G + Y+ KPIS     + I +Y 
Sbjct: 741 VETTARLREMDTGNHRTPIIALTAHALADEQERLTKQGFDGYMPKPISSGQLNDIIHEYT 800

Query: 121 G 121
           G
Sbjct: 801 G 801


>gi|163793734|ref|ZP_02187708.1| hypothetical protein BAL199_11916 [alpha proteobacterium BAL199]
 gi|159180845|gb|EDP65362.1| hypothetical protein BAL199_11916 [alpha proteobacterium BAL199]
          Length = 1311

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP--DVIIMDIQLQEISG 61
            +V++VEDNE+N ++ R+++E  G       NGM AL + R + P  D I+MD+Q+ E+ G
Sbjct: 965  RVLLVEDNEINQQIAREVLEDVGVTVAIADNGMIALSMLRGNGPLPDAILMDLQMPELDG 1024

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             E T+ I+ D  L  IP+IA+TA     + +R    G   +++KP+ +   ++T++++ G
Sbjct: 1025 YETTRWIRSDDRLAHIPIIAMTAHVTDDERKRCLAAGMVDHVAKPVDVRQLLDTLERWTG 1084



 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQT-RNGMEAL----ELARQHKP-DVIIMDIQLQ 57
           + +IVEDN +   +  D ++   +  ++   +G  AL    E   + +P D++++D ++ 
Sbjct: 814 RTLIVEDNAVARAVLADTLKGLRFTDVEAVGDGPAALGAFAEAQLRGQPFDLVLVDWKMP 873

Query: 58  EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + G+   +++KE S    +P ++ VTA +     E  R+ G    + KP+++S+ +++I
Sbjct: 874 GMDGIATARRLKELSTPGAVPSILMVTAHSRAEVVEHAREVGILKVLVKPVNVSMLVDSI 933


>gi|297621214|ref|YP_003709351.1| putative transcriptional regulator [Waddlia chondrophila WSU
           86-1044]
 gi|297376515|gb|ADI38345.1| putative transcriptional regulator [Waddlia chondrophila WSU
           86-1044]
          Length = 129

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 73/120 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED+ +N+++  ++++  G I     NG EAL+   ++  D I MD+Q+  + G E
Sbjct: 7   RILVVEDHFINLEMISEMLKRLGCIVDTASNGKEALDCVTKNFYDAIFMDLQMPVMDGYE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            T+ I+ED   Q+IP+IA+TA  +K D +R  + G + Y++KP  L      +KKY+  A
Sbjct: 67  TTRLIREDKTRQKIPIIALTANHVKSDLDRCLESGMDGYLTKPFELKDLNNVLKKYLDVA 126


>gi|284051516|ref|ZP_06381726.1| multi-sensor hybrid histidine kinase [Arthrospira platensis str.
           Paraca]
          Length = 270

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN +N  L   L++  G+   +  NG EA+ L +Q  P +I MD+ +  I G E
Sbjct: 53  RILVVEDNPVNRLLLTTLLQDVGFEVREAENGQEAIALWQQWHPHLIFMDMHMPVIDGFE 112

Query: 64  ITKQIKEDSELQEIPVI-AVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ IK+ SE+  IPV+ A+TA A     +     GC+ +ISKP      +ET+ KY+G
Sbjct: 113 ATQYIKQ-SEVDAIPVVVAITASAFTEQRQNCIDAGCDDFISKPFRREQVLETLTKYLG 170


>gi|332701444|ref|ZP_08421532.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551593|gb|EGJ48637.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 697

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N    + L++ +G+       G E LE+  +   D ++MD+Q+ E+ G+E
Sbjct: 565 RILVAEDNPINQIFIQALLQDAGHDVRIAPTGCEVLEVLARDCFDCVLMDVQMPEMDGME 624

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T++I+     L +IP+IA+TA+AMK D+ERI   G + Y++KP+ ++ F   +++ +  
Sbjct: 625 TTRRIRAMAPPLCDIPIIALTAYAMKEDQERIMSAGMDGYVTKPVDIAEFSRVLREKLAH 684

Query: 123 A 123
           A
Sbjct: 685 A 685


>gi|326794044|ref|YP_004311864.1| multi-sensor hybrid histidine kinase [Marinomonas mediterranea
           MMB-1]
 gi|326544808|gb|ADZ90028.1| multi-sensor hybrid histidine kinase [Marinomonas mediterranea
           MMB-1]
          Length = 912

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDL-IETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           K++++VEDN LN ++   L I  S  +A  ++NG EA+E  + +  D+++MD+Q+  + G
Sbjct: 617 KRILVVEDNALNAQILGQLLIMQSADVAF-SQNGEEAIEELKSNPYDLVMMDVQMPILDG 675

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              T+QI+ +   + +P+IA+TA AMKGD E+  + G   Y+SKP+       T+ K++G
Sbjct: 676 YSATRQIRLNPSFKTLPIIAMTANAMKGDREKALESGMNDYLSKPVEPDTLYTTLIKWLG 735


>gi|119505209|ref|ZP_01627284.1| response regulator receiver domain [marine gamma proteobacterium
           HTCC2080]
 gi|119458900|gb|EAW40000.1| response regulator receiver domain [marine gamma proteobacterium
           HTCC2080]
          Length = 126

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 67/109 (61%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + +++VEDNE+N ++ +  ++  GY      +G EAL+  R  KP ++++DI L    
Sbjct: 5   MSRHLLLVEDNEVNREMLQRRLQRVGYTLDCAADGQEALDKMRDVKPALVLLDINLPIKD 64

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           G  + K+ + DS++Q+IP+IA+TA AM+ D ++    GC  Y +KPI  
Sbjct: 65  GWTVVKEARSDSDIQDIPIIALTAHAMESDRQQALASGCRDYATKPIDF 113


>gi|317483762|ref|ZP_07942704.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316924994|gb|EFV46138.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 988

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 75/118 (63%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN++N  +  ++++  G       NG+EA+++AR    DVI+MDIQ+ E+ G+E
Sbjct: 873 RVLLAEDNDINQIVATEILKMKGIAVDVASNGLEAVDMARSGAYDVILMDIQMPELDGIE 932

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++I+  + L +IP+IA+TA  MKGD E+  + G + +I+KPI        +++  G
Sbjct: 933 ATRRIR--AFLPDIPIIAMTAHTMKGDAEKCLEAGMQDHIAKPIDPETLFAALQRARG 988


>gi|150866454|ref|XP_001386063.2| histidine kinase osmosensor [Scheffersomyces stipitis CBS 6054]
 gi|149387710|gb|ABN68034.2| histidine kinase osmosensor [Scheffersomyces stipitis CBS 6054]
          Length = 1118

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 73/125 (58%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  R+ K DV++MD+Q+  + G E
Sbjct: 866 KILLAEDNLVNQKLAVRILEKQGHQVEVVENGLEAYEAIRKKKYDVVLMDVQMPVMGGFE 925

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 926 ATEKIRQWEKKSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 985

Query: 116 IKKYI 120
           I K I
Sbjct: 986 INKCI 990


>gi|300864563|ref|ZP_07109425.1| hypothetical protein OSCI_960001 [Oscillatoria sp. PCC 6506]
 gi|300337436|emb|CBN54573.1| hypothetical protein OSCI_960001 [Oscillatoria sp. PCC 6506]
          Length = 391

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 74/117 (63%), Gaps = 3/117 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISGL 62
           ++++ EDN +N K+   ++E  GY A    NG+EALE A QHK  D ++MD+Q+ E+ GL
Sbjct: 136 RILLAEDNLVNQKVALRILERLGYRADVANNGLEALE-ALQHKTYDTVLMDVQMPEMDGL 194

Query: 63  EITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           E  + I +   +Q  P +IA+TA AM+GD E+  + G + YISKPI  +  ++ + +
Sbjct: 195 ETARYINQHWPIQRRPRIIAMTANAMQGDREKCLEAGMDDYISKPIQFTELIQALSQ 251



 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 9/114 (7%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGLE 63
           ++IV+DN  N ++ R   +  G I+ +  NG EAL  L++    D+ I+D+Q+ ++ GL 
Sbjct: 1   MLIVDDNATNRQILRLQTQKWGMISQEAANGTEALNCLSQSELYDLAILDVQMPQMDGLT 60

Query: 64  ITKQIKEDSELQEIPVIAVTAF-AMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           +  +I++   ++ +P++ +T+   M G    +    C   ++KPI  S   E +
Sbjct: 61  LASEIQKSDRIRRMPIVLLTSINCMVGSANAV----C---LTKPIKPSQLYEVL 107


>gi|239908793|ref|YP_002955535.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239798660|dbj|BAH77649.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 788

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++I ED+ +++   + ++E SGY     ++G+EAL+   +   D+I+MD+QL  + G++
Sbjct: 662 RILIAEDDPVSLLSGKRMLEKSGYSVTAAKDGLEALQFLTEQDFDLILMDVQLPTMDGVD 721

Query: 64  ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+E    ++   IP+IA+TA+AM GD+E+  + G   YISKP+ +    E I++ +
Sbjct: 722 ATRAIREGRAGEDKASIPIIAMTAYAMTGDKEKFLEAGMNDYISKPVEMETLKEVIERVM 781

Query: 121 GEA 123
            +A
Sbjct: 782 EKA 784


>gi|59714208|ref|YP_206983.1| two-component hybrid sensor histidine kinase [Vibrio fischeri
           ES114]
 gi|59482456|gb|AAW88095.1| two-component hybrid sensor histidine kinase [Vibrio fischeri
           ES114]
          Length = 766

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 72/118 (61%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VEDN  N  + ++ +  +GY     +NG EA+  A   + D+I MDI + E+ G+ 
Sbjct: 500 NILVVEDNHANQIVIKNTLNYAGYSIDIAQNGKEAITKAINTQYDLIFMDISMPEMDGMT 559

Query: 64  ITKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK+I+  S+  Q +P+IA+TA A+ GD+ER  + G   Y+SKP + S  +E + KY+
Sbjct: 560 ATKKIRSLSDTHQNMPIIALTAHALSGDKERFIEAGMTDYLSKPFNRSDLLECLAKYL 617


>gi|258514818|ref|YP_003191040.1| multi-sensor hybrid histidine kinase [Desulfotomaculum acetoxidans
            DSM 771]
 gi|257778523|gb|ACV62417.1| multi-sensor hybrid histidine kinase [Desulfotomaculum acetoxidans
            DSM 771]
          Length = 1172

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 64/104 (61%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             +++ ED+ LN K+    + T G+     ++G E L   + +  D+I+MD+Q+  + G E
Sbjct: 946  NILVAEDHILNQKIIESFLVTEGHRVTMVKDGAEVLHALKSNNFDLILMDMQMPTMDGYE 1005

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
               +I+ + +   +P++A+TA+AMKGDEE+  + GC  Y+SKPI
Sbjct: 1006 TMARIRAEKKWGSMPIVAITAYAMKGDEEKCFEAGCNYYLSKPI 1049



 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 68/116 (58%), Gaps = 3/116 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED+ +  ++ +  +  +GY  + T +G EA+  AR + P  +I+D+ L ++SG ++
Sbjct: 684 ILVVEDDRVARQIIKIHLRKAGYNVISTASGKEAITCARHYHPHGVILDLLLPDLSGWQV 743

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +++K+    +EIPVI  +    K  E+ I  G  + YI KP+     +E ++K++
Sbjct: 744 LQELKKSEITREIPVIICSILPEK--EKAISLGAVD-YIEKPVREKTLLEKVRKHV 796


>gi|108760607|ref|YP_628793.1| response regulator [Myxococcus xanthus DK 1622]
 gi|108464487|gb|ABF89672.1| response regulator [Myxococcus xanthus DK 1622]
          Length = 169

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 69/105 (65%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+V++V+D +   +++ + +E  G+     RNG+EA+E A + +PD+I+MD+ L  + G 
Sbjct: 42  KRVLVVDDFDDAREMYAEYLEFVGFEVDTARNGVEAVEKASEGEPDIILMDLSLPVMDGW 101

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           E T++IK+DS  ++IPV+A+T   + G+ E  R  G + +++KP 
Sbjct: 102 EATRRIKQDSRTRDIPVMALTGHVLAGNAEHARDAGADEFVAKPC 146


>gi|218674083|ref|ZP_03523752.1| probable two-component sensor histidine kinase/response regulator
           hybrid protein [Rhizobium etli GR56]
          Length = 163

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDNE+N  +F  +++ +G       NG EA+     H P +I+MD+ +  ++G E 
Sbjct: 34  VLVAEDNEVNQIVFTQILQGTGLSFRVVNNGQEAVAAWESHTPRIIMMDVSMPVMNGHEA 93

Query: 65  TKQI--KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+ I  +E  + Q +P+I VTA A++ D E     G + Y+SKPIS  +  E I++++G
Sbjct: 94  TRTIREREKGQGQRVPIIGVTAHALESDREACLDAGMDDYMSKPISPELLEEKIRQWLG 152


>gi|291569174|dbj|BAI91446.1| two-component hybrid sensor and regulator [Arthrospira platensis
           NIES-39]
          Length = 1009

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN +N  L   L++  G+   +  NG EA+ L +Q  P +I MD+ +  I G E
Sbjct: 792 RILVVEDNPVNRLLLTTLLQDVGFEVREAENGQEAIALWQQWHPHLIFMDMHMPVIDGFE 851

Query: 64  ITKQIKEDSELQEIPVI-AVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ IK+ SE+  IPV+ A+TA A     +     GC+ +ISKP      +ET+ KY+G
Sbjct: 852 ATQYIKQ-SEVDAIPVVVAITASAFTEQRQNCIDAGCDDFISKPFRREQVLETLTKYLG 909


>gi|189467145|ref|ZP_03015930.1| hypothetical protein BACINT_03529 [Bacteroides intestinalis DSM
           17393]
 gi|189435409|gb|EDV04394.1| hypothetical protein BACINT_03529 [Bacteroides intestinalis DSM
           17393]
          Length = 979

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (59%), Gaps = 7/121 (5%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDNE N  LF  ++    Y  +   NG EA+EL R+ +P VIIMDI + ++ G E 
Sbjct: 860 ILVAEDNESNYLLFNSIL-NKDYNLVHAWNGEEAIELYRKFQPHVIIMDINMPKMDGYEA 918

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME----TIKKYI 120
            ++I++ S  + IP+IAVTA++   D+E++ + G   Y+ KP+   I  E    TIK+ I
Sbjct: 919 AREIRKFS--KTIPIIAVTAYSFSSDKEKVMENGFNGYVPKPVDAHILKEKLHSTIKQNI 976

Query: 121 G 121
            
Sbjct: 977 A 977


>gi|224371411|ref|YP_002605575.1| putative two-component system sensor protein [Desulfobacterium
            autotrophicum HRM2]
 gi|223694128|gb|ACN17411.1| putative two-component system sensor protein [Desulfobacterium
            autotrophicum HRM2]
          Length = 1272

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 71/120 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDNE+N ++  +++   G       NG EA++    +  D ++MD+Q+  + G  
Sbjct: 908  RVLLVEDNEINQEVAMEILAAGGVTVSLAANGREAVDAVGMNHFDAVLMDLQMPVMDGYT 967

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T+ I++D   +++P+IA+TA AM  D ++ R  G  A+I+KPI   +   T+ ++I  A
Sbjct: 968  ATRTIRQDVRFKDLPIIAMTAHAMADDPDKSRHAGMNAHITKPIDPEVLYSTLAEWISAA 1027



 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGY---IALQTRNGMEALELARQHKP-DVIIMDIQLQEI 59
           K ++V+DN  + ++F+ ++E   +   +A     G+E +  +   +P D+++MD +L  I
Sbjct: 757 KALVVDDNATSREIFQSMLECFSFDVTLAASGEEGLEEIGKSVGGRPYDIVVMDWKLPGI 816

Query: 60  SGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            G+E +K+IK+++ L  IP VI V+A+A +    R    G + ++ KPI+ S+  +TI
Sbjct: 817 DGIEASKRIKKNTGLTRIPLVILVSAYAREEIMWRAEAAGLDGFLIKPINASVMFDTI 874


>gi|153872535|ref|ZP_02001400.1| Response regulator receiver [Beggiatoa sp. PS]
 gi|152070999|gb|EDN68600.1| Response regulator receiver [Beggiatoa sp. PS]
          Length = 121

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 70/121 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VEDNE+N  +    ++  G+      +G + +++A    PD+I+MD+ L    G
Sbjct: 1   MPKILLVEDNEMNRDMLSRRLKRKGFDVSIAVDGGQGVDMAHNEIPDLILMDMSLPVKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              TK++K   + Q+IPVIA+TA AM GD E+    GC+ Y +KPI L   +  I+  + 
Sbjct: 61  WTATKELKAAEDTQKIPVIALTAHAMSGDREQALAAGCDDYDTKPIELPRLLGKIETLLA 120

Query: 122 E 122
           +
Sbjct: 121 Q 121


>gi|294775421|ref|ZP_06740936.1| PAS domain S-box [Bacteroides vulgatus PC510]
 gi|294450741|gb|EFG19226.1| PAS domain S-box [Bacteroides vulgatus PC510]
          Length = 781

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  +NG +A+   ++H+PD+I+MDI++  + GL
Sbjct: 666 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKNGEDAVNQFKEHQPDLILMDIKMPHMDGL 724

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+ +++KP+S +   + + KY+
Sbjct: 725 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDFLTKPVSQNALEKVLDKYV 780


>gi|220903475|ref|YP_002478787.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219867774|gb|ACL48109.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 666

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 72/119 (60%), Gaps = 4/119 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDV--IIMDIQLQEISG 61
           +V++ ED ++N ++   L+   G       NG EALE  R H  D+  I+MD+Q+  + G
Sbjct: 538 RVLMAEDGDINREIMEVLLSGMGVQCTAVSNGQEALEAWRAHAGDIDLILMDVQMPVMDG 597

Query: 62  LEITKQIKEDS--ELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
              T++I+ DS  E   +P++A+TA+AM+GD ER  + G  A+++KP+ +   M T+K+
Sbjct: 598 YTATREIRADSRPEAATVPIVAMTAYAMRGDAERSLQAGMNAHLTKPVDVRELMLTLKR 656


>gi|150006477|ref|YP_001301221.1| two-component system sensor histidine kinase [Bacteroides vulgatus
           ATCC 8482]
 gi|149934901|gb|ABR41599.1| two-component system sensor histidine kinase [Bacteroides vulgatus
           ATCC 8482]
          Length = 781

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  +NG +A+   ++H+PD+I+MDI++  + GL
Sbjct: 666 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKNGEDAVNQFKEHQPDLILMDIKMPHMDGL 724

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+ +++KP+S +   + + KY+
Sbjct: 725 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDFLTKPVSQNALEKVLDKYV 780


>gi|327484945|gb|AEA79352.1| BarA sensory histidine kinase [Vibrio cholerae LMA3894-4]
          Length = 916

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 69/115 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 656 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 715

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+  E ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 716 CKAIKQLKEYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 770


>gi|150018828|ref|YP_001311082.1| histidine kinase [Clostridium beijerinckii NCIMB 8052]
 gi|149905293|gb|ABR36126.1| histidine kinase [Clostridium beijerinckii NCIMB 8052]
          Length = 502

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 77/111 (69%), Gaps = 5/111 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQ-TRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+++VED+++N  + + +++  GYI ++   NG+EAL+    ++ D+I+MD+QL E+ G 
Sbjct: 276 KILVVEDDKINQIVIKKVLKELGYINIKIASNGVEALKFIENYRFDLILMDVQLPELDGS 335

Query: 63  EITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
           E  + I+++ E++    IP++A+TA+A+KGD ER    G + YISKPI ++
Sbjct: 336 ETVRIIRKN-EIKTGGHIPIVAMTAYALKGDRERFLSQGMDDYISKPIDIN 385


>gi|319781148|ref|YP_004140624.1| PAS sensor protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167036|gb|ADV10574.1| PAS sensor protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 1545

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 74/121 (61%), Gaps = 2/121 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N  +F  ++  +GY      NG +AL+   +  P +I+MD+ + E++GLE 
Sbjct: 1417 ILVAEDNEVNQMVFTQILGETGYGFEIVGNGRKALDAFGRLNPCMILMDVSMPEMNGLEA 1476

Query: 65   TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T  I+  E+     +P++ VTA A+KGD ER  + G + Y+ KPIS    +E +++++G 
Sbjct: 1477 TAAIRRLEEETGTHVPIVGVTAHALKGDRERCLEAGMDDYLPKPISPRALLEKVERWVGA 1536

Query: 123  A 123
            +
Sbjct: 1537 S 1537



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-----ARQHKPDVIIMDIQLQE 58
            +V+IV+DN +N  +  + + +  + +    +G E L++     A     D +++D Q+ E
Sbjct: 1237 RVLIVDDNAVNRAILTEQMTSWTFDSCAAESGAEGLKVLIAAAAYGVPVDCVVLDYQMPE 1296

Query: 59   ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            +SG E+ + ++  + L   P+I +T+          R  G +A + KP   S+ +ET+
Sbjct: 1297 MSGAEMARIVRNTAGLAGTPIIMLTSVDQSLANTSYRDLGIDAQLIKPARSSVLLETL 1354


>gi|308048557|ref|YP_003912123.1| multi-sensor hybrid histidine kinase [Ferrimonas balearica DSM
           9799]
 gi|307630747|gb|ADN75049.1| multi-sensor hybrid histidine kinase [Ferrimonas balearica DSM
           9799]
          Length = 899

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 67/117 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+ V+DN  N+KL   L+            G  A+EL RQH+ D + MDIQ+ +I GL 
Sbjct: 667 KVLAVDDNPANLKLIATLLRELVAEVDTATGGQSAIELCRQHRYDAVFMDIQMPDIDGLM 726

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+ DS  +  PVIAVTA AM  + E+I   G + Y++KPI  +   + + +++
Sbjct: 727 ATQAIRMDSRSRHSPVIAVTAHAMGDEREKILASGMDDYLTKPIDEADLRQVLMRWV 783


>gi|302791846|ref|XP_002977689.1| sensory histidine protein kinase [Selaginella moellendorffii]
 gi|300154392|gb|EFJ21027.1| sensory histidine protein kinase [Selaginella moellendorffii]
          Length = 823

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 77/120 (64%), Gaps = 5/120 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKP-DVIIMDIQLQEIS 60
           K+V++VEDN +N K+   L++  G++ +   +G+EA+E L   HK  D+++MDIQ+  + 
Sbjct: 689 KRVLLVEDNLVNQKVASRLLQKYGHVVITVTDGLEAVEALKSDHKAYDLVLMDIQMPGMD 748

Query: 61  GLEITKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           GLE T++I++D   S   +IP+I +TA AMKG ++   + G + Y+ KP  +   + TI+
Sbjct: 749 GLEATRRIRKDELGSGWHKIPIIGLTANAMKGYQDICYEAGMDGYLPKPFDIKQVLSTIR 808


>gi|283850550|ref|ZP_06367838.1| histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283574121|gb|EFC22093.1| histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 536

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ ED+E N+   R ++E SG +    +NG E L L R +  DV++MDIQ+  + G+E
Sbjct: 411 RVLLAEDDEENLLYGRRVLEKSGCLLTCAQNGQEVLRLLRLYDFDVVLMDIQMPVMDGVE 470

Query: 64  ITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+       ++IP+IA+TA+AM GD E+    G +AYI+KP+ +      I K +
Sbjct: 471 ATRAIRAGLTDAAKDIPIIAMTAYAMAGDREKFIDAGMDAYIAKPLDMDALKSVINKVL 529


>gi|328951841|ref|YP_004369175.1| multi-sensor hybrid histidine kinase [Desulfobacca acetoxidans DSM
           11109]
 gi|328452165|gb|AEB07994.1| multi-sensor hybrid histidine kinase [Desulfobacca acetoxidans DSM
           11109]
          Length = 1121

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N K+   L+   GY A    NG+EALE  R+   DV++MD+Q+ E+ GLE
Sbjct: 883 KILLAEDNAVNQKVALRLLARLGYRADVVANGLEALEAVRRQSYDVVLMDVQMPEMDGLE 942

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            +++IK     +  P +IA+TA AM+GD E+    G + Y++KPI +   ++ + +
Sbjct: 943 ASRRIKLGEAGRAAPRIIALTADAMQGDREKCLAAGMDDYLTKPIKVEALVDALTR 998



 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 51/87 (58%), Gaps = 3/87 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K+++ V+DN+ N ++     ++ G +   +R+  EAL   ++  P D+ I+D+Q+ +++G
Sbjct: 740 KRLLAVDDNDTNRRILVLQSQSWGMLVRDSRSPQEALGWIKRGDPFDLAILDMQMPDMNG 799

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMK 88
           L + ++I+  +    +P++  ++   +
Sbjct: 800 LMLGREIR--AHRPNLPLVLYSSLGCR 824


>gi|239909171|ref|YP_002955913.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239799038|dbj|BAH78027.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 840

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED+ +N    R  +E  G+  L    G+EAL++  +   DV++MD+ + E+ G+  
Sbjct: 716 VLLVEDDAINRLAARQYLEKQGFAVLTATTGLEALDILAREAVDVVLMDVHMPELDGVAA 775

Query: 65  TKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
           T++I+   E + L  +P++A+TA+AM GD+E+    G + YI KP+ L+
Sbjct: 776 TRRIRTAPEFARLSGLPIVAMTAYAMAGDKEKFLAAGMDGYIEKPLDLA 824


>gi|120553190|ref|YP_957541.1| response regulator receiver protein [Marinobacter aquaeolei VT8]
 gi|120323039|gb|ABM17354.1| response regulator receiver protein [Marinobacter aquaeolei VT8]
          Length = 128

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ--HKPDVIIMDIQLQE 58
           M   V++VED+  +++L   L+E  GY   +  +G + L++AR+   + D+I+ DIQ+  
Sbjct: 1   MKATVLLVEDDMASLELAAYLLEHQGYRIHRAEDGRQGLDIARRLVDQLDLILSDIQMPN 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G E+ ++++ +  +  IPV+A+TAF+M+GDE+ I   G + YISKPI    F   + +
Sbjct: 61  MDGYELLRELRGNPAMAGIPVVAITAFSMRGDEQAILNAGFDGYISKPIDPERFTTQVGQ 120

Query: 119 YI 120
           ++
Sbjct: 121 WL 122


>gi|13473203|ref|NP_104770.1| hybrid sensory histidine kinase [Mesorhizobium loti MAFF303099]
 gi|14023951|dbj|BAB50556.1| Hybrid sensory histidine kinase [Mesorhizobium loti MAFF303099]
          Length = 1391

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N  +F  ++  +GY      NG +AL+   +  P +I+MD+ + E+SGLE 
Sbjct: 1263 ILVAEDNEVNQMVFTQILGETGYGFEIVGNGRKALDAFGKLNPCMILMDVSMPEMSGLEA 1322

Query: 65   TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T  I+  E      +P++ VTA A+KGD ER  + G + Y+ KPIS    +E +++++G
Sbjct: 1323 TAAIRQLEQQTGTHVPIVGVTAHALKGDRERCLEAGMDDYLPKPISPRALLEKVERWLG 1381



 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-----ARQHKPDVIIMDIQLQE 58
            +V+IV+DN +N  +  + + +  + +    +G E L++     A     D +++D Q+ E
Sbjct: 1084 RVLIVDDNAVNRAILTEQMTSWTFDSCAAESGAEGLKVLIAAAAYGVPVDCVVLDYQMPE 1143

Query: 59   ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            +SG E+ + ++    L + P+I +T+          R  G +A + KP   S+ +ET+
Sbjct: 1144 MSGAEMARIVRNTGGLADTPIIMLTSVDQSLANTSYRDLGIDAQLIKPARSSVLLETL 1201


>gi|157376000|ref|YP_001474600.1| Signal transduction histidine kinase-like protein [Shewanella
            sediminis HAW-EB3]
 gi|157318374|gb|ABV37472.1| Signal transduction histidine kinase-like protein [Shewanella
            sediminis HAW-EB3]
          Length = 2213

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN++N ++  +L+E +G +     +G EA E  +    DVI+MDIQ+  + G   
Sbjct: 1877 VLLVEDNDINQQVATELLEMAGLVVTTASDGQEACERVKTELFDVILMDIQMPVMDGYTA 1936

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I++ S  +E+PVIA+TA AM GD E+    G   +I+KPI  +     + K++
Sbjct: 1937 TRHIRKFSGYEELPVIAMTANAMDGDREKCLDAGMNDHIAKPIDPASMFAALVKWV 1992


>gi|297621363|ref|YP_003709500.1| putative two-component response regulator [Waddlia chondrophila WSU
           86-1044]
 gi|297376664|gb|ADI38494.1| putative two-component response regulator [Waddlia chondrophila WSU
           86-1044]
          Length = 135

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++I ED  +N ++ + ++E   +      NG EALE+   +  D I+MD+Q+ E+ G 
Sbjct: 15  KKILIAEDYFINQEVTQAILELMEFTVDIAENGREALEMYESNAYDAILMDVQMPEMDGF 74

Query: 63  EITKQI-KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + T +I K++   + IP+IA+TA AM GD E+    G + Y+SKPI  S   E +KKYI
Sbjct: 75  QTTAEIRKKEKNGKRIPIIALTANAMSGDREKCLNAGMDDYLSKPIEASKLEEILKKYI 133


>gi|123441097|ref|YP_001005086.1| hybrid sensory histidine kinase BarA [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088058|emb|CAL10846.1| two-component regulatory protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 944

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 76/120 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 669 KVMAVDDNPANLKLMGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            ++ I + S  Q+ P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + +Y+ ++
Sbjct: 729 ASEVIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQALSRYLPDS 788


>gi|126172786|ref|YP_001048935.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
 gi|125995991|gb|ABN60066.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS155]
          Length = 1238

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL+       D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVLAGNGQVALDTIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E     ++P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADDLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1229



 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSTLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMIPEMDGSD 1027

Query: 64   ITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  L + PV I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VVSAIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|332532631|ref|ZP_08408507.1| sensory histidine kinase BarA [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037847|gb|EGI74296.1| sensory histidine kinase BarA [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 924

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 67/104 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+DN+ N+KL   L+     +     NG +A  L++ HK D+I MDIQ+  + G+ 
Sbjct: 672 KVLVVDDNDANLKLLHTLLSEQIEVIETAHNGSQAYSLSKSHKYDIIFMDIQMPIMDGIT 731

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             K I+E S  ++ P+IAVTA A++ ++E++ K G + Y++KPI
Sbjct: 732 ACKLIQESSLNEDTPIIAVTAHALQSEKEQLLKDGFKGYLTKPI 775


>gi|256830393|ref|YP_003159121.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579569|gb|ACU90705.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 902

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 75/121 (61%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VED+  N    + L+E +G+  +   NG +AL+L   +  D I+MD+Q+  +SG+E
Sbjct: 762 RVLLVEDDPSNRIPTQKLLEKAGHTVILAENGRQALDLLEANDIDCILMDVQMPVMSGVE 821

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+  + L   ++IP+IA+TA+AM GD+E     G   Y++KP +L    + ++K +
Sbjct: 822 ATRIIRGSTTLGAKRDIPIIALTAYAMAGDKEAFLAAGMNGYVAKPATLEEMTQAMRKAM 881

Query: 121 G 121
           G
Sbjct: 882 G 882


>gi|312890095|ref|ZP_07749639.1| integral membrane sensor hybrid histidine kinase [Mucilaginibacter
           paludis DSM 18603]
 gi|311297627|gb|EFQ74752.1| integral membrane sensor hybrid histidine kinase [Mucilaginibacter
           paludis DSM 18603]
          Length = 936

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 70/115 (60%), Gaps = 1/115 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N KL   ++   GY A   +NG+E + L   HK DVI+MDIQ+  + GLE
Sbjct: 807 NILVAEDNLINQKLILRILSKLGYEATVAQNGLEVIALTELHKFDVILMDIQMPMMDGLE 866

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T QI   S++++  +IA+TA AM  D+E   K G + Y+SKPI L  F+  + K
Sbjct: 867 AT-QIIRSSKIEQPFIIAMTANAMPEDKEDCLKAGMDDYLSKPIHLESFLTALSK 920



 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++V+DN+ N K+ +  +E    + L   +  EAL L  +H+ D+++ D+Q+ ++ G+
Sbjct: 666 KVILVVDDNQTNRKILQVQLEQWKLVPLMAASASEALTLLAKHRIDLVLTDMQMPDMDGI 725

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGC-EAYISKPI 107
           +    IK  +   ++PV+ +++   +GDE + +  G   A ++KP+
Sbjct: 726 DFAAIIKNKNA--KMPVVLLSS---RGDEAKTKYPGLFTAVLNKPV 766


>gi|332702456|ref|ZP_08422544.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
 gi|332552605|gb|EGJ49649.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
          Length = 1066

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDNE+N  + RD ++  G++ +   NG +A++L  Q + D++ MD Q+ E+ G+E
Sbjct: 939  RILVAEDNEINQLVMRDWLDEMGHMVICVPNGRKAIDLLSQGRFDLVFMDAQMPEMDGIE 998

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T+ I+          IP++A+TA+A+KGD ER    G + Y+SKP+  
Sbjct: 999  ATRIIRRSPPQGVDPAIPIVALTAYALKGDRERFLAAGMDDYLSKPLDF 1047


>gi|304410894|ref|ZP_07392511.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|307304935|ref|ZP_07584685.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
 gi|304350791|gb|EFM15192.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS183]
 gi|306912337|gb|EFN42761.1| multi-sensor hybrid histidine kinase [Shewanella baltica BA175]
          Length = 1238

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL+       D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVLAGNGQVALDTIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E     ++P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADDLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1229



 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSTLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMMPEMDGSD 1027

Query: 64   ITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  L + PV I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VVSAIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|256828552|ref|YP_003157280.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577728|gb|ACU88864.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 869

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ ED+E+     R L+E +GY     RNG EAL+L   H  D ++MDIQ+  + G+E
Sbjct: 742 RVLLAEDDEVTQFAVRKLLEKAGYTVSIARNGEEALDLLGAHDFDAVLMDIQMPVMGGIE 801

Query: 64  ITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T+ I+  +  +    IP+IA+TA+AM GD E+    G   YI+KP+ +
Sbjct: 802 ATRLIRSSATPEAKRSIPIIALTAYAMAGDREKFLDAGMNDYIAKPVQV 850


>gi|303323473|ref|XP_003071728.1| histidine kinase J7, putative [Coccidioides posadasii C735 delta
            SOWgp]
 gi|240111430|gb|EER29583.1| histidine kinase J7, putative [Coccidioides posadasii C735 delta
            SOWgp]
 gi|320035142|gb|EFW17084.1| signal transduction histidine-protein kinase barA [Coccidioides
            posadasii str. Silveira]
          Length = 1285

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N K+   ++E   +      NG+ A+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 1105 ILLAEDNDVNQKVAVKILEKCNHGVTVVSNGLAAVEAVKQHRYDVILMDVQMPIMGGFEA 1164

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ LQ  P+IA+TA AM GD E+  +   + Y++KP+  +  M+TI K
Sbjct: 1165 TGKIREWEKENGLQRTPIIALTAHAMLGDREKCLQAQMDEYLAKPLKQNQMMQTILK 1221


>gi|160877018|ref|YP_001556334.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|160862540|gb|ABX51074.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS195]
 gi|315269221|gb|ADT96074.1| multi-sensor hybrid histidine kinase [Shewanella baltica OS678]
          Length = 1238

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL+       D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVLAGNGQVALDTIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E     ++P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADDLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNHWI 1229



 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSSLMRDFHFEVDTAASGAEALYKLSRAPIDLLLLDWMMPEMDGSD 1027

Query: 64   ITKQIK---EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  L + PV I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VVSAIDTMVAEGRLAKRPVIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|317029553|ref|XP_001391885.2| histidine kinase J7 [Aspergillus niger CBS 513.88]
          Length = 1308

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1111 ILLAEDNDVNQKLAVKILEKHNHNVSVVSNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1170

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   +S L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1171 TGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1227


>gi|83313114|ref|YP_423378.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82947955|dbj|BAE52819.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 658

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 68/113 (60%), Gaps = 1/113 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN +N K+    +  +G+      NG EAL LAR    DV++MD+Q+  + GLE 
Sbjct: 411 VLVAEDNPINQKVALGFLTQAGHRVTVAANGAEALALARDGGFDVVLMDMQMPVMDGLEA 470

Query: 65  TKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             +I+   +   ++PVIA+TA AM+GD ER R+ G  A+++KP+  +I    I
Sbjct: 471 VSRIRALPAPAGDVPVIALTANAMRGDAERCREAGMNAHVAKPVDPAILFRVI 523


>gi|300864702|ref|ZP_07109558.1| hypothetical protein OSCI_1020012 [Oscillatoria sp. PCC 6506]
 gi|300337308|emb|CBN54706.1| hypothetical protein OSCI_1020012 [Oscillatoria sp. PCC 6506]
          Length = 143

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 70/116 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+D+  N++L   +++  G   L T +G   L + R   PD+I++DI+L +I G+E+
Sbjct: 27  VLAVDDDLDNLELMSQILDLFGCSCLGTVDGKTTLAIIRDRLPDLILLDIRLPDIDGIEL 86

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             QIK+D +L  IP+IAVT+ A   D +RI   G   YI KP +L     TI++++
Sbjct: 87  ISQIKQDPKLVNIPIIAVTSLARPEDRKRILLAGFTDYICKPFNLDNLEITIRRHL 142


>gi|150005262|ref|YP_001300006.1| two-component hybrid sensor kinase/response regulator [Bacteroides
            vulgatus ATCC 8482]
 gi|149933686|gb|ABR40384.1| two-component system sensor histidine kinase, with response regulator
            receiver domain [Bacteroides vulgatus ATCC 8482]
          Length = 1045

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILIAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHTPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R  + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRAMENGFDGYMAKPIS 1026


>gi|160887321|ref|ZP_02068324.1| hypothetical protein BACOVA_05339 [Bacteroides ovatus ATCC 8483]
 gi|156107732|gb|EDO09477.1| hypothetical protein BACOVA_05339 [Bacteroides ovatus ATCC 8483]
          Length = 657

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L+    YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 542 KKILVVEDIESNFAQLNILLNKE-YIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 600

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 601 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 657


>gi|119188929|ref|XP_001245071.1| hypothetical protein CIMG_04512 [Coccidioides immitis RS]
          Length = 1284

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N K+   ++E   +      NG+ A+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 1101 ILLAEDNDVNQKVAVKILEKCNHGVTVVSNGLAAVEAVKQHRYDVILMDVQMPIMGGFEA 1160

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ LQ  P+IA+TA AM GD E+  +   + Y++KP+  +  M+TI K
Sbjct: 1161 TGKIREWEKENGLQRTPIIALTAHAMLGDREKCLQAQMDEYLAKPLKQNQMMQTILK 1217


>gi|294777096|ref|ZP_06742553.1| sensor histidine kinase/response regulator [Bacteroides vulgatus
            PC510]
 gi|319643455|ref|ZP_07998078.1| sensor protein [Bacteroides sp. 3_1_40A]
 gi|294448965|gb|EFG17508.1| sensor histidine kinase/response regulator [Bacteroides vulgatus
            PC510]
 gi|317384860|gb|EFV65816.1| sensor protein [Bacteroides sp. 3_1_40A]
          Length = 1045

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILIAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHTPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R  + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRAMENGFDGYMAKPIS 1026


>gi|254883730|ref|ZP_05256440.1| two-component system sensor histidine kinase [Bacteroides sp.
            4_3_47FAA]
 gi|254836523|gb|EET16832.1| two-component system sensor histidine kinase [Bacteroides sp.
            4_3_47FAA]
          Length = 1045

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF+ +++   Y  +   +G EA+ L + H P +I+MDI +  + G E 
Sbjct: 926  ILIAEDNESNYRLFQSILKRE-YNLVHAWDGKEAVNLYKLHTPQIILMDINMPVMDGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R  + G + Y++KPIS
Sbjct: 985  TREIRKLS--LDVPIIAVTAFAYASDEQRAMENGFDGYMAKPIS 1026


>gi|323700304|ref|ZP_08112216.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio sp. ND132]
 gi|323460236|gb|EGB16101.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio desulfuricans
            ND132]
          Length = 1049

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 71/121 (58%), Gaps = 7/121 (5%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ ED  +N  + + L+E  G+  +   NG E LE  R    DVI+MDIQ+  + G+E 
Sbjct: 926  ILLAEDERVNSLVMKRLLEKGGHTVVAVENGAEVLETLRTASFDVILMDIQMPVMDGVET 985

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + I+     ++L +IP++AVTA+AM GD E+  K G + Y+ KPI     ME +++ + 
Sbjct: 986  ARAIRAGRVGADLTDIPIVAVTAYAMVGDREKFLKAGMDGYVVKPIE----MEKLEQALA 1041

Query: 122  E 122
            E
Sbjct: 1042 E 1042


>gi|224539516|ref|ZP_03680055.1| hypothetical protein BACCELL_04421 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518864|gb|EEF87969.1| hypothetical protein BACCELL_04421 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 997

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+I EDNE N  LF  +++   Y  L   +G EA+EL +Q+ P +I+MDI + + +G E 
Sbjct: 878 VLIAEDNESNFLLFESILKRQ-YNILHAWDGEEAVELFKQYNPHLILMDINMPKKTGYEA 936

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           T+ I+E S    +P++AVTA+    DEERI   G +AY SKPI+
Sbjct: 937 TQLIREMSP--TVPIMAVTAYVYAEDEERILNSGFDAYTSKPIN 978


>gi|253699401|ref|YP_003020590.1| response regulator receiver protein [Geobacter sp. M21]
 gi|251774251|gb|ACT16832.1| response regulator receiver protein [Geobacter sp. M21]
          Length = 132

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 67/118 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED E  +KL   L  + GY     R G++AL    Q +PD++++DI L ++ G E
Sbjct: 5   RILVVEDEESLLKLESILFTSKGYQVTGVRGGIDALRSISQERPDLVVLDIMLPDMDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + + IKED E + IPV+ +TA     D E  R  G +AYI+KP      +E I   +G
Sbjct: 65  VCRSIKEDPETRSIPVVMLTAKKSSRDLEAGRVAGADAYITKPFKSVKVLEVIGGLLG 122


>gi|332524127|ref|ZP_08400357.1| signal transduction histidine kinase-like protein [Rubrivivax
            benzoatilyticus JA2]
 gi|332107466|gb|EGJ08690.1| signal transduction histidine kinase-like protein [Rubrivivax
            benzoatilyticus JA2]
          Length = 1062

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRN-GMEALELARQHKPDVIIMDIQLQEISG 61
            ++V  +EDNE N+++ R ++     I L+    G++ L   RQH+P +I++D+ L +ISG
Sbjct: 935  RRVHYIEDNETNVEVMRGVLAQRPQIVLEVSTMGLDGLAAVRQHRPHLILLDMHLPDISG 994

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            LE+ + +K+D ++ +IPVI V+A A     +     G   Y++KP+ +  F+ T+ +
Sbjct: 995  LELLRHLKQDRDVADIPVIVVSADATTARMQEALTLGAAQYVTKPLDVRRFLRTVDE 1051


>gi|313498283|gb|ADR59649.1| Multi-sensor hybrid histidine kinase [Pseudomonas putida BIRD-1]
          Length = 1149

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 1025 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 1084

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1085 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1143



 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E  ELA Q+ PD I++D++L + SGL +
Sbjct: 759 ILVIEDEPNFARILFDLAHELGYSCLVAHGADEGFELAAQYIPDAILLDMRLPDHSGLTV 818

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 819 LQRLKEQASTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 859



 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK +++VED++L  +    LI              +AL L RQ+  D +I+D++L ++ G
Sbjct: 878 LKHILLVEDDDLQRESIARLIGDDDVEITAVAMAQDALALLRQNIYDCMIIDLKLPDMLG 937

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   +  +EE
Sbjct: 938 NELLKRMTAEDIRAFPPVIVYTGRNLTREEE 968


>gi|134076372|emb|CAK39626.1| unnamed protein product [Aspergillus niger]
          Length = 1306

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1102 ILLAEDNDVNQKLAVKILEKHNHNVSVVSNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1161

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   +S L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1162 TGKIREYERESGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1218


>gi|26990466|ref|NP_745891.1| multi-sensor hybrid histidine kinase [Pseudomonas putida KT2440]
 gi|24985438|gb|AAN69355.1|AE016572_11 sensor histidine kinase/response regulator [Pseudomonas putida
            KT2440]
          Length = 1155

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 1031 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 1090

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1091 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1149



 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E  ELA Q+ PD I++D++L + SGL +
Sbjct: 765 ILVIEDEPNFARILFDLAHELGYSCLVAHGADEGFELAAQYIPDAILLDMRLPDHSGLTV 824

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 825 LQRLKEQASTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 865



 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK +++VED++L  +    LI              +AL L RQ+  D +I+D++L ++ G
Sbjct: 884 LKHILLVEDDDLQRESIARLIGDDDVEITAVAMAQDALALLRQNIYDCMIIDLKLPDMLG 943

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   +  +EE
Sbjct: 944 NELLKRMTAEDIRAFPPVIVYTGRNLTREEE 974


>gi|253699365|ref|YP_003020554.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M21]
 gi|251774215|gb|ACT16796.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M21]
          Length = 240

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 68/116 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+M+V+D  L ++L +  ++ S    +   NG EALEL R+  PD+I MD+ +  + G+ 
Sbjct: 5   KIMLVDDTRLILELEKSFLKLSHVDVVTAGNGAEALELIRKDPPDLIFMDMHMPVMDGIA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              ++K D  L  IPV+ +T    + D ER +  GC+ +++KP+   +F++  +KY
Sbjct: 65  CCAELKADPFLCGIPVVMLTTAGKEEDRERAKAAGCDNFLTKPVDRRLFLDLARKY 120


>gi|148547224|ref|YP_001267326.1| multi-sensor hybrid histidine kinase [Pseudomonas putida F1]
 gi|148511282|gb|ABQ78142.1| multi-sensor hybrid histidine kinase [Pseudomonas putida F1]
          Length = 1155

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 1031 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 1090

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1091 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1149



 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E  ELA Q+ PD I++D++L + SGL +
Sbjct: 765 ILVIEDEPNFARILFDLAHELGYSCLVAHGADEGFELAAQYIPDAILLDMRLPDHSGLTV 824

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 825 LQRLKEQASTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 865



 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK +++VED++L  +    LI              +AL L RQ+  D +I+D++L ++ G
Sbjct: 884 LKHILLVEDDDLQRESIARLIGDDDVEITAVAMAQDALALLRQNIYDCMIIDLKLPDMLG 943

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   +  +EE
Sbjct: 944 NELLKRMTAEDIRAFPPVIVYTGRNLTREEE 974


>gi|170721287|ref|YP_001748975.1| multi-sensor hybrid histidine kinase [Pseudomonas putida W619]
 gi|169759290|gb|ACA72606.1| multi-sensor hybrid histidine kinase [Pseudomonas putida W619]
          Length = 1155

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 1031 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 1090

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1091 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1149



 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L  +   E   LA Q+ PD I++D++L + SGL +
Sbjct: 765 ILVIEDEPNFARILFDLAHELGYSCLVAQGADEGFALAAQYIPDAILLDMRLPDHSGLTV 824

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 825 LQRLKELAATRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 865


>gi|238756866|ref|ZP_04618054.1| PAS/PAC domain [Yersinia aldovae ATCC 35236]
 gi|238704696|gb|EEP97225.1| PAS/PAC domain [Yersinia aldovae ATCC 35236]
          Length = 1334

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP--DVIIMDIQLQEISG 61
            +++IVEDN  N ++ R+L+E  G       NG EA+E+  +     DV++MD+Q+  + G
Sbjct: 985  QLLIVEDNLNNQQIARELLEDEGATVTIANNGKEAIEILERTPALFDVVLMDLQMPVMDG 1044

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
               T+ I+E   L+E+P+IA+TA AM  D +     G   +I KP  L+  ++TI+KY G
Sbjct: 1045 FNATRYIRESLGLKELPIIAMTANAMASDRDACLAAGMNDHIGKPFDLNNLIQTIRKYSG 1104


>gi|260171368|ref|ZP_05757780.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
 gi|315919679|ref|ZP_07915919.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
 gi|313693554|gb|EFS30389.1| two-component system sensor histidine kinase [Bacteroides sp. D2]
          Length = 637

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L+    YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 522 KKILVVEDIESNFAQLNILLNKE-YIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 580

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 581 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 637


>gi|167033148|ref|YP_001668379.1| multi-sensor hybrid histidine kinase [Pseudomonas putida GB-1]
 gi|166859636|gb|ABY98043.1| multi-sensor hybrid histidine kinase [Pseudomonas putida GB-1]
          Length = 1149

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 1025 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 1084

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1085 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1143



 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L  +   E  ELA Q+ PD I++D++L + SGL +
Sbjct: 759 ILVIEDEPNFARILFDLAHELGYSCLVAQGADEGFELAAQYIPDAILLDMRLPDHSGLTV 818

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 819 LQRLKEQAGTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 859


>gi|163847333|ref|YP_001635377.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222525179|ref|YP_002569650.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
 gi|163668622|gb|ABY34988.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222449058|gb|ACM53324.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
          Length = 124

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (59%), Gaps = 4/122 (3%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IVED+  N  L   ++E  G+  +   +G + + LAR  +PD+IIMD+ L  ++G
Sbjct: 1   MAKILIVEDDSNNRDLIARIVELMGHQPILAIDGAQGVALARSEQPDLIIMDMGLPVLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRK--GGCEAYISKPISLSIFMETIKKY 119
            + T +IK     + IPV+A+TA+AM  +E+RIR    GC+ + +KPI  + F E +   
Sbjct: 61  WQATHRIKSQPATRHIPVLALTAYAM--NEDRIRSLVAGCDDFETKPIDFNRFREKVDAL 118

Query: 120 IG 121
           + 
Sbjct: 119 LA 120


>gi|149177491|ref|ZP_01856094.1| sensory box histidine kinase/response regulator [Planctomyces maris
            DSM 8797]
 gi|148843641|gb|EDL58001.1| sensory box histidine kinase/response regulator [Planctomyces maris
            DSM 8797]
          Length = 1362

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 2/117 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++ ED+ +N KL   L++  G+      NG +A+   +  + D+I+MD+Q+ E+ GLE
Sbjct: 1082 KILLAEDSLVNQKLALALLKPQGHEIAVVLNGSDAVNERKNREFDLILMDVQMPEMDGLE 1141

Query: 64   ITKQIKE-DSELQE-IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T+QI+E + E  E +P+IA+TA AMKGD ER  + G + Y+SKP+ +     TI++
Sbjct: 1142 ATRQIREYEQETGEHVPIIAMTAHAMKGDRERCLEAGMDGYVSKPVRVRELFSTIEE 1198



 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 69/126 (54%), Gaps = 11/126 (8%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRN---GMEALELAR-----QHKPDVIIMDIQ 55
            +V+IV+DN  N ++  +++   G   +QT++   G +AL++       +H  D++++D  
Sbjct: 936  RVLIVDDNLTNCQILEEML---GSWNMQTQSINRGSDALDVMHASQQSKHPFDLVLVDAN 992

Query: 56   LQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            +  + G  + K IK+DS L    ++ +T+   +G+  R ++ G  A++ KP+  S    +
Sbjct: 993  MPVMDGFSVAKAIKQDSTLGSAVIMMITSSDRQGEISRCKELGIAAHLIKPLKQSELFNS 1052

Query: 116  IKKYIG 121
            I + +G
Sbjct: 1053 IAETLG 1058


>gi|167753652|ref|ZP_02425779.1| hypothetical protein ALIPUT_01932 [Alistipes putredinis DSM 17216]
 gi|167658277|gb|EDS02407.1| hypothetical protein ALIPUT_01932 [Alistipes putredinis DSM 17216]
          Length = 1057

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ ED + N  L   LI   GY  L+  NG EA+ + R+  PDV++MD+++  + GLE 
Sbjct: 943  VLVAEDTDSNF-LLVSLILKKGYEVLRAHNGAEAVRMCREFAPDVVLMDMKMPVMDGLEA 1001

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T+QI+E      +P+IAVTA+A   D  +    GC+ YI+KP++
Sbjct: 1002 TRQIREAG--SSVPIIAVTAYAYDSDRAKALDVGCDDYIAKPLT 1043


>gi|224535688|ref|ZP_03676227.1| hypothetical protein BACCELL_00552 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522698|gb|EEF91803.1| hypothetical protein BACCELL_00552 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 980

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 73/121 (60%), Gaps = 7/121 (5%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF D I    Y  +   NG EA+EL ++ +P VIIMDI + ++ G E 
Sbjct: 861 ILIAEDNENNYLLF-DSILNKEYNLIHAWNGEEAIELYQKFQPHVIIMDINMPKMDGYEA 919

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME----TIKKYI 120
            ++I++ S  + IP+IAVTA++   D+E++ + G   Y+ KP+ + I  E    TIK+ I
Sbjct: 920 AREIRKFS--KTIPIIAVTAYSFSSDKEKVLENGFNGYVPKPVDVHILKEKLHSTIKQNI 977

Query: 121 G 121
            
Sbjct: 978 A 978


>gi|119471909|ref|ZP_01614217.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Alteromonadales bacterium TW-7]
 gi|119445282|gb|EAW26572.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Alteromonadales bacterium TW-7]
          Length = 928

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+DN+ N+KL   L++    +     NG +A  L++ HK DVI MDIQ+  + G+ 
Sbjct: 672 KVLVVDDNDANLKLICTLLDEQVEVIDTAHNGSQAYSLSKSHKYDVIFMDIQMPIMDGIT 731

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             K I+E S  ++ P+IAVTA A+  ++E++ K G + Y++KPI
Sbjct: 732 ACKLIQESSLNEDTPIIAVTAHALHSEKEQLLKDGFKGYLTKPI 775


>gi|262171619|ref|ZP_06039297.1| hypothetical protein VII_002442 [Vibrio mimicus MB-451]
 gi|261892695|gb|EEY38681.1| hypothetical protein VII_002442 [Vibrio mimicus MB-451]
          Length = 1325

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 72/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++VEDNE+N ++   L+E +G       NG EALE       D+++MD+Q+  + G+
Sbjct: 992  QKLLLVEDNEVNQEVALGLLEETGLSVTIANNGQEALEKLENADFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK I+ +   + +P++A+TA AM  D ER  + G   ++SKPI +  F + +K+++
Sbjct: 1052 TATKHIRTNGRWKNLPIVAMTANAMAADIERCLQVGMNGHLSKPIEVDKFYQVLKQFL 1109



 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKP-DVIIMDIQLQEIS 60
           K+V++V+DN+    +   L+    +  +   NG EAL EL  QHKP D++  D  +  ++
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEL--QHKPFDMLFADWNMPGMN 909

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+  ++K            VTA+    + +       +A I KP++ S  ++ I    
Sbjct: 910 GIELLTRVKSLGLRDHTKCFLVTAYGRDINLDSENSKLIDALIVKPVNPSNLLDAIVTSY 969

Query: 121 G 121
           G
Sbjct: 970 G 970


>gi|258627567|ref|ZP_05722344.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
            VM603]
 gi|258580149|gb|EEW05121.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
            VM603]
          Length = 1325

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 72/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++VEDNE+N ++   L+E +G       NG EALE       D+++MD+Q+  + G+
Sbjct: 992  QKLLLVEDNEVNQEVALGLLEETGLSVTIANNGQEALEKLENADFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK I+ +   + +P++A+TA AM  D ER  + G   ++SKPI +  F + +K+++
Sbjct: 1052 TATKHIRTNGRWKNLPIVAMTANAMAADIERCLQVGMNGHLSKPIEVDKFYQVLKQFL 1109



 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKP-DVIIMDIQLQEIS 60
           K+V++V+DN+    +   L+    +  +   NG EAL EL  QHKP D++  D  +  ++
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEL--QHKPFDMLFADWNMPGMN 909

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+  ++K            VTA+    + +       +A I KP++ S  ++ I    
Sbjct: 910 GIELLTRVKSLGLRDHTKCFLVTAYGRDINLDSENSKLIDALIVKPVNPSNLLDAIVTSY 969

Query: 121 G 121
           G
Sbjct: 970 G 970


>gi|258621553|ref|ZP_05716586.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
            VM573]
 gi|258586171|gb|EEW10887.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
            VM573]
          Length = 1325

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 72/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++VEDNE+N ++   L+E +G       NG EALE       D+++MD+Q+  + G+
Sbjct: 992  QKLLLVEDNEVNQEVALGLLEETGLSVTIANNGQEALEKLENADFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK I+ +   + +P++A+TA AM  D ER  + G   ++SKPI +  F + +K+++
Sbjct: 1052 TATKHIRTNGRWKNLPIVAMTANAMAADIERCLQVGMNGHLSKPIEVDKFYQVLKQFL 1109



 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKP-DVIIMDIQLQEIS 60
           K+V++V+DN+    +   L+    +  +   NG EAL EL  QHKP D++  D  +  ++
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEL--QHKPFDMLFADWNMPGMN 909

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+  ++K            VTA+    + +       +A I KP++ S  ++ I    
Sbjct: 910 GIELLTRVKSLGLRDHTKCFLVTAYGRDINLDSENSKLIDALIVKPVNPSNLLDAIVTSY 969

Query: 121 G 121
           G
Sbjct: 970 G 970


>gi|75909218|ref|YP_323514.1| histidine kinase [Anabaena variabilis ATCC 29413]
 gi|75702943|gb|ABA22619.1| histidine kinase [Anabaena variabilis ATCC 29413]
          Length = 603

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 67/117 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++VED+  N +L +  +   GY     +N  E      Q +  VI+MDI+L +  GL
Sbjct: 484 KDILLVEDDLPNGELMQTHLSKLGYNVTWVKNAHEMWAKLDQQQAAVILMDIRLPDGDGL 543

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           ++ KQ++E S+ Q+IP+IA TA AMKGD       G   YISKPI L++    + KY
Sbjct: 544 DLVKQLREKSQYQQIPIIAQTAMAMKGDRSICLSAGVNDYISKPIDLNLLASLVAKY 600


>gi|34557362|ref|NP_907177.1| two-component hybrid protein [Wolinella succinogenes DSM 1740]
 gi|34483078|emb|CAE10077.1| TWO-COMPONENT HYBRID PROTEIN [Wolinella succinogenes]
          Length = 401

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 78/120 (65%), Gaps = 6/120 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++I++D   N++L   +++ +GY+    ++G++ L+ AR+H+PD+I++DI++ E+ G E
Sbjct: 11  EILIIDDTPENLRLLGSVLKEAGYLITMAKSGIQGLQAARKHQPDLILLDIRMPEMDGFE 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKKYI 120
           +  +++E+  L EIPV+ +TA +   DEE I +G   G   Y+ KP S S  +  ++ ++
Sbjct: 71  VLTRLREEENLGEIPVVFLTAHS---DEESILRGLSLGAVDYVKKPFSPSELLLRVRNHL 127


>gi|255731748|ref|XP_002550798.1| hypothetical protein CTRG_05096 [Candida tropicalis MYA-3404]
 gi|240131807|gb|EER31366.1| hypothetical protein CTRG_05096 [Candida tropicalis MYA-3404]
          Length = 1128

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  +++K DV++MD+Q+  + G E
Sbjct: 872 KILLAEDNLVNQKLAVRILEKQGHQIEVVENGLEAYEAIKKNKYDVVLMDVQMPVMGGFE 931

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 932 ATEKIRQWEKKSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 991

Query: 116 IKKYI 120
           I K I
Sbjct: 992 INKCI 996


>gi|325277539|ref|ZP_08143134.1| multi-sensor hybrid histidine kinase [Pseudomonas sp. TJI-51]
 gi|324097320|gb|EGB95571.1| multi-sensor hybrid histidine kinase [Pseudomonas sp. TJI-51]
          Length = 456

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 71/121 (58%), Gaps = 1/121 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           +KV++V+D+  N+      +E  G I    RNG EA+E   QH   D+++MD+ + E+ G
Sbjct: 332 RKVLLVDDDVRNIFALTSALEHKGAIVEIGRNGREAIERLEQHDDIDLVLMDVMMPEMDG 391

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+ I++    +++P+IAVTA AMK D+ R  + G   Y++KPI L      I+ ++ 
Sbjct: 392 FEATRLIRQQPRWRKLPIIAVTAKAMKDDQHRCLQAGANDYLAKPIDLDRLFSLIRVWLP 451

Query: 122 E 122
           +
Sbjct: 452 Q 452



 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E  ELA +  PD I++D++L + SGL +
Sbjct: 66  ILVIEDEPNFARILFDLAHELGYSCLVAHAADEGFELAARFIPDAILLDMRLPDHSGLTV 125

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE ++ + IPV  ++       E+R+      G   Y  KP S
Sbjct: 126 LQRLKEQADTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 166



 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK +++VED++L  +    LI              EAL L R++  D +I+D++L ++ G
Sbjct: 185 LKHILLVEDDDLQRESIARLIGDDDVEITAVGMAQEALALLRENIYDCMIIDLKLPDMLG 244

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   +  +EE
Sbjct: 245 NELLKRMTAEDIRAFPPVIVYTGRNLTREEE 275


>gi|218782281|ref|YP_002433599.1| multi-sensor hybrid histidine kinase [Desulfatibacillum alkenivorans
            AK-01]
 gi|218763665|gb|ACL06131.1| multi-sensor hybrid histidine kinase [Desulfatibacillum alkenivorans
            AK-01]
          Length = 1152

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN++N  + + ++   GY  L   NG EALE   + + D+I+MDIQ+  + GLE 
Sbjct: 906  VLLVEDNQVNQMVAKGILRKLGYKTLVVENGQEALEFLAEKQVDIILMDIQMPVMDGLEA 965

Query: 65   TKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++I++          P+IA+TA AMKGD E+    G + YI+KPI  +     +   +G
Sbjct: 966  TRRIRDGRHKVLDPGAPIIAMTARAMKGDREKCLDAGMDDYITKPIDPAALAAVMASRLG 1025

Query: 122  EA 123
             A
Sbjct: 1026 GA 1027


>gi|327194700|gb|EGE61545.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Rhizobium etli CNPAF512]
          Length = 312

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDNE+N  +F  +++ +G   L   NG +A+     H P +I+MD+ +  ++G E 
Sbjct: 183 VLVAEDNEVNQIVFTQILQGTGLSFLVVNNGEQAVAAWESHTPRIIMMDVSMPVMNGHEA 242

Query: 65  TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T+ I+E  + Q   +P+I VTA A++ D E     G + Y+SKPIS  +  E I++++G+
Sbjct: 243 TRMIREREKGQGHRVPIIGVTAHALESDRELCLDAGMDDYMSKPISPELLEEKIRQWLGK 302



 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           ++++V+DNE+N ++  + +   G+  +    G   L +           D +I+D  + +
Sbjct: 21  RILVVDDNEVNRRILTEQLSLWGFDGVAAEGGGTGLAILEAAADLGVTVDAVILDYHMPD 80

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
           ++G ++ ++++ D    E+P+I +T+  + G E+       +A++ KP   ++   T
Sbjct: 81  MNGADVARRLRADPRFVELPIIFLTSMDISGTEKEFAALNGQAHLMKPARANVLRNT 137


>gi|146421491|ref|XP_001486691.1| hypothetical protein PGUG_00068 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 665

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 73/125 (58%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  ++ K DV++MD+Q+  + G E
Sbjct: 411 KILLAEDNLVNQKLAVRILEKQGHRVEVVENGLEAFEAIQKSKYDVVLMDVQMPVMGGFE 470

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 471 ATEKIRQWEKRSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 530

Query: 116 IKKYI 120
           I K I
Sbjct: 531 ISKCI 535


>gi|261253028|ref|ZP_05945601.1| signal transduction histidine kinase [Vibrio orientalis CIP 102891]
 gi|260936419|gb|EEX92408.1| signal transduction histidine kinase [Vibrio orientalis CIP 102891]
          Length = 769

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 74/121 (61%), Gaps = 2/121 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN  N  + R++ +  G       NG+EALE+A+Q++ D+I MDI + ++ G+ 
Sbjct: 490 RILVAEDNRANQLVIREMFKRVGSQIDIAENGLEALEMAQQYQYDLIFMDISMPKMDGMT 549

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + I+  ED     IP+IA+TA ++ GD+E+    G + Y+SKP+ LS  ++ I  ++ 
Sbjct: 550 ACRAIRALEDEATATIPIIALTAHSLAGDKEKFLASGMDDYLSKPLRLSQLVDKINLFLD 609

Query: 122 E 122
           E
Sbjct: 610 E 610


>gi|239904801|ref|YP_002951539.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
 gi|239794664|dbj|BAH73653.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
          Length = 1027

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 73/120 (60%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED+ +++   + ++E SGY     +NG EAL+   +   D+I+MD+Q+  + G+E
Sbjct: 901  RILVAEDDTISLITAKRMLEKSGYSVSAAKNGQEALQRLTEESFDLILMDVQMPIMDGVE 960

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK I+  S L     +P++A+TA+AM GD+E     G + YISKP+  +   E I++ +
Sbjct: 961  ATKAIRGASNLGAKSSVPIVAMTAYAMTGDKETFLAAGMDDYISKPVDKAALAEVIERVL 1020


>gi|190344318|gb|EDK35970.2| hypothetical protein PGUG_00068 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 665

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 73/125 (58%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  ++ K DV++MD+Q+  + G E
Sbjct: 411 KILLAEDNLVNQKLAVRILEKQGHRVEVVENGLEAFEAIQKSKYDVVLMDVQMPVMGGFE 470

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 471 ATEKIRQWEKRSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 530

Query: 116 IKKYI 120
           I K I
Sbjct: 531 ISKCI 535


>gi|170728644|ref|YP_001762670.1| PAS/PAC sensor-containing hybrid histidine kinase [Shewanella woodyi
            ATCC 51908]
 gi|169813991|gb|ACA88575.1| PAS/PAC sensor hybrid histidine kinase [Shewanella woodyi ATCC 51908]
          Length = 1245

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 74/118 (62%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N ++  +L++++GY      NG  AL++   +  + ++MDIQ+  + GL 
Sbjct: 1123 RILLVEDNFINQQVATELLKSAGYEVDVADNGQIALDMIADNDYEAVLMDIQMPVMDGLT 1182

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             T+++++     E+PVIA+TA AM GD E+    G  A+I+KPI L+   +T+  +I 
Sbjct: 1183 ATRELRKHYNQSELPVIAMTAHAMSGDREKSLDAGMNAHITKPIVLNELFDTLSYWIN 1240



 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K ++V+DN   ++++  +++   +      +G EA+    +   D++++D  + E+ G+ 
Sbjct: 980  KALVVDDNPTALQIYSTIMQDFKFDVDTAASGSEAIYKLGKSSVDLLLLDWMMPEMDGIA 1039

Query: 64   ITKQIKE---DSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIKK 118
            + +++     D  L   P +I +TA+A +  +E   K    A + KP   S +F E I  
Sbjct: 1040 VIEELDRMVADGRLDSRPIIIMMTAYAAEPLKEDADKSNIYAMLQKPFKASALFDEIISA 1099

Query: 119  YI 120
            ++
Sbjct: 1100 FV 1101


>gi|239908782|ref|YP_002955524.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239798649|dbj|BAH77638.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 968

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 73/121 (60%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++ ED+ L+    + ++E SGY     ++G EAL+   +   D+I+MD+Q+  + G+
Sbjct: 841 SRILLAEDDSLSSITCKRMLEKSGYSVTAVKDGQEALQRLTKEDFDLILMDVQMPVMDGV 900

Query: 63  EITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           E TK I+  S L     IP++A+TA+AM GD+E     G + YISKP+  +  +E I++ 
Sbjct: 901 EATKAIRGASNLGAKSSIPIVAMTAYAMTGDKESFLAAGMDDYISKPVDKAALVEVIERV 960

Query: 120 I 120
           I
Sbjct: 961 I 961


>gi|222054841|ref|YP_002537203.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. FRC-32]
 gi|221564130|gb|ACM20102.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. FRC-32]
          Length = 230

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 69/119 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++V+D  + +++ +  ++ S    L  R+G EAL + R  +PDV+ MD+ +  + G
Sbjct: 1   MAKVLLVDDVNMFLEIQKGFLQRSSVTILTARDGAEALAITRAKRPDVVFMDLHMPNMGG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E    IK D+ L+   V+ +T+     DE   RK GC+++++KP+  + ++E  + Y+
Sbjct: 61  AECCTAIKADAALRSTTVVLITSVGKPDDEILCRKAGCDSFLTKPLDRNDYLELARTYL 119


>gi|167629981|ref|YP_001680480.1| signal transduction histidine kinase [Heliobacterium modesticaldum
           Ice1]
 gi|167592721|gb|ABZ84469.1| signal transduction histidine kinase [Heliobacterium modesticaldum
           Ice1]
          Length = 703

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDN +N KL    ++  G   L   NG EA+E  R+ K  +I+MD Q+ E+ G 
Sbjct: 563 KRILLVEDNPVNQKLASIQLKKFGLPLLAVSNGREAVEAVRREKYSLILMDCQMPEMDGF 622

Query: 63  EITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T++I+  E  +   +P++A+TA AM+GD E     G + YISKPI  +     + ++I
Sbjct: 623 EATREIRRIEAEQGGHVPIVAMTARAMRGDREECLACGMDDYISKPIRSADLRRILNRWI 682


>gi|117926505|ref|YP_867122.1| Hpt sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117610261|gb|ABK45716.1| amino acid-binding domain sensor hybrid histidine kinase
            [Magnetococcus sp. MC-1]
          Length = 1251

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 71/117 (60%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN LN ++    +E +G       NG+  +E+A Q   D++ MDIQ+  + GLE
Sbjct: 950  RVLLVEDNALNQQVAVAFLEQAGMEVAVAENGLRCIEMAEQSHYDLVFMDIQMPVMDGLE 1009

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+Q+++ S L ++P+IA+TA AM  + E     G + Y++KP+S     + + ++I
Sbjct: 1010 ATRQLRQRSALAKLPIIAMTAQAMPSERECSMVAGLDDYLTKPVSPEAIQQMLVRWI 1066


>gi|170749964|ref|YP_001756224.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656486|gb|ACB25541.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 126

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 67/121 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED+E         ++  GY  +   +G   +  AR  +PDVI++D+ L  + G
Sbjct: 1   MAKILLVEDHEEIWDFLSRRLKRRGYEVILAHDGEAGVRQARSGQPDVILLDMNLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + +K  ++ + IP+IA+TA AM GD ++  + GC+ Y  KP+  S  +  I   +G
Sbjct: 61  WSVARTLKSGTDTRAIPIIALTAHAMSGDRDKAIQAGCDDYHPKPVDFSKLLSQISAALG 120

Query: 122 E 122
           E
Sbjct: 121 E 121


>gi|119484750|ref|ZP_01619232.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
 gi|119457568|gb|EAW38692.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
          Length = 727

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 69/123 (56%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ------HKPDVIIMDIQLQ 57
           ++++VED   N  L  +++E  GY       G   +++           PDVI+MDIQL 
Sbjct: 603 RILVVEDQPFNQLLVSEILELEGYQVELICEGQTMMDMINSPFVRASMLPDVILMDIQLP 662

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ G E+  Q+K+ S  Q +PV+AVTA AM GD +R  + G  AY+SKP+ +   + T+K
Sbjct: 663 EVDGFELMGQLKKHSIWQSVPVVAVTAMAMAGDRDRCLEAGAIAYLSKPLDVDQVLATVK 722

Query: 118 KYI 120
             +
Sbjct: 723 SLL 725


>gi|258592848|emb|CBE69157.1| putative response regulator in two-component regulatory system
           (CheY-like protein) [NC10 bacterium 'Dutch sediment']
          Length = 124

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 65/112 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED+ L+ +L   ++ET+GY  L   +G+   EL    +PD+IIMD+QL  I G+ +
Sbjct: 7   ILIVEDHALSRELATAILETAGYTVLSAEDGVGLPELVATERPDLIIMDLQLPHIDGVTL 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + +K     + IP+I +TA+A      +  + GC AY+ KP+     + T+
Sbjct: 67  IRSLKAHGATRSIPIIVMTAYAQPELYAKAMEAGCAAYLPKPLDSRALLRTV 118


>gi|317486965|ref|ZP_07945775.1| response regulator receiver domain-containing protein [Bilophila
            wadsworthia 3_1_6]
 gi|316921840|gb|EFV43116.1| response regulator receiver domain-containing protein [Bilophila
            wadsworthia 3_1_6]
          Length = 1084

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 74/117 (63%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDN +N ++  +++++SG       +G+EA+E   +   D ++MDIQ+  + GL+
Sbjct: 959  RVLLAEDNAINRQVANEILQSSGVSVEPAGDGLEAVEKLWEGGYDAVLMDIQMPGMDGLK 1018

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ ++E +    +P+IA+TA AM GD E+    G + YI+KPI  S+ + T+ ++I
Sbjct: 1019 ATRILREYARFDNLPIIAMTAHAMNGDREKSLSVGMQDYIAKPIEPSVLLSTLARWI 1075


>gi|189467281|ref|ZP_03016066.1| hypothetical protein BACINT_03667 [Bacteroides intestinalis DSM
            17393]
 gi|189435545|gb|EDV04530.1| hypothetical protein BACINT_03667 [Bacteroides intestinalis DSM
            17393]
          Length = 1330

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 72/123 (58%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+ +T GY      NG EAL + R+  PD++I DI + E+ G
Sbjct: 1077 LQRILIVEDNDDLRNYLIDMFKT-GYNVQSCPNGKEALVIVREFDPDLVISDIMMPEMGG 1135

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPVI +TA    GDE+ + +G   G +AYI+KP S+ I   T+K 
Sbjct: 1136 DELCSVIKGDLEISHIPVILLTAL---GDEKNMLEGLEIGADAYITKPFSVGILKATVKN 1192

Query: 119  YIG 121
             + 
Sbjct: 1193 ILA 1195


>gi|315185412|gb|EFU19184.1| PAS/PAC sensor hybrid histidine kinase [Spirochaeta thermophila DSM
            6578]
          Length = 1278

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 65/118 (55%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K +++V+D ELN  L ++ +  +G   ++  NG EAL  A  H PD+I+MDI++  + GL
Sbjct: 1049 KVILVVDDKELNRTLLKEYLAPTGATVIEASNGQEALSRAETHPPDLILMDIRMPVMDGL 1108

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               K+   D   + IPVIA+TA  +K   E   K G    ++KPI       T++ ++
Sbjct: 1109 TFIKEYYRDPSHRHIPVIALTASVLKERHEEFLKNGFVEVLTKPIQRDTLFSTLRSFL 1166


>gi|253701316|ref|YP_003022505.1| Hpt sensor hybrid histidine kinase [Geobacter sp. M21]
 gi|251776166|gb|ACT18747.1| Hpt sensor hybrid histidine kinase [Geobacter sp. M21]
          Length = 818

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L++V++VEDN +N ++ R ++E+ G       NG+ AL+  ++ K D+I MD Q+  + G
Sbjct: 562 LRQVLLVEDNVVNQEVGRGMLESLGCRVKVAENGLAALKEVQRRKYDLIFMDCQMPVLDG 621

Query: 62  LEITKQI--KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           L  T++I  +E+     +P+IA+TA+AMKGD E     G + Y+SKP S     ++I++ 
Sbjct: 622 LGATRRIRQREEGSSSRVPIIALTAYAMKGDREACLAAGADDYLSKPFSREQLSKSIERR 681

Query: 120 IG 121
           +G
Sbjct: 682 LG 683


>gi|24372170|ref|NP_716212.1| sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
 gi|24346071|gb|AAN53657.1|AE015504_7 sensory box histidine kinase/response regulator [Shewanella
            oneidensis MR-1]
          Length = 1188

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1066 VLLVEDNFINQQVATELLKSAGYEVVVAGNGQIALDIVDSRPFDAVLMDIQMPVMDGLTA 1125

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E      +P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1126 ARALRERYSADVLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFETLTHWI 1181


>gi|256829208|ref|YP_003157936.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
 gi|256578384|gb|ACU89520.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
          Length = 1079

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 73/120 (60%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VED+ +N+   + L+E SGY+    R+G EALE+   H  D+++MDIQ+  + G++
Sbjct: 949  RLLMVEDDAVNLLCGQRLLEKSGYVVTTARDGQEALEVLMVHDFDLVLMDIQMPVLDGIQ 1008

Query: 64   ITKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+     + +  IP+IA+TA AM GD+E+      + Y+SKP  +    + I + +
Sbjct: 1009 TTRAIRHAAPFAHVSTIPIIALTAHAMAGDQEKFLAAEMDGYLSKPFDICKINQEIARVV 1068


>gi|215433421|gb|ACJ66676.1| response regulator [Myxococcus fulvus HW-1]
          Length = 169

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 68/104 (65%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+V++V+D +   +++ + +E  G+     RNGMEA+E A + +PD+I+MD+ L  + G 
Sbjct: 42  KRVLVVDDFDDAREMYAEYLEFVGFEVDTARNGMEAVEKASEGEPDIILMDLSLPIMDGW 101

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           E T++IK+DS  ++IPV+A+T   + G+ E     G + +++KP
Sbjct: 102 EATRRIKQDSRTRDIPVMALTGHVLAGNAEHAMDAGADEFVAKP 145


>gi|116694330|ref|YP_728541.1| signal transduction histidine kinase [Ralstonia eutropha H16]
 gi|113528829|emb|CAJ95176.1| signal transduction histidine kinase containing a receiver domain
           (hybrid) and a PAS sensor domain [Ralstonia eutropha
           H16]
          Length = 503

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 1/113 (0%)

Query: 5   VMIVEDNELNMKLFRDLI-ETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++ VEDN  N+KL   LI   +G   L    G   LELAR   P+VI+MDI L +I+G+E
Sbjct: 376 LLYVEDNPANLKLVEQLIARRAGMRLLTAITGTLGLELARTALPEVIVMDIHLPDINGIE 435

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
               ++ED     IPVIA++A AM  D E+  K G   Y++KPI L+ FM+ +
Sbjct: 436 ALGLLREDPRTAHIPVIALSANAMPRDIEKGTKAGFFRYLTKPIRLNEFMDAL 488


>gi|294828133|ref|NP_712722.2| histidine kinase/response regulator hybrid protein [Leptospira
            interrogans serovar Lai str. 56601]
 gi|293385980|gb|AAN49740.2| histidine kinase response regulator hybrid protein [Leptospira
            interrogans serovar Lai str. 56601]
          Length = 1017

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 68/113 (60%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N K+   L+   GY A    NG+E +E  +    D+I MDIQ+ EI G E
Sbjct: 899  QILLVEDNVINQKIALRLLTKLGYNADSALNGLEGIEKLKTKNYDLIFMDIQMPEIDGYE 958

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             T QI++D    +  ++A+TA AM+GD E+  + G  AYISKPI +     TI
Sbjct: 959  TTFQIRKDFGKSKPVIVAMTANAMEGDREKCLEAGMNAYISKPIQIQDIESTI 1011


>gi|45657308|ref|YP_001394.1| histidine kinase response regulator hybrid protein [Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|45600546|gb|AAS70031.1| histidine kinase response regulator hybrid protein [Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 1017

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 68/113 (60%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N K+   L+   GY A    NG+E +E  +    D+I MDIQ+ EI G E
Sbjct: 899  QILLVEDNVINQKIALRLLTKLGYNADSALNGLEGIEKLKTKNYDLIFMDIQMPEIDGYE 958

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             T QI++D    +  ++A+TA AM+GD E+  + G  AYISKPI +     TI
Sbjct: 959  TTFQIRKDFGKSKPVIVAMTANAMEGDREKCLEAGMNAYISKPIQIQDIESTI 1011


>gi|238797166|ref|ZP_04640668.1| Signal transduction histidine-protein kinase barA [Yersinia
           mollaretii ATCC 43969]
 gi|238719013|gb|EEQ10827.1| Signal transduction histidine-protein kinase barA [Yersinia
           mollaretii ATCC 43969]
          Length = 915

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 72/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 660 KVMAVDDNPANLKLIGTLLEEQVAETVLCDSGAKAIAYAREHTLDIILMDIQMPEIDGIR 719

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S   + P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + +Y
Sbjct: 720 ASEIIHQMSHHLDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDETRLIQALSRY 775


>gi|189910583|ref|YP_001962138.1| two component response regulator sensor histidine kinase/response
           regulator subunits [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775259|gb|ABZ93560.1| Sensor histidine kinase and response regulator of a two component
           complex [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
          Length = 812

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 78/117 (66%), Gaps = 1/117 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I +D+ +N+K+ +  ++  GY+AL   NG + LE+  +  PD+I++D+Q+ +I G++
Sbjct: 691 KILIADDDSINLKVSKMFLKKLGYVALIAENGEKTLEVVEKENPDLILLDVQMPDIDGIQ 750

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +TKQI+++  L+  P +IA+TA  M+ ++E     G + +++KP+ +   +  IKK+
Sbjct: 751 VTKQIRKNKNLKRQPIIIALTANVMEEEKENCLSSGMDDFMTKPLLMQDLVYMIKKW 807


>gi|197117892|ref|YP_002138319.1| sensor histidine kinase response regulator lipoprotein, HAMP/Hpt
           domain-containing protein [Geobacter bemidjiensis Bem]
 gi|197087252|gb|ACH38523.1| sensor histidine kinase response regulator lipoprotein, HAMP and
           Hpt domain-containing protein [Geobacter bemidjiensis
           Bem]
          Length = 818

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L++V++VEDN +N ++ R L+E+ G       NG+ AL+  ++   D+I MD Q+  + G
Sbjct: 562 LRQVLLVEDNVVNQEVGRGLLESLGCRVKVAENGLAALKELQRGAFDLIFMDCQMPVLDG 621

Query: 62  LEITKQI--KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE T++I  +E+     +P+IA+TA+AMKGD E     G + Y+SKP S     ++I++ 
Sbjct: 622 LEATRRIRQREEGSSARVPIIALTAYAMKGDREACLAAGADDYLSKPFSREQLSKSIERR 681

Query: 120 IG 121
           +G
Sbjct: 682 LG 683


>gi|255531848|ref|YP_003092220.1| PAS sensor protein [Pedobacter heparinus DSM 2366]
 gi|255344832|gb|ACU04158.1| PAS sensor protein [Pedobacter heparinus DSM 2366]
          Length = 1179

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 73/119 (61%), Gaps = 2/119 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIE--TSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            +V+I EDN +NM L + ++          + +NG+EALEL +  K D+++MDIQ+ E++G
Sbjct: 935  QVLIAEDNAVNMLLAKTIVRRIAPNATIFEAKNGLEALELYKTTKIDIVLMDIQMPEMNG 994

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E TK+I+        P+IA+TA  +KG++E+    G + +ISKP+       ++KK++
Sbjct: 995  YEATKKIRAVRHKPHTPIIALTAGNVKGEKEKCFAAGMDDFISKPVVAHTIALSLKKWL 1053



 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 64/117 (54%), Gaps = 15/117 (12%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-ARQHKPDVIIMDIQLQEIS 60
           +K V+IV+DN+ N  +   ++      +++  +G EA+ + ++  K DVI+MD  + ++ 
Sbjct: 792 IKNVLIVDDNKNNRLIINKMLSLKQIRSVEAGSGHEAIGMISKGEKFDVILMDYHMPDLD 851

Query: 61  GLEITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCE-----AYISKPISL 109
           GLE  K+I+E   DS+ ++ P++ + +     DE  I+   CE       + KPI L
Sbjct: 852 GLETIKKIREILKDSD-KDQPIVLLHS---SSDETIIK--ACEELNVHHRLLKPIKL 902


>gi|168699248|ref|ZP_02731525.1| response regulator receiver domain protein (CheY-like) [Gemmata
           obscuriglobus UQM 2246]
          Length = 406

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 71/122 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  V++VED ++N ++FR  +E  GY  L    G+ A+ LAR  +PDVI+MD+ L +I G
Sbjct: 1   MPHVLLVEDEQVNREMFRRRLERKGYTVLPADTGLGAVALARSERPDVILMDLGLPDIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E T+++K D     IP+I ++A A    +++    GC+ + +KP++       + +++ 
Sbjct: 61  WEATRRLKADPATAPIPIIVLSAHATFDAKDKAFAAGCQDFETKPVNWDALYRKLDEWLA 120

Query: 122 EA 123
           + 
Sbjct: 121 KG 122



 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/104 (33%), Positives = 61/104 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDN+ N  +    + + G+  ++  NG EAL+  R+   D+++ DI + E+ G 
Sbjct: 161 KRILVVEDNDANRVMLCRRLGSRGFQTVEAANGREALDAVRRAPFDLVLCDIMMPEVDGY 220

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           E+ +Q+K D  LQ +PVI V+A     +  R  + G E Y+ KP
Sbjct: 221 EVLRQLKADQNLQSLPVIMVSAIDETAEVVRCIEMGAEDYLHKP 264


>gi|117925745|ref|YP_866362.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609501|gb|ABK44956.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1128

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 74/120 (61%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++ EDN+LN+++ ++++  SG       NG+ A+E  ++   D+++MD+Q+  + G 
Sbjct: 791 KHILLAEDNDLNVEVVQEMLSPSGVTLSCVSNGLRAVEAVQKRSYDLVLMDLQMPVMDGR 850

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E TKQI      Q  P+IA+TA A+ GD ER    G   +I+KP+   +F  TIK+++G+
Sbjct: 851 EATKQILGLGLDQPPPIIALTANALSGDRERCMALGMVDHIAKPLVPELFYATIKRHLGD 910



 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 65/116 (56%), Gaps = 3/116 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSG-YIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           +V++V+DN L+  +  D+++  G  + + +      L LA+   P D I+MD Q+  ++G
Sbjct: 643 QVLVVDDNVLSQHILHDILQGFGCQVQVASSGEEALLLLAQLEGPFDFILMDWQMPGLNG 702

Query: 62  LEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           +E  ++I +     E+P +I VTA   +   ++ R+   + ++ KP++ S+ +E I
Sbjct: 703 IETAQRIYQKFAKVEMPTIIMVTAHGREEVMQKAREAKLDGFLMKPVNPSMLLEVI 758


>gi|299148913|ref|ZP_07041975.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
 gi|298513674|gb|EFI37561.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_23]
          Length = 657

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L+    YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 542 KKILVVEDIESNFVQLNILLNKE-YIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 600

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 601 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 657


>gi|237713842|ref|ZP_04544323.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D1]
 gi|229445998|gb|EEO51789.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D1]
          Length = 1330

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 74/123 (60%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+++TS Y      NG +AL + R+  PD++I DI + E+SG
Sbjct: 1065 LQRILIVEDNDDLRNYLVDMLKTS-YNIQACPNGKDALIIIREFNPDLVISDIMMPEMSG 1123

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI+KP S+ I   TIK 
Sbjct: 1124 DELCSAIKGDLEMSHIPVVLLTAL---GDEKNMLEGLEIGADAYITKPFSVGILKATIKN 1180

Query: 119  YIG 121
             + 
Sbjct: 1181 LLA 1183


>gi|290769939|gb|ADD61708.1| putative protein [uncultured organism]
          Length = 221

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 77/121 (63%), Gaps = 5/121 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEI 59
           K++++VEDNELN ++ + ++E +G++     +G+EA++   Q  P   D+I+MDIQ+  +
Sbjct: 96  KRILLVEDNELNQEIAQTILEDAGFMVETANDGVEAVKKMEQAVPGQYDLILMDIQMPVM 155

Query: 60  SGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           +G E  KQI+  ++ E   +P++A+TA A + D E+  + G   Y++KP+S    + TI 
Sbjct: 156 NGYEAAKQIRSLKNRETASVPIVAMTANAFEEDREKSYEAGMNGYLAKPVSAEALINTID 215

Query: 118 K 118
           K
Sbjct: 216 K 216


>gi|183220472|ref|YP_001838468.1| putative two-component response regulator [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|167778894|gb|ABZ97192.1| Putative two-component response regulator; putative membrane
           protein [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Paris)']
          Length = 807

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 78/117 (66%), Gaps = 1/117 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I +D+ +N+K+ +  ++  GY+AL   NG + LE+  +  PD+I++D+Q+ +I G++
Sbjct: 686 KILIADDDSINLKVSKMFLKKLGYVALIAENGEKTLEVVEKENPDLILLDVQMPDIDGIQ 745

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +TKQI+++  L+  P +IA+TA  M+ ++E     G + +++KP+ +   +  IKK+
Sbjct: 746 VTKQIRKNKNLKRQPIIIALTANVMEEEKENCLSSGMDDFMTKPLLMQDLVYMIKKW 802


>gi|295085367|emb|CBK66890.1| Signal transduction histidine kinase [Bacteroides xylanisolvens XB1A]
          Length = 1263

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 74/123 (60%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+++TS Y      NG +AL + R+  PD++I DI + E+SG
Sbjct: 998  LQRILIVEDNDDLRNYLVDMLKTS-YNIQACPNGKDALIIIREFNPDLVISDIMMPEMSG 1056

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI+KP S+ I   TIK 
Sbjct: 1057 DELCSAIKGDLEMSHIPVVLLTAL---GDEKNMLEGLEIGADAYITKPFSVGILKATIKN 1113

Query: 119  YIG 121
             + 
Sbjct: 1114 LLA 1116


>gi|262409249|ref|ZP_06085793.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_1_22]
 gi|294645954|ref|ZP_06723622.1| response regulator receiver domain protein [Bacteroides ovatus SD CC
            2a]
 gi|294806056|ref|ZP_06764914.1| response regulator receiver domain protein [Bacteroides xylanisolvens
            SD CC 1b]
 gi|262352996|gb|EEZ02092.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_1_22]
 gi|292638699|gb|EFF57049.1| response regulator receiver domain protein [Bacteroides ovatus SD CC
            2a]
 gi|294446739|gb|EFG15348.1| response regulator receiver domain protein [Bacteroides xylanisolvens
            SD CC 1b]
          Length = 1341

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 74/123 (60%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+++TS Y      NG +AL + R+  PD++I DI + E+SG
Sbjct: 1076 LQRILIVEDNDDLRNYLVDMLKTS-YNIQACPNGKDALIIIREFNPDLVISDIMMPEMSG 1134

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI+KP S+ I   TIK 
Sbjct: 1135 DELCSAIKGDLEMSHIPVVLLTAL---GDEKNMLEGLEIGADAYITKPFSVGILKATIKN 1191

Query: 119  YIG 121
             + 
Sbjct: 1192 LLA 1194


>gi|284054106|ref|ZP_06384316.1| two-component hybrid sensor and regulator [Arthrospira platensis
           str. Paraca]
          Length = 385

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHK------PDVIIMDIQLQ 57
           ++++VED   N  L  +++E  GY      +G   L++           PD+I+MDIQL 
Sbjct: 261 RILVVEDQLFNQLLITEVLELEGYQVELIADGNTMLDMINSTMVKPEILPDLILMDIQLP 320

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ G E+ +++K+ S  + +PV+AVTA  M GD ER    G + Y+SKP+ +   +ET+K
Sbjct: 321 EVDGFELIRRLKQSSLWKVVPVVAVTAMVMSGDRERCLVAGADGYLSKPLDVDQVLETVK 380

Query: 118 KYI 120
            ++
Sbjct: 381 DFL 383


>gi|254513977|ref|ZP_05126038.1| two-component response regulator [gamma proteobacterium NOR5-3]
 gi|219676220|gb|EED32585.1| two-component response regulator [gamma proteobacterium NOR5-3]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 67/117 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDNELN  +    ++ +G+ AL   +G +AL      +P ++++D+ L  + G  
Sbjct: 5   QLLLVEDNELNRDMLSRRLKRAGFEALIAEDGAKALASIESERPALVLLDMNLPVMDGWS 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + + ++   EL   P+IA+TA AM  D +R  + GC+ Y +KPI     +E I + +
Sbjct: 65  VCRAVRAKPELAHTPIIALTAHAMAEDRDRALEAGCDDYATKPIDFPALLEKIARLL 121


>gi|45440163|ref|NP_991702.1| hybrid sensory histidine kinase BarA [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162421785|ref|YP_001605547.1| hybrid sensory histidine kinase BarA [Yersinia pestis Angola]
 gi|45435019|gb|AAS60579.1| two-component regulatory protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|162354600|gb|ABX88548.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           Angola]
          Length = 921

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|295087116|emb|CBK68639.1| PAS domain S-box [Bacteroides xylanisolvens XB1A]
          Length = 637

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L+    YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 522 KKILVVEDIESNFVQLNILLNKE-YIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 580

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 581 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 637


>gi|293370768|ref|ZP_06617314.1| PAS domain S-box [Bacteroides ovatus SD CMC 3f]
 gi|292634128|gb|EFF52671.1| PAS domain S-box [Bacteroides ovatus SD CMC 3f]
          Length = 635

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N      L+    YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 520 KKILVVEDIESNFVQLNILLNKE-YIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 578

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 579 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 635


>gi|186894112|ref|YP_001871224.1| hybrid sensory histidine kinase BarA [Yersinia pseudotuberculosis
           PB1/+]
 gi|186697138|gb|ACC87767.1| multi-sensor hybrid histidine kinase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 924

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|238761632|ref|ZP_04622607.1| Signal transduction histidine-protein kinase barA [Yersinia
           kristensenii ATCC 33638]
 gi|238700146|gb|EEP92888.1| Signal transduction histidine-protein kinase barA [Yersinia
           kristensenii ATCC 33638]
          Length = 891

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 73/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 640 KVMAVDDNPANLKLIGTLLEELVEETVLCDSGAKAITYARENTLDIILMDIQMPEIDGIR 699

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S  Q+ P+IAVTA A++G +E++ K G   Y++KPI  +  ++ I +Y
Sbjct: 700 ASEVIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQAISRY 755


>gi|108808871|ref|YP_652787.1| hybrid sensory histidine kinase BarA [Yersinia pestis Antiqua]
 gi|167398949|ref|ZP_02304473.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|108780784|gb|ABG14842.1| Hpt sensor hybrid histidine kinase [Yersinia pestis Antiqua]
 gi|167051453|gb|EDR62861.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. UG05-0454]
          Length = 927

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|89901045|ref|YP_523516.1| periplasmic sensor hybrid histidine kinase [Rhodoferax
           ferrireducens T118]
 gi|89345782|gb|ABD69985.1| periplasmic sensor hybrid histidine kinase [Rhodoferax
           ferrireducens T118]
          Length = 1009

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 73/122 (59%), Gaps = 6/122 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDN++N +   +L+   G   ++  NG EAL+  +QH  D ++MD+Q+  + GL+ 
Sbjct: 668 LLLVEDNDINREFATELLRGEGIEIIEAVNGQEALDKVQQHDLDAVLMDLQMPVMDGLQA 727

Query: 65  TKQIK------EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           T++I+      E +    +P+IA+TA AM  D ++ R+ G   +ISKP+     M T+ K
Sbjct: 728 TRRIRALANTPEGARFASLPIIAMTALAMPQDAQKSREAGMNDHISKPVDPEHLMATLAK 787

Query: 119 YI 120
           +I
Sbjct: 788 WI 789



 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 66/124 (53%), Gaps = 4/124 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL---ARQHKPDVIIMDIQLQEIS 60
           ++++V+DNE + ++    +      A    +G  AL +   A  H  D+++MD ++  ++
Sbjct: 519 RMLVVDDNEASCEIMAQTLRYFHVDASTANSGPAALTILKNAAAHPFDLVLMDWRMPGMN 578

Query: 61  GLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           G E+T++I+ +  +   P V+ V+A+  +   +   +   + +++KP+S S  ++T+   
Sbjct: 579 GDEVTRRIRAEPGIAHQPKVVMVSAYGHEDVIKLAEQARVDGFLTKPVSPSTLLDTVLSV 638

Query: 120 IGEA 123
           +G  
Sbjct: 639 LGRG 642


>gi|165925853|ref|ZP_02221685.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|229896495|ref|ZP_04511663.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis Pestoides A]
 gi|165922465|gb|EDR39642.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|229700569|gb|EEO88600.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis Pestoides A]
          Length = 924

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|87118652|ref|ZP_01074551.1| Multi-sensor Hybrid Histidine Kinase [Marinomonas sp. MED121]
 gi|86166286|gb|EAQ67552.1| Multi-sensor Hybrid Histidine Kinase [Marinomonas sp. MED121]
          Length = 916

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 73/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+ V+DN++N++L    +  +        +G  AL+L  + + D+I+MDIQ+ E+ G+E
Sbjct: 673 KVLAVDDNQINLQLVSHWLTPNNIDVSLAHSGQAALDLCAREQFDLILMDIQMPEMDGME 732

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+++++      IP+IA+TA A+  +++ I K G  AY++KP++ S  +E I+ +
Sbjct: 733 TTRRLRQHKNTTLIPIIALTAHALSSEKQEILKSGMNAYLTKPVNESKLLEVIQDW 788


>gi|269140062|ref|YP_003296763.1| hybrid sensory histidine kinase [Edwardsiella tarda EIB202]
 gi|267985723|gb|ACY85552.1| hybrid sensory histidine kinase [Edwardsiella tarda EIB202]
 gi|304559890|gb|ADM42554.1| BarA sensory histidine kinase [Edwardsiella tarda FL6-60]
          Length = 919

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 70/118 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       L   +G EAL  AR+   D+I+MDIQ+ E+ G+  
Sbjct: 666 VMAVDDNPANLKLIGALLGELVQHTLLCHSGEEALAAARERHLDIILMDIQMPEMDGIRT 725

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T+ +++       P+IAVTA A+ G+ ER+ + G + Y++KPI  ++  + + +Y GE
Sbjct: 726 TELLRQQPRHATTPIIAVTAHAINGERERLLRAGMDDYLAKPIDENMLRQLLNRYSGE 783


>gi|170025666|ref|YP_001722171.1| hybrid sensory histidine kinase BarA [Yersinia pseudotuberculosis
           YPIII]
 gi|169752200|gb|ACA69718.1| multi-sensor hybrid histidine kinase [Yersinia pseudotuberculosis
           YPIII]
          Length = 942

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|51595100|ref|YP_069291.1| hybrid sensory histidine kinase BarA [Yersinia pseudotuberculosis
           IP 32953]
 gi|51588382|emb|CAH19990.1| bifunctional multimodular BarA: sensory histidine kinase in two
           component regulatory system, activates OmpR [Yersinia
           pseudotuberculosis IP 32953]
          Length = 942

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|229839016|ref|ZP_04459175.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229695382|gb|EEO85429.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262363147|gb|ACY59868.1| two-component regulatory protein [Yersinia pestis D106004]
          Length = 927

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|167423462|ref|ZP_02315215.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167057632|gb|EDR67378.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Mediaevalis str. K1973002]
          Length = 936

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|166214085|ref|ZP_02240120.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166204716|gb|EDR49196.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. B42003004]
          Length = 939

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|22124721|ref|NP_668144.1| hybrid sensory histidine kinase BarA [Yersinia pestis KIM 10]
 gi|108810875|ref|YP_646642.1| hybrid sensory histidine kinase BarA [Yersinia pestis Nepal516]
 gi|229901084|ref|ZP_04516207.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis Nepal516]
 gi|270489264|ref|ZP_06206338.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Yersinia pestis KIM D27]
 gi|21957537|gb|AAM84395.1|AE013683_8 sensor-regulator, activates OmpR by phophorylation [Yersinia pestis
           KIM 10]
 gi|108774523|gb|ABG17042.1| Hpt sensor hybrid histidine kinase [Yersinia pestis Nepal516]
 gi|229681809|gb|EEO77902.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis Nepal516]
 gi|270337768|gb|EFA48545.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Yersinia pestis KIM D27]
          Length = 933

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|145600234|ref|YP_001164310.1| hybrid sensory histidine kinase BarA [Yersinia pestis Pestoides F]
 gi|153997576|ref|ZP_02022676.1| two-component regulatory protein [Yersinia pestis CA88-4125]
 gi|165936705|ref|ZP_02225272.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010041|ref|ZP_02230939.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|167420808|ref|ZP_02312561.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167469899|ref|ZP_02334603.1| hybrid sensory histidine kinase BarA [Yersinia pestis FV-1]
 gi|218930398|ref|YP_002348273.1| hybrid sensory histidine kinase BarA [Yersinia pestis CO92]
 gi|229899582|ref|ZP_04514723.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis biovar Orientalis str. India
           195]
 gi|294505087|ref|YP_003569149.1| two-component regulatory protein [Yersinia pestis Z176003]
 gi|115349009|emb|CAL21970.1| two-component regulatory protein [Yersinia pestis CO92]
 gi|145211930|gb|ABP41337.1| Hpt sensor hybrid histidine kinase [Yersinia pestis Pestoides F]
 gi|149289213|gb|EDM39293.1| two-component regulatory protein [Yersinia pestis CA88-4125]
 gi|165915354|gb|EDR33964.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165990948|gb|EDR43249.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166961614|gb|EDR57635.1| signal transduction histidine-protein kinase BarA [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|229687074|gb|EEO79149.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis biovar Orientalis str. India
           195]
 gi|262367077|gb|ACY63634.1| two-component regulatory protein [Yersinia pestis D182038]
 gi|294355546|gb|ADE65887.1| two-component regulatory protein [Yersinia pestis Z176003]
 gi|320016581|gb|ADW00153.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 930

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|153947037|ref|YP_001402279.1| hybrid sensory histidine kinase BarA [Yersinia pseudotuberculosis
           IP 31758]
 gi|152958532|gb|ABS45993.1| signal transduction histidine-protein kinase BarA [Yersinia
           pseudotuberculosis IP 31758]
          Length = 930

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +VM V+DN  N+KL   L+E      +   +G  A+  AR+H  D+I+MDIQ+ EI G+ 
Sbjct: 669 RVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I +    QE P+IAVTA A+KG +E++ + G   Y++KPI  +  ++ + +Y
Sbjct: 729 ASEIIHQIPHHQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRY 784


>gi|167948903|ref|ZP_02535977.1| two-component system sensor protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 345

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 73/123 (59%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ++  V++VEDN +NM + + +++ +G   +   +G EAL++  +   DV++MD Q+  + 
Sbjct: 67  LVGHVLVVEDNPVNMAVVKKMLQRAGLTPVTAMDGAEALKMVGEENFDVVLMDCQMPRMD 126

Query: 61  GLEITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           G E T+ I+   E   L  +P+IA+TA AM GD ER    G + Y++KP+  S     ++
Sbjct: 127 GYESTEAIRNREEMNGLSRLPIIAMTANAMAGDRERCLAAGMDDYLAKPVKPSALENMLR 186

Query: 118 KYI 120
           +++
Sbjct: 187 QWL 189


>gi|254490059|ref|ZP_05103252.1| NMT1/THI5 like family [Methylophaga thiooxidans DMS010]
 gi|224464723|gb|EEF80979.1| NMT1/THI5 like family [Methylophaga thiooxydans DMS010]
          Length = 896

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEA-LELARQHKPDVIIMDIQLQEISG 61
           K+++ +EDN  N+KL    +    +++L+T    EA LE+  Q KPD+I+MDI L  ISG
Sbjct: 779 KQILYIEDNPANIKLIEVFLSRFKHVSLETCETAEAGLEIVNQRKPDLILMDINLPGISG 838

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +E  +++ +  E  +IP+IA+TA A++ +     +G   AYI+KP+  ++   T++ Y+
Sbjct: 839 IEAAQKLHDTPEFADIPLIALTAAALE-ENSHAAQGLFTAYITKPVDFTLLARTLQPYL 896


>gi|212635122|ref|YP_002311647.1| PAS domain-containing protein [Shewanella piezotolerans WP3]
 gi|212556606|gb|ACJ29060.1| PAS domain protein [Shewanella piezotolerans WP3]
          Length = 1831

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 72/116 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN++N ++  +L+  +G       NG EA+++A  +  D I+MDIQ+  + G E 
Sbjct: 1406 VLLVEDNDINQEIATELLNMAGIEVSTACNGQEAVDMAIANSYDAILMDIQMPIMDGYEA 1465

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+ + + Q IP+IA+TA AM GD E+  + G   +I KPI+     +T+ K+I
Sbjct: 1466 TRNIRLNPDKQLIPIIAMTANAMSGDREKCIEAGMNEHIPKPINPQEVYQTLAKWI 1521


>gi|238920900|ref|YP_002934415.1| hybrid sensory histidine kinase BarA [Edwardsiella ictaluri 93-146]
 gi|238870469|gb|ACR70180.1| signal transduction histidine-protein kinase BarA [Edwardsiella
           ictaluri 93-146]
          Length = 918

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 70/118 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       L   +G EAL  AR    D+I+MDIQ+ E+ G+  
Sbjct: 666 VMAVDDNPANLKLIGALLGELVQHILLCHSGEEALAAARDRHLDIILMDIQMPEMDGIRT 725

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T+ +++ S     P+IAVTA A+ G+ ER+ + G + Y++KPI  ++  + + +Y GE
Sbjct: 726 TELLRQQSRHVTTPIIAVTAHAINGERERLLRAGMDDYLAKPIDENMLRQLLNRYSGE 783


>gi|170078542|ref|YP_001735180.1| response regulatory protein [Synechococcus sp. PCC 7002]
 gi|169886211|gb|ACA99924.1| receiver domain response regulatory protein [Synechococcus sp. PCC
           7002]
          Length = 131

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 78/131 (59%), Gaps = 10/131 (7%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSG-YIALQTRNGMEALELARQHKPDVIIMDIQL---- 56
           +  ++IVED+ +N+++F  +++  G +  L + N  E + L    K D+++MD+ L    
Sbjct: 1   MATILIVEDDPINVRVFSTILQKRGQFDVLCSENVGEIMALTSAGKVDLVMMDVSLTASL 60

Query: 57  ---QEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEER-IRKGGCEAYISKP-ISLSI 111
              + + G+ IT+ +K D + +EIPVI VTA AM+GD E  + K G E YISKP +    
Sbjct: 61  YEGESVDGIRITQMLKADPQTKEIPVILVTAHAMQGDRETFLSKSGAEGYISKPVVDYDD 120

Query: 112 FMETIKKYIGE 122
           F++ I + IGE
Sbjct: 121 FLQQIHRLIGE 131


>gi|239908806|ref|YP_002955548.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
 gi|239798673|dbj|BAH77662.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
          Length = 1375

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            + +V++VED+E+++   + ++E SGY     ++G  A+        D+I+MD+Q+  + G
Sbjct: 1249 MHRVLLVEDDEISLHTVKRMLEKSGYAVSTAQDGQIAIGCLSDPDFDLILMDVQMPVLDG 1308

Query: 62   LEITKQIKED-SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +E TK I+   +   +IP+IA+TA+AM GD+E+    G   YISKP+ ++   E I++ +
Sbjct: 1309 VEATKLIRASGASYADIPIIAMTAYAMTGDKEKFLAAGMNDYISKPVDMAALKEVIERVM 1368

Query: 121  GEA 123
             +A
Sbjct: 1369 EKA 1371


>gi|283850700|ref|ZP_06367987.1| Hpt sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283573943|gb|EFC21916.1| Hpt sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 651

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ EDN +N    ++L+E  G+  +    G  ALE  R+   D I+MDIQ+ E+ GLE 
Sbjct: 372 ILLAEDNPINQLYVQELLEMDGHEVVVAHTGRRALEALRRKYFDAILMDIQMPEMDGLEA 431

Query: 65  TKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+ I+ D        IP++A+TA A+KGD E   + G   Y+SKP+S +     + + +G
Sbjct: 432 TRAIRTDQTGDFDPNIPIVALTAHALKGDRETFLRAGMNEYLSKPVSPAGLEAALMRAVG 491

Query: 122 EA 123
           +A
Sbjct: 492 DA 493


>gi|255943187|ref|XP_002562362.1| Pc18g05350 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587095|emb|CAP94759.1| Pc18g05350 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1302

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N +L   +++   +      NG+EA+E  ++ + DVI+MD+Q+  + G E 
Sbjct: 1094 ILLAEDNDVNQQLAMKILQKHNHNVFVVGNGLEAVEAVKKRRYDVILMDVQMPVMGGFEA 1153

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   +S LQ  P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1154 TGKIREYERESGLQRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1210


>gi|114048941|ref|YP_739491.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
 gi|113890383|gb|ABI44434.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-7]
          Length = 1236

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVVAGNGQIALDIIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E      +P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADVLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFETLSHWI 1229



 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSALMRDFHFEVDTAASGAEALYKLSRDPIDLLLLDWMMPEMDGGD 1027

Query: 64   ITKQIK---EDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  + + P +I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VISAIDTMVAEGRIAKRPIIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|117919029|ref|YP_868221.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
 gi|117611361|gb|ABK46815.1| multi-sensor hybrid histidine kinase [Shewanella sp. ANA-3]
          Length = 1236

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVVAGNGQIALDIIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E      +P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADVLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFETLSHWI 1229



 Score = 33.9 bits (76), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSALMRDFHFEVDTAASGAEALYKLSRDPIDLLLLDWMMPEMDGGD 1027

Query: 64   ITKQIK---EDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  + + P +I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VISAIDTMVAEGRIAKRPIIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|237726370|ref|ZP_04556851.1| two-component system sensor histidine kinase [Bacteroides sp. D4]
 gi|265751928|ref|ZP_06087721.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_33FAA]
 gi|229434896|gb|EEO44973.1| two-component system sensor histidine kinase [Bacteroides dorei
           5_1_36/D4]
 gi|263236720|gb|EEZ22190.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_33FAA]
          Length = 781

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  ++G +A+   ++H+PD+I+MDI++  + GL
Sbjct: 666 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKDGEDAVNQFKEHQPDLILMDIKMPHMDGL 724

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+ +++KP+S +   + + KY+
Sbjct: 725 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDFLTKPVSQNALEKVLDKYV 780


>gi|153809460|ref|ZP_01962128.1| hypothetical protein BACCAC_03775 [Bacteroides caccae ATCC 43185]
 gi|149127920|gb|EDM19142.1| hypothetical protein BACCAC_03775 [Bacteroides caccae ATCC 43185]
          Length = 1338

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 71/119 (59%), Gaps = 7/119 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D++ T GY      NG EAL + R+  PD++I DI + E+ G
Sbjct: 1077 LQRILIVEDNDDLRNYLVDMLRT-GYNIQSCPNGKEALIIIREFNPDLVISDIMMPEMGG 1135

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIK 117
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI+KP S+ I   TIK
Sbjct: 1136 DELCATIKGDLEMSHIPVVLLTAL---GDEKHMLEGLEIGADAYITKPFSVGILKATIK 1191


>gi|73537902|ref|YP_298269.1| PAS/PAC sensor hybrid histidine kinase [Ralstonia eutropha JMP134]
 gi|72121239|gb|AAZ63425.1| PAS/PAC sensor hybrid histidine kinase [Ralstonia eutropha JMP134]
          Length = 1284

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 71/120 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDNE+N ++   L++ +G       NG  ALEL      D+++MD+Q+  + G E
Sbjct: 928  RVLLVEDNEINREVATHLLQQAGITPDTAENGAIALELLAVQDYDLVLMDMQMPVMDGFE 987

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T+ I+ +  L  +PV+A+TA A+  D  R    G + +I+KPIS + F  T+ +++  A
Sbjct: 988  ATRHIRANPRLASMPVVAMTANALPEDRNRCLAAGMDDHIAKPISPATFFTTLHRWLTGA 1047


>gi|212691328|ref|ZP_03299456.1| hypothetical protein BACDOR_00820 [Bacteroides dorei DSM 17855]
 gi|212666081|gb|EEB26653.1| hypothetical protein BACDOR_00820 [Bacteroides dorei DSM 17855]
          Length = 781

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  ++G +A+   ++H+PD+I+MDI++  + GL
Sbjct: 666 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKDGEDAVNQFKEHQPDLILMDIKMPHMDGL 724

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+ +++KP+S +   + + KY+
Sbjct: 725 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDFLTKPVSQNALEKVLDKYV 780


>gi|113968921|ref|YP_732714.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
 gi|113883605|gb|ABI37657.1| multi-sensor hybrid histidine kinase [Shewanella sp. MR-4]
          Length = 1236

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN +N ++  +L++++GY  +   NG  AL++      D ++MDIQ+  + GL  
Sbjct: 1114 VLLVEDNFINQQVATELLKSAGYEVVVAGNGQIALDIIDSRPFDAVLMDIQMPVMDGLTA 1173

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E      +P+IA+TA AM GD E+    G  A+I+KPI L+   ET+  +I
Sbjct: 1174 ARALRERFSADVLPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLTELFETLSHWI 1229



 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++V+DN   ++++  L+    +      +G EAL    +   D++++D  + E+ G +
Sbjct: 968  RTLVVDDNPTALQIYSALMRDFHFEVDTAASGAEALYKLSRDPIDLLLLDWMMPEMDGGD 1027

Query: 64   ITKQIK---EDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIKK 118
            +   I     +  + + P +I +TA+A +  +  +      A + KP  + S+F E I  
Sbjct: 1028 VISAIDTMVAEGRIAKRPIIIMMTAYAAEPLQHEVDSANVFAVLQKPFKASSLFDEIIAA 1087

Query: 119  YIGE 122
            +  E
Sbjct: 1088 FADE 1091


>gi|320354148|ref|YP_004195487.1| multi-sensor hybrid histidine kinase [Desulfobulbus propionicus DSM
           2032]
 gi|320122650|gb|ADW18196.1| multi-sensor hybrid histidine kinase [Desulfobulbus propionicus DSM
           2032]
          Length = 900

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++ ED  +N  L R L+  +GY      NG +A++  R    D I+MDIQ+ E+ G 
Sbjct: 758 QRILVAEDEYINKILIRTLLRQAGYQVTVVENGRKAVDAWRGGLFDCILMDIQMPEMDGY 817

Query: 63  EITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E   +I+E + + Q IP+IA+TA AM  D ++    G + Y+SKPI  S  ++ I+KY+
Sbjct: 818 EAVARIREAEGDNQHIPIIAMTAHAMPSDRQKCLSSGMDDYVSKPIDGSSVLKIIEKYL 876


>gi|153807923|ref|ZP_01960591.1| hypothetical protein BACCAC_02209 [Bacteroides caccae ATCC 43185]
 gi|149129532|gb|EDM20746.1| hypothetical protein BACCAC_02209 [Bacteroides caccae ATCC 43185]
          Length = 991

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N KLF  +++   Y  +   +G EA+ + +++ P +++MDI +  + G E 
Sbjct: 872 ILIAEDNESNYKLFESILKYD-YHLIHAWDGQEAVNMFKEYDPQIVLMDINMPVMDGYEA 930

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           TK+I++ S   ++P+IA+TAFA   DE+R+   G + Y+ KPI+
Sbjct: 931 TKEIRKYS--AKVPIIAITAFAYASDEQRVMASGFDGYMPKPIN 972


>gi|113866854|ref|YP_725343.1| signal transduction histidine kinase [Ralstonia eutropha H16]
 gi|113525630|emb|CAJ91975.1| signal transduction histidine kinase containing a receiver domain
           (hybrid) and a PAS sensor domain [Ralstonia eutropha
           H16]
          Length = 569

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 67/116 (57%), Gaps = 1/116 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYI-ALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           +  ++ VEDN  N+KL   L+     +  L    G+  +ELAR   PD I+MDI L +I+
Sbjct: 440 MHTLLYVEDNPANLKLLEQLLARRADVHLLSAATGILGVELARTSLPDAIVMDIHLPDIN 499

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           G+E   +++ED     IPVIA++A AM  D ER  K G   Y++KPI +  FM+ +
Sbjct: 500 GIEALGRLREDPMTMHIPVIALSANAMPRDIERGMKAGFFRYLTKPIRIHEFMDAL 555


>gi|77919010|ref|YP_356825.1| two component signal transduction response regulator [Pelobacter
           carbinolicus DSM 2380]
 gi|77545093|gb|ABA88655.1| two component signal transduction response regulator [Pelobacter
           carbinolicus DSM 2380]
          Length = 123

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++IVED E  ++L   L+ + GY      NG  ALE     KPD++++DI L EI G 
Sbjct: 5   KKILIVEDEESLLRLESILLTSKGYDVKGVSNGKAALEAMASEKPDLVLLDIMLPEIDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ + IK   E   IPVI +TA   + D  R ++ G + YI+KP   ++ +ETI++++
Sbjct: 65  EVCRIIKVTEETCHIPVIMLTAKKCQDDFSRGQEVGADWYITKPFKSAMVIETIQRFL 122


>gi|88858180|ref|ZP_01132822.1| sensor protein barA [Pseudoalteromonas tunicata D2]
 gi|88819797|gb|EAR29610.1| sensor protein barA [Pseudoalteromonas tunicata D2]
          Length = 925

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 70/116 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+DN+ N+KL   L+           NG +AL LA+ HK D+I +DIQ+  + G+ 
Sbjct: 670 KVLVVDDNDANLKLMCTLLAEQIEFIDTAHNGSQALSLAKTHKYDLIFLDIQMPIMDGVT 729

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             K I E S  +  P+IAVTA A+ G++E + K G + Y++KP+   +  +TI +Y
Sbjct: 730 ACKLIIESSINESTPIIAVTAHALAGEKENLLKVGFKNYLTKPLDEEVLRQTIFEY 785


>gi|317152269|ref|YP_004120317.1| PAS sensor protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316942520|gb|ADU61571.1| PAS sensor protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 922

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 71/121 (58%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VED  +NM + R L+E  G+      NG + L++ R  + DVI+MDIQ+  ++G+E
Sbjct: 801 RVLLVEDERVNMLMARRLLENLGHTVTCAENGEKCLQVLRGERFDVILMDIQMPVMNGME 860

Query: 64  ITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +T  I+   + +   +IP++A+TA A + D E   K G   YISKP        T++++ 
Sbjct: 861 VTHLIRNSEDFRHVADIPIVALTAHATRRDREAALKAGMNEYISKPFEKEHLEATLQRFA 920

Query: 121 G 121
           G
Sbjct: 921 G 921


>gi|237712224|ref|ZP_04542705.1| two-component system sensor histidine kinase [Bacteroides sp.
           9_1_42FAA]
 gi|229453545|gb|EEO59266.1| two-component system sensor histidine kinase [Bacteroides sp.
           9_1_42FAA]
          Length = 730

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 77/118 (65%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  ++G +A+   ++H+PD+I+MDI++  + GL
Sbjct: 615 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKDGEDAVNQFKEHQPDLILMDIKMPHMDGL 673

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+ +++KP+S +   + + KY+
Sbjct: 674 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDFLTKPVSQNALEKVLDKYV 729


>gi|119776084|ref|YP_928824.1| sensory box histidine kinase/response regulator [Shewanella
            amazonensis SB2B]
 gi|119768584|gb|ABM01155.1| sensory box histidine kinase/response regulator [Shewanella
            amazonensis SB2B]
          Length = 1763

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 73/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDNE+N ++  + +E  G +     NG  ALE   Q   D+++MD Q+  + G 
Sbjct: 1420 KRILLVEDNEMNQEVASEFLEQVGVVLSIADNGQIALEKLGQQSFDLVLMDCQMPVMDGY 1479

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + T+++++   L E+PV+A+TA AM GD+E     G   +I+KPI + I  +T+ +Y+
Sbjct: 1480 QATRELRKLPGLAELPVVAMTANAMAGDKEMCLLAGMNDHIAKPIEVGILYQTLLQYL 1537



 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+DN     + R  +++ G+     R+GMEALE   +    + ++D ++ E+ G E 
Sbjct: 1281 VLVVDDNSTARDILRTTLQSMGFSVDSARSGMEALEKCAERDYRIALIDWKMPEMDGTET 1340

Query: 65   TKQIKEDSELQEIPVI-AVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              +++   EL++ P+I  V+A A     +++ + G   YI+KPIS S  ++ I   +G
Sbjct: 1341 AARMR---ELKQPPLILMVSAHANSEFIDKVEEMGINGYITKPISASRLLDGIMSALG 1395


>gi|154500004|ref|ZP_02038042.1| hypothetical protein BACCAP_03661 [Bacteroides capillosus ATCC
           29799]
 gi|150271602|gb|EDM98859.1| hypothetical protein BACCAP_03661 [Bacteroides capillosus ATCC
           29799]
          Length = 821

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 75/123 (60%), Gaps = 5/123 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEI 59
           +K+++ EDNELNM++  ++++ SG   LQ  NG EA+ + +   P   D I+MD+Q+ E+
Sbjct: 696 RKILLAEDNELNMEIATEILDMSGVEVLQAVNGAEAVRIFQAAAPYSIDAILMDMQMPEM 755

Query: 60  SGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            G E  + I+  +  +   +P+IAVTA A   D ++  K G   +ISKPI +++  + ++
Sbjct: 756 DGCEAARAIRSLDKPDAATVPIIAVTANAFAEDIDKTTKAGMNGHISKPIDVALLYQALE 815

Query: 118 KYI 120
           K I
Sbjct: 816 KCI 818


>gi|313672986|ref|YP_004051097.1| multi-sensor hybrid histidine kinase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939742|gb|ADR18934.1| multi-sensor hybrid histidine kinase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 1095

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 74/116 (63%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           +IVEDN +N  + +++++     +    +G+EA+ LA++ K D++ MDIQ+  + G E T
Sbjct: 776 LIVEDNAINQIVLQNMLKQFNISSDFANDGLEAVNLAKKKKYDIVFMDIQMPNMDGYEAT 835

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +Q+++  E  ++P+IAV+A A K D ++  + G   +++KP+S++   + + K+I 
Sbjct: 836 RQLRKIPEYTDVPIIAVSAHAFKTDADKSLEAGMNDHLTKPVSINDLFKALSKWIN 891


>gi|22023765|gb|AAM89215.1|AF462151_1 hybrid histidine kinase [Tritrichomonas foetus]
          Length = 1547

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++VEDN+ N  + + +++  G       NG EA++   Q + D+I MD Q+  + G+
Sbjct: 1426 QKILVVEDNKTNQFVMKKILQNIGCPMRIAENGKEAIDALEQEEFDLIFMDCQMPVLDGI 1485

Query: 63   EITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            E TK I+  D     IP+IA+TA A++GDEE  RK G +AY+SKP+ +
Sbjct: 1486 EATKIIRSCDKNYSSIPIIALTASAVEGDEETCRKAGMDAYLSKPVRI 1533


>gi|209527277|ref|ZP_03275787.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209492265|gb|EDZ92610.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 1051

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN +N  L   L++  G+   +  NG EA+ + +Q  P +I MD+ +  I G E
Sbjct: 830 RILVVEDNPVNRLLLTTLLQDVGFEVQEAENGQEAIAVWQQWHPHLIFMDMHMPVIDGFE 889

Query: 64  ITKQIKEDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ IK+ +E+  +PV IA+TA A     +     GC+ +ISKP      +ET+ KY+G
Sbjct: 890 ATQYIKQ-AEVDSLPVIIAITASAFTEQRQNCINAGCDDFISKPFRREQVLETLTKYLG 947


>gi|150019623|ref|YP_001311877.1| multi-sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149906088|gb|ABR36921.1| multi-sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 979

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 68/116 (58%), Gaps = 1/116 (0%)

Query: 2   LKKVMIVEDNELNMKLF-RDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
            + ++  EDN  N++L  R L + S    L   +G   L+LA  HKPD+I++DI L  I 
Sbjct: 851 FRTILYAEDNPANLRLVERALSQISNLKMLSANSGELCLDLAIAHKPDIILLDINLPGID 910

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           G E+ K++K   E ++IP+IAV+A AM  D E+    G   YI+KPI +  F+E +
Sbjct: 911 GYEVFKRLKMHKETKDIPIIAVSAHAMPRDIEKGLSLGFSDYITKPIDIPNFIEKV 966


>gi|239905634|ref|YP_002952373.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795498|dbj|BAH74487.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 768

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I ED+++N       ++  G+ AL   +G+E L+L +  + D+I+MDIQ+  + G+E
Sbjct: 645 KILIAEDDKVNQLAISSFVKRIGHTALCANDGIETLKLLQSEEFDLILMDIQMPNLDGVE 704

Query: 64  ITKQIKEDSE-LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T  I+  +E   +IP+IA+TA AM GD E+    G   Y+SKPI +     TI K
Sbjct: 705 TTIAIRNSNEKFSKIPIIALTAHAMAGDREKFLAHGMNGYLSKPIIIEDLKNTIDK 760


>gi|117924896|ref|YP_865513.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117608652|gb|ABK44107.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 964

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 75/117 (64%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN +N ++ ++L+E  G      ++G++A+    + + D+I+MDIQ+ E+ G E
Sbjct: 695 RVLLVEDNPINQQVAQELLEQCGLQVSIAQDGVKAVAAVERERFDLILMDIQMPEMDGYE 754

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I++  E   +P+IA+TA AM GD +R    G + +++KPI +    + + K++
Sbjct: 755 ATRRIRQLPERARLPIIAMTAHAMSGDADRSLAAGMQGHLTKPIEIQPLYDMLGKWL 811


>gi|110596980|ref|ZP_01385270.1| PAS [Chlorobium ferrooxidans DSM 13031]
 gi|110341667|gb|EAT60127.1| PAS [Chlorobium ferrooxidans DSM 13031]
          Length = 999

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ ED+ +N K+   ++   G       NG EA++  RQ + D++ MD Q+ EI G E+
Sbjct: 745 VLLAEDSVVNQKVALSMLGKLGCFPDVAANGREAIDAMRQKRYDLVFMDCQMPEIDGYEV 804

Query: 65  TKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T++I++D  L    +IPV+A+TA AMKGD E+    G + +++KP+  S F    ++Y 
Sbjct: 805 TRRIRKDHSLLCSPDIPVVAMTANAMKGDREKCIDAGMDDFMAKPLKKSDFQAIFERYF 863


>gi|330809931|ref|YP_004354393.1| histidine kinase, Hybrid [Pseudomonas brassicacearum subsp.
            brassicacearum NFM421]
 gi|327378039|gb|AEA69389.1| putative Histidine kinase, Hybrid [Pseudomonas brassicacearum subsp.
            brassicacearum NFM421]
          Length = 1160

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +KV++V+D+  N+      +E  G I +  RNG+EA++   +    D+++MD+ + E+ G
Sbjct: 1036 RKVLLVDDDVRNIFALTSALEAKGAIVVIGRNGLEAIDRLNEFDDIDLVLMDVMMPEMDG 1095

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T  I++D   +++P+IAVTA AMK D+ER    G   Y++KPI L      I+ ++
Sbjct: 1096 FEATALIRKDPRWRKLPIIAVTAKAMKDDQERCLAAGSNDYLAKPIDLDRLFSLIRVWL 1154



 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E  +LA Q  PD I++D++L + SGL +
Sbjct: 770 ILVIEDEPKFARILFDLAHELGYQCLVAHGADEGFDLALQLAPDAILLDMRLPDHSGLTV 829

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +E + IPV  ++       E+R+      G   Y  KP +
Sbjct: 830 LQRLKERAETRHIPVHVISV------EDRVEAAMHMGAIGYAVKPTT 870



 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED++L       LI              +AL+L R +  D +I+D++L ++ G
Sbjct: 889 VKRVLLVEDDDLQRDSITRLIGDDDIEITAVGLAQQALDLLRSNVYDCMIIDLKLPDMLG 948

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            ++ K++  +      PVI  T   +  DEE
Sbjct: 949 NDLLKRMSSEDICSFPPVIVYTGRNLTRDEE 979


>gi|260439089|ref|ZP_05792905.1| putative response regulator receiver domain protein [Butyrivibrio
            crossotus DSM 2876]
 gi|292808401|gb|EFF67606.1| putative response regulator receiver domain protein [Butyrivibrio
            crossotus DSM 2876]
          Length = 1103

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 79/124 (63%), Gaps = 4/124 (3%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEISG 61
            +K++IVEDNE+N+ +  D ++         RNG++A    +Q H  D ++MDI++  + G
Sbjct: 979  RKILIVEDNEINIDIISDYLDDVEIKYDSVRNGLDAYNRIKQNHSYDCVLMDIKMPVMDG 1038

Query: 62   LEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             E T++I+  +D  ++++P+IA+TA A   D ++ ++ G   +I+KP++L +F   IKK+
Sbjct: 1039 YEATRKIRALDDDYVRKLPIIAMTANAFAEDVQKSKEAGMNDHITKPVNLELFYSVIKKH 1098

Query: 120  -IGE 122
             IGE
Sbjct: 1099 MIGE 1102


>gi|254881605|ref|ZP_05254315.1| two-component system sensor histidine kinase [Bacteroides sp.
           4_3_47FAA]
 gi|319642990|ref|ZP_07997624.1| sensor protein [Bacteroides sp. 3_1_40A]
 gi|254834398|gb|EET14707.1| two-component system sensor histidine kinase [Bacteroides sp.
           4_3_47FAA]
 gi|317385355|gb|EFV66300.1| sensor protein [Bacteroides sp. 3_1_40A]
          Length = 781

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 76/118 (64%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++ ED + N  L + L+     + L  +NG +A+   ++H+PD+I+MDI++  + GL
Sbjct: 666 RTVLVAEDVDSNFLLLKTLLGKRCNL-LWAKNGEDAVNQFKEHQPDLILMDIKMPHMDGL 724

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+  S  +E+P++A+TAFA + D++R  + GC+  ++KP+S +   + + KY+
Sbjct: 725 EATRLIRSYS--KEVPIVALTAFAFESDKDRAIEAGCDDCLTKPVSQNALEKVLDKYV 780


>gi|237722776|ref|ZP_04553257.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_2_4]
 gi|229447298|gb|EEO53089.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_2_4]
          Length = 1331

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+++TS Y      NG +AL + R+  PD +I DI + E+SG
Sbjct: 1065 LQRILIVEDNDDLRNYLVDMLKTS-YNIQACPNGKDALIIIREFNPDFVISDIMMPEMSG 1123

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI+KP S+ I   TIK 
Sbjct: 1124 DELCSAIKGDLEMSHIPVVLLTAL---GDEKNMLEGLEIGADAYITKPFSVGILKATIKN 1180

Query: 119  YIG 121
             + 
Sbjct: 1181 LLA 1183


>gi|239905642|ref|YP_002952381.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795506|dbj|BAH74495.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 754

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ ED  +N    + L +  G       NG+ ALEL  Q+  D+++MDIQ+ E+ G++
Sbjct: 628 KILLAEDERVNQIALQHLAKKIGLFIDVANNGIAALELLSQNNYDLVLMDIQMPELDGIQ 687

Query: 64  ITKQIKED-SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T++I+   +    IP+IA+TA+AM GD+E   + G   Y+SKPI  +  ++ ++KY
Sbjct: 688 TTQRIRASKTTYANIPIIALTAYAMPGDKEMFIESGMNDYLSKPIEFNNLIQILQKY 744


>gi|283852097|ref|ZP_06369371.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283572487|gb|EFC20473.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 1340

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N     DL+E+ G+      NG  AL+   + + DV++MDIQ+  + GL 
Sbjct: 1089 RILLVEDNRVNRVFAGDLLESRGHEVAMAENGRAALDFLARERVDVVLMDIQMPVMDGLA 1148

Query: 64   ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
             T+ I+  E      +PV+ ++A+AM  + ER    G + YI+KPI +  F E ++
Sbjct: 1149 ATRAIRAGEGGIDPTLPVVGLSAYAMDQERERFLAAGLDGYITKPIDVEAFFEVVR 1204


>gi|210622339|ref|ZP_03293108.1| hypothetical protein CLOHIR_01056 [Clostridium hiranonis DSM 13275]
 gi|210154327|gb|EEA85333.1| hypothetical protein CLOHIR_01056 [Clostridium hiranonis DSM 13275]
          Length = 232

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 72/106 (67%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+I++D    ++L R  +ETSGY  + + +G +    A++ KPD+I++D  L  ISG+E
Sbjct: 7   KVLIIDDEMHIVELLRFNLETSGYKTIYSYDGFDGFIKAKEEKPDLILLDWMLPNISGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           + K+I++D++L++IPVI +TA  M+ D+    + G + YI+KP S+
Sbjct: 67  VLKKIRQDADLKKIPVIMLTAKNMEDDKVEGLEVGADDYITKPFSI 112


>gi|268679228|ref|YP_003303659.1| ATP-binding region ATPase domain protein [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617259|gb|ACZ11624.1| ATP-binding region ATPase domain protein [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 1068

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++ EDNE+N KL R  +E  G       NG++ALE  +    D+I MDI +  + G+E
Sbjct: 771 NVLVAEDNEINQKLIRRTLEDLGLNITIVPNGLQALERRKTDTFDMIFMDIAMPVMDGIE 830

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS-------LSIFM 113
            T +I   +E +    IP++A+TA A+KGD ER  K G + YI+KPI        L++FM
Sbjct: 831 ATHKILEYEEKNHQTHIPIVAITANALKGDRERFMKEGLDEYITKPIKKDNIINILNVFM 890

Query: 114 ET 115
             
Sbjct: 891 HN 892


>gi|288942572|ref|YP_003444812.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
 gi|288897944|gb|ADC63780.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
          Length = 1705

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 1/120 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGLE 63
            V++VEDNELN +L  +L+ ++G       NG EALE LA + + D ++MD Q+  + G  
Sbjct: 1368 VLLVEDNELNQELALELLVSNGLSVEIAANGREALERLAGESRFDGVLMDCQMPVMDGYT 1427

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T+ I+E  EL  +PVIA+TA  M GD E+    G   +I KPI++     T+ K+I  A
Sbjct: 1428 ATRAIREQPELAGLPVIAMTANVMSGDREKALAAGMNDHIGKPINVREMFATLAKWIRPA 1487



 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR---QHKP-DVIIMDIQLQEI 59
            ++++V+DN    ++   ++   G+      +G EAL+  R   + +P D+++MD ++ E+
Sbjct: 1218 RILVVDDNATAREILTQMLLAFGFAVESAASGREALDRLRVVDRLEPFDLVLMDWKMPEM 1277

Query: 60   SGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             G+E  +++   +E+ + P +I VTA+  +   +   + G   +++KP++ S  ++ I  
Sbjct: 1278 DGIETIRRLCAQTEITQAPALIMVTAYGHEAAHQVAVELGVSGFLTKPVTSSNLLDAIMH 1337

Query: 119  YIG 121
             +G
Sbjct: 1338 AVG 1340


>gi|300866840|ref|ZP_07111517.1| Sensor protein [Oscillatoria sp. PCC 6506]
 gi|300335150|emb|CBN56677.1| Sensor protein [Oscillatoria sp. PCC 6506]
          Length = 1017

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 67/118 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED  +N  L   L+E+ G+      NG+EA+   +   P +I MDI++ E+ G E
Sbjct: 813 RILVAEDVLVNRHLLVTLLESVGFEVCAVTNGIEAIACWQDWHPHLIFMDIEMPEMDGYE 872

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+QI+       + ++A+TA+A + D     + GC+ YI+KP + +I  + I  Y+G
Sbjct: 873 ATRQIRARGVQDNVAIVALTAYAFEEDRTASLQAGCDDYIAKPFTETILFDKIAHYLG 930


>gi|119898741|ref|YP_933954.1| putative two-component system sensor protein [Azoarcus sp. BH72]
 gi|119671154|emb|CAL95067.1| putative two-component system sensor protein [Azoarcus sp. BH72]
          Length = 916

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 69/117 (58%), Gaps = 1/117 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGME-ALELARQHKPDVIIMDIQLQEISG 61
           ++++ V+DN  N+KL   L+    +I L + +  E  LELAR H+PD+I++DI +  + G
Sbjct: 785 RRILCVDDNPANLKLVAQLLGRRSHIRLTSAHTPELGLELARVHRPDLILLDINMPGMDG 844

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            ++  ++  D  L+ +PVIAVTA A+  D ER R  G   YI KP+ +  F   I +
Sbjct: 845 YQMLAELAADERLRHVPVIAVTANALPRDIERGRAAGFADYIVKPLVIDSFFAAIDR 901


>gi|283851785|ref|ZP_06369063.1| histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283572905|gb|EFC20887.1| histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 310

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N    ++L+   G+      +G EALE  R    D+++MDI +  + G+E
Sbjct: 189 KILLAEDNPINRLFLQELLRNEGHSITYAADGQEALEALRTEAFDIVLMDISMPRMDGIE 248

Query: 64  ITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T++I+E    +   +IP++A+TA A + D ER  K G + Y+SKPI  +   E + KY
Sbjct: 249 ATRRIRESVSGKINAKIPIVALTAHAFRVDAERFLKAGMDGYLSKPIDPAKLKEILGKY 307


>gi|239904806|ref|YP_002951544.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239794669|dbj|BAH73658.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 972

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++ ED+ L+    + ++E SGY      +G +AL+L  +   D+I+MD+Q+  + G+
Sbjct: 845 RRILLAEDDALSSLTCKRMLEKSGYSVAAANDGQKALQLLTEQDFDLILMDVQMPVMDGV 904

Query: 63  EITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           E TK I+  S L     IP++A+TA+AM GD+E+    G + YI+KP+     +E +++ 
Sbjct: 905 EATKAIRGSSILGVKSSIPIVAMTAYAMSGDKEKFLASGMDDYIAKPVDKEALVEVVERV 964

Query: 120 I 120
           +
Sbjct: 965 L 965


>gi|152991089|ref|YP_001356811.1| two-component sensor histidine kinase/response regulator
           [Nitratiruptor sp. SB155-2]
 gi|151422950|dbj|BAF70454.1| two-component sensor histidine kinase/response regulator
           [Nitratiruptor sp. SB155-2]
          Length = 1044

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K ++ EDN +N KL +  +E  G       NG+EA E  +    D+I MDIQ+  + G+E
Sbjct: 775 KALVAEDNTINQKLIKKTLEDLGLTVDLANNGLEAFEKRKNGDYDIIFMDIQMPIMDGVE 834

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T +I   +E+S    IP+IA+TA A+KGD ER    G + YI+KP+  +  +  +KK++
Sbjct: 835 ATHEILEYEEESNQPHIPIIALTAHALKGDRERYINEGMDEYITKPLIKNELVAILKKFL 894


>gi|239907183|ref|YP_002953924.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239797049|dbj|BAH76038.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 624

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN +N    ++L+E  G+  +    G  ALE  R+ + D ++MDIQ+ E+ G+E 
Sbjct: 376 VLLAEDNPINQIYVQELLEMDGHEVVVAHTGRRALEALRKKRFDAVLMDIQMPEMDGIEA 435

Query: 65  TKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+ I+ D+       IP++A+TA A+KGD E   + G   Y+SKP+S +     + +  G
Sbjct: 436 TRAIRSDASGDFDPAIPIVALTAHALKGDRETFLRAGMNEYLSKPVSPADLEAALGRVTG 495

Query: 122 EA 123
            A
Sbjct: 496 GA 497


>gi|160890817|ref|ZP_02071820.1| hypothetical protein BACUNI_03262 [Bacteroides uniformis ATCC 8492]
 gi|156859816|gb|EDO53247.1| hypothetical protein BACUNI_03262 [Bacteroides uniformis ATCC 8492]
          Length = 1034

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N  LF+ +++   Y  +   +G EA+EL ++  P V+IMDI + ++ G E 
Sbjct: 915  ILIAEDNESNYMLFKSILQ-KDYELVHAWDGEEAVELHQKFHPHVVIMDINMPKMDGYEA 973

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T++I++ S  + +P+IAVTA++   D+E+I + G   Y+SKP+ +
Sbjct: 974  TREIRKVS--KTVPIIAVTAYSFASDKEKIMQNGFNGYMSKPVDI 1016


>gi|127512132|ref|YP_001093329.1| hybrid sensory histidine kinase BarA [Shewanella loihica PV-4]
 gi|126637427|gb|ABO23070.1| Hpt sensor hybrid histidine kinase [Shewanella loihica PV-4]
          Length = 933

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+DN  N+KL + L++        T NG EA+E+A+    D+I MDIQ+    G   
Sbjct: 688 VLAVDDNPANLKLIKTLLKELVTQVTVTDNGQEAVEIAKAKSFDLIFMDIQMPGTDGFSA 747

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           TKQI+E S  +  P++AVTA A+  + ERI + G + Y+ KPI  +     I ++
Sbjct: 748 TKQIREHSLNRNTPIVAVTAHAIAEERERIDQSGMDGYLPKPIDEAALKSVISRW 802


>gi|330508123|ref|YP_004384551.1| two-component hybrid sensor and regulator [Methanosaeta concilii
           GP-6]
 gi|328928931|gb|AEB68733.1| two-component hybrid sensor and regulator [Methanosaeta concilii
           GP-6]
          Length = 808

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N K+ + ++   GY A    NG+E L    +   DVI+MDIQ+ E+ GL+
Sbjct: 674 RILVAEDNIINQKVIKKMLHKLGYRADVAANGLEVLVALDRQDYDVILMDIQMPEMDGLD 733

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             ++I+E      +P +IA+TAFAM+GD+E+    G + YISKP++L
Sbjct: 734 AARKIRETRP--TLPKIIAITAFAMEGDKEKCIDSGMDGYISKPVNL 778


>gi|270295813|ref|ZP_06202013.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270273217|gb|EFA19079.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 978

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N  LF+ +++   Y  +   +G EA+EL ++  P V+IMDI + ++ G E 
Sbjct: 859 ILIAEDNESNYMLFKSILQ-KDYELVHAWDGEEAVELHQKFHPHVVIMDINMPKMDGYEA 917

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           T++I++ S  + +P+IAVTA++   D+E+I + G   Y+SKP+ +
Sbjct: 918 TREIRKVS--KTVPIIAVTAYSFASDKEKIMQNGFNGYMSKPVDI 960


>gi|294660058|ref|XP_462511.2| DEHA2G22286p [Debaryomyces hansenii CBS767]
 gi|199434441|emb|CAG91021.2| DEHA2G22286p [Debaryomyces hansenii]
          Length = 1116

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 72/125 (57%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N KL   ++E  G+      NG+EA E  ++ K DV++MD+Q+  + G E
Sbjct: 866 NILLAEDNLVNQKLAVKILEKQGHHVEVVENGLEAFEALQKTKYDVVLMDVQMPVMGGFE 925

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
            T++I++        DS     P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 926 ATEKIRQWEKKSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 985

Query: 116 IKKYI 120
           I K I
Sbjct: 986 ISKCI 990


>gi|94263808|ref|ZP_01287614.1| PAS [delta proteobacterium MLMS-1]
 gi|93455819|gb|EAT05986.1| PAS [delta proteobacterium MLMS-1]
          Length = 1049

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN  N ++ + +++  G  A    NG EA+E  +    D+++MD+Q+ E+ GLE
Sbjct: 789 RILLAEDNITNQQVAQGILKKLGLSADAVANGREAIEALKTLPYDLVLMDVQMPEMDGLE 848

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+QI+        + IP+IA+TA AM+GD E+    G   Y++KP+S     E ++K++
Sbjct: 849 ATRQIRNPKSPIPNRNIPIIAMTAHAMQGDREKFLAAGMNDYVAKPVSPQDLAEALEKWL 908

Query: 121 GE 122
            E
Sbjct: 909 PE 910


>gi|17228780|ref|NP_485328.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17130632|dbj|BAB73242.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 603

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 68/117 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VED+  N +L +  +   GY     +N  E      + +  VI+MD++L +  GL
Sbjct: 484 KEILLVEDDLPNGELMQTHLSKLGYNVTWVKNAHEMWAKLDEQQAAVILMDVRLPDGDGL 543

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           ++ KQ++E S+ Q+IP+IA TA AMKGD       G   YISKPI L++    + KY
Sbjct: 544 DLVKQLREKSQYQQIPIIAQTAMAMKGDRAVCLSAGVNDYISKPIDLNLLASLVAKY 600


>gi|162451226|ref|YP_001613593.1| two-component response regulator [Sorangium cellulosum 'So ce 56']
 gi|161161808|emb|CAN93113.1| two-component response regulator [Sorangium cellulosum 'So ce 56']
          Length = 142

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 61/102 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D + N ++F + +  SG+   +   G EAL+ A +  PD+I+MD+ L EI G E 
Sbjct: 14  VLVVDDFQDNREMFAEYLSFSGFRVAEAATGREALDRAFELIPDLILMDLSLPEIDGWEA 73

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           T+ +K D     IP++A+T   + G     +  GC+A+++KP
Sbjct: 74  TRHLKSDPRTMRIPIVALTGHTLAGHSREAKDAGCDAFLTKP 115


>gi|327439034|dbj|BAK15399.1| signal transduction histidine kinase [Solibacillus silvestris
           StLB046]
          Length = 899

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
           K ++IV+D+  N+   R  +E  G   L+  NG+E L  L    + D ++MDI + E+ G
Sbjct: 772 KHILIVDDDYRNIYALRQALEHKGVHILEASNGVECLNILQTATRVDAVLMDIMMPEMDG 831

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            E  ++I++D +L E+P+IA+TA AMK D++R  + G   YISKP++L
Sbjct: 832 YETMERIRKDLQLHELPIIALTAKAMKQDQDRAFEAGASDYISKPLNL 879


>gi|170741714|ref|YP_001770369.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168195988|gb|ACA17935.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 125

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 64/120 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED+E         +   GY  +   +G   ++ AR  +PDVI++D+ L  + G
Sbjct: 1   MTKILLVEDHEEIWDFLSRRLTRRGYEVVMAHDGDAGVQQARSLRPDVILLDMNLPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + +K   + Q IP+IA+TA AM GD E+  + GC+ Y  KPI  +  +  I    G
Sbjct: 61  WSVARALKSSPDTQSIPIIALTAHAMSGDREKAIQAGCDDYHPKPIDFAKLLGQIGAVTG 120


>gi|119485370|ref|ZP_01619698.1| Response regulator receiver domain protein (CheY) [Lyngbya sp. PCC
           8106]
 gi|119457126|gb|EAW38252.1| Response regulator receiver domain protein (CheY) [Lyngbya sp. PCC
           8106]
          Length = 158

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 71/119 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+DN+ N+ L   ++E  GY  L   +  EAL L + ++P +I++DI L +I GL++
Sbjct: 20  VLAVDDNQDNLILIGCVLENLGYPYLSAGSSQEALSLLQHYQPKLILLDIVLPDIDGLQL 79

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +QI+ D  + +  ++AVT  A+  D +R+   G + Y+SKP  LS     + +Y+ ++
Sbjct: 80  LRQIRGDQRIHQTTIVAVTGLALGQDRQRLLAAGFDDYLSKPYLLSDLEALVCRYLTQS 138


>gi|332711875|ref|ZP_08431805.1| response regulator receiver domain protein [Lyngbya majuscula 3L]
 gi|332349203|gb|EGJ28813.1| response regulator receiver domain protein [Lyngbya majuscula 3L]
          Length = 133

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 76/115 (66%), Gaps = 9/115 (7%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIAL-QTRNGMEALELARQHKPDVIIMDIQL---- 56
           +K V+IVED+ +N ++F  ++   G + +  T +  E ++LA+  +PD+I+MD+ L    
Sbjct: 1   MKTVLIVEDDPINARVFAKILTKRGGLNVKHTEDVEEVMQLAQAGEPDIILMDVSLAHSV 60

Query: 57  ---QEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEER-IRKGGCEAYISKPI 107
              Q + G++IT+ +K D++  ++P+I VTA AM+GD E+ +++ G + YISKP+
Sbjct: 61  YQGQSVDGIKITQMLKADADTSKLPIILVTAHAMEGDREKFLKQSGADDYISKPV 115


>gi|121710420|ref|XP_001272826.1| two-component osmosensing histidine kinase (Bos1), putative
            [Aspergillus clavatus NRRL 1]
 gi|119400976|gb|EAW11400.1| two-component osmosensing histidine kinase (Bos1), putative
            [Aspergillus clavatus NRRL 1]
          Length = 1341

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1151 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1210

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1211 TGKIREYEREAGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1267


>gi|303246174|ref|ZP_07332455.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
            JJ]
 gi|302492570|gb|EFL52441.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
            JJ]
          Length = 1620

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 73/120 (60%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            KV++VEDN +N ++ R+L+  +G       NG  A+E+ ++ + D ++MD Q+  + G E
Sbjct: 1135 KVLLVEDNAINQEVARELLARNGVRTKVADNGRTAMEMLQKERFDGVLMDCQMPVMDGYE 1194

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T++I+     +++P+IA+TA  M GD+E+    G  A+I KPI+     +T+ ++I  A
Sbjct: 1195 ATRKIRAMGGFEDLPIIAMTANVMAGDKEKCLACGMNAHIGKPINFKELSQTLGRWITPA 1254



 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR---QHKP-DVIIMDIQLQEIS 60
            V++V+DN     +F  ++   G+ A    +G EAL L     Q +P D+ I+D  L ++S
Sbjct: 985  VLVVDDNSAARDIFLGMLTRFGFQAEAAASGKEALALLEEKGQERPYDMAIIDWVLPDMS 1044

Query: 61   GLEITKQIKEDSELQEIPVIAVTA 84
            G E+ + +++  ++   P I + A
Sbjct: 1045 GRELCQALRDAPKIDPKPKIILAA 1068


>gi|299147659|ref|ZP_07040723.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. 3_1_23]
 gi|298514446|gb|EFI38331.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. 3_1_23]
          Length = 1343

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 74/123 (60%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L++++IVEDN+       D+++TS Y      NG +AL + R+  PD++I DI + E+SG
Sbjct: 1077 LQRILIVEDNDDLRNYLVDMLKTS-YNIQACPNGKDALIIIREFNPDLVISDIMMPEMSG 1135

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK D E+  IPV+ +TA    GDE+ + +G   G +AYI++P S+ I   TIK 
Sbjct: 1136 DELCSAIKGDLEMSHIPVVLLTAL---GDEKNMLEGLEIGADAYITRPFSVGILKATIKN 1192

Query: 119  YIG 121
             + 
Sbjct: 1193 LLA 1195


>gi|119498321|ref|XP_001265918.1| two-component osmosensing histidine kinase (Bos1), putative
            [Neosartorya fischeri NRRL 181]
 gi|119414082|gb|EAW24021.1| two-component osmosensing histidine kinase (Bos1), putative
            [Neosartorya fischeri NRRL 181]
          Length = 1336

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  +Q + DVI+MD+Q+  + G E 
Sbjct: 1146 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKQRRYDVILMDVQMPVMGGFEA 1205

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1206 TGKIREYEREAGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1262


>gi|330859215|emb|CBX69566.1| signal transduction histidine-protein kinase barA [Yersinia
           enterocolitica W22703]
          Length = 976

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 74/120 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 669 KVMAVDDNPANLKLMGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            ++ I + S  Q+ P+IAVTA  ++G +E++ K G   Y++KPI  +  ++ + +Y+ + 
Sbjct: 729 ASEVIHQMSHHQDTPIIAVTAHTVRGQQEQLLKLGMADYLAKPIDEARLIQALSRYLPDG 788


>gi|332160479|ref|YP_004297056.1| hybrid sensory histidine kinase BarA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325664709|gb|ADZ41353.1| hybrid sensory histidine kinase BarA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 956

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 74/120 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 669 KVMAVDDNPANLKLMGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            ++ I + S  Q+ P+IAVTA  ++G +E++ K G   Y++KPI  +  ++ + +Y+ + 
Sbjct: 729 ASEVIHQMSHHQDTPIIAVTAHTVRGQQEQLLKLGMADYLAKPIDEARLIQALSRYLPDG 788


>gi|318607055|emb|CBY28553.1| bara sensory histidine kinase (= VarS = GacS) [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 847

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 74/120 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 669 KVMAVDDNPANLKLMGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 728

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            ++ I + S  Q+ P+IAVTA  ++G +E++ K G   Y++KPI  +  ++ + +Y+ + 
Sbjct: 729 ASEVIHQMSHHQDTPIIAVTAHTVRGQQEQLLKLGMADYLAKPIDEARLIQALSRYLPDG 788


>gi|254423730|ref|ZP_05037448.1| PAS fold family [Synechococcus sp. PCC 7335]
 gi|196191219|gb|EDX86183.1| PAS fold family [Synechococcus sp. PCC 7335]
          Length = 774

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 71/115 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED  LN K+   +I + GY A    NG EA+E  + H  D+++MD+Q+ E+ GLE
Sbjct: 639 RILLAEDIALNQKVALYMITSFGYQADVANNGKEAVEALQSHAYDLVLMDVQMPEMDGLE 698

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T+ I+ +S + +  ++A+TA A++GD E     G   YI KPI+    ++T+++
Sbjct: 699 ATRIIRANSNIVQPHIVAMTAHALQGDREECLSAGMNGYIRKPITKDELLKTLQQ 753


>gi|197117138|ref|YP_002137565.1| chemotaxis protein CheY [Geobacter bemidjiensis Bem]
 gi|197086498|gb|ACH37769.1| chemotaxis protein CheY [Geobacter bemidjiensis Bem]
          Length = 132

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED E  +KL   L  + GY     R G++AL    Q +PD++++DI L ++ G E
Sbjct: 5   RILVVEDEESLLKLESILFTSKGYQVTGVRGGVDALRSISQDRPDLVVLDIMLPDMDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           + + IKED E + IPV+ +TA     D E  R  G +AYI+KP      +E I
Sbjct: 65  VCRSIKEDPETRSIPVVMLTAKKSSRDLEAGRVAGADAYITKPFKSVKVLEVI 117


>gi|302340600|ref|YP_003805806.1| multi-sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
 gi|301637785|gb|ADK83212.1| multi-sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
          Length = 802

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 71/117 (60%), Gaps = 2/117 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED+E+N +LF+ ++E+ G+      NG EA++     + D+I MD+Q+ E++G E 
Sbjct: 557 ILVAEDHEVNQQLFKTILESFGHEVDLASNGKEAVQATHGRRYDLIFMDVQMPEMNGYEA 616

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T  I+  S   + P++AVTA A++G+EER R  G   ++ KP      +  + +++G
Sbjct: 617 TSAIR--SSGIDTPIVAVTASALRGEEERCRNVGMSGFLVKPFKKRDLIPVLDRWLG 671



 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 7/126 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD-----VIIMDIQLQE 58
           KV++V+D     +     +   G     + NG  AL++ R    +     + I+D  +  
Sbjct: 396 KVLVVDDTPSVREAVCAYLSEWGCSIECSSNGPAALDVLRSQAAEGNGFTLCIVDQMMPG 455

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR-KGGCEAYISKPISLS-IFMETI 116
           + G +   ++  D  L+ I +  ++     GDE +++       Y+SKPI  S +F E +
Sbjct: 456 MDGWQFASEVNSDESLRGIRLFLMSPSGKSGDEAKMKLLHWYHGYLSKPIRKSRLFREMV 515

Query: 117 KKYIGE 122
           K ++G+
Sbjct: 516 KCFLGD 521


>gi|329910717|ref|ZP_08275359.1| CheY-like response regulator domain [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546108|gb|EGF31170.1| CheY-like response regulator domain [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 141

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 69/120 (57%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +V+I+EDN  +M+L   L++  G+  L   +G   + LA    PD+I+ D+ L  + 
Sbjct: 1   MPARVLIIEDNPASMELMVCLLQAYGHTVLLAPDGAAGIALAASAMPDLIVCDVHLPCMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + +K+ + L  IP++AVTA AM GD + +   G + YI KPI  + F+  ++ ++
Sbjct: 61  GYGVVRHLKKQAALARIPIVAVTALAMVGDRKNLLSAGFDGYIGKPIEPTSFIPQLEMFL 120


>gi|262165591|ref|ZP_06033328.1| hypothetical protein VMA_002038 [Vibrio mimicus VM223]
 gi|262025307|gb|EEY43975.1| hypothetical protein VMA_002038 [Vibrio mimicus VM223]
          Length = 1325

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 72/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K+++VEDNE+N ++   L+E +G       NG EALE       D+++MD+Q+  + G+
Sbjct: 992  QKLLLVEDNEVNQEVALGLLEETGLSVTIANNGQEALEKLENADFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK I+ +   + +P++A+TA AM  D ER  + G   ++SKPI +  F + +K+++
Sbjct: 1052 TATKYIRTNGRWKNLPIVAMTANAMATDIERCLQVGMNGHLSKPIEVDKFYQVLKQFL 1109



 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKP-DVIIMDIQLQEIS 60
           K+V++V+DN+    +   L+    +  +   NG EAL EL  QHKP D++  D  +  ++
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEL--QHKPFDMLFADWNMPGMN 909

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+  ++K            VTA+    + +       +A I KP++ S  ++ I    
Sbjct: 910 GIELLTRVKSLGLRDHTKCFLVTAYGRDINLDSENSKLIDALIVKPVNPSNLLDAIVTSY 969

Query: 121 G 121
           G
Sbjct: 970 G 970


>gi|288941589|ref|YP_003443829.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
 gi|288896961|gb|ADC62797.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
          Length = 755

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 73/119 (61%), Gaps = 2/119 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH--KPDVIIMDIQLQEISGL 62
           V+ V+DN  N+++   L+   G  A   R+G EALE  R H  + D ++MD+Q+  + GL
Sbjct: 415 VLAVDDNASNLEVITRLLALEGANATPARHGREALEQLRAHPWRFDAVLMDVQMPVMDGL 474

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             T+ I+ D +   +PVIA++A  ++ +++R R+ GC  +++KP+ L   +E + +++G
Sbjct: 475 SATRAIRRDLKRPALPVIALSAGVLREEQQRAREAGCNDFLAKPVELEHLVERLLRWVG 533


>gi|22086084|gb|AAM90591.1|AF398464_1 protein kinase PpoS [Marinomonas mediterranea MMB-1]
          Length = 939

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 77/116 (66%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++ V+D ++N++L    +E  G       +G +A+E+A++ + D+I+MDIQ+ E+ G+E
Sbjct: 695 QILAVDDTQINLQLLGHWLEPHGLQVDLAYSGKQAIEMAKETQYDLILMDIQMPEMDGME 754

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+++++ +     P++A+TA A+  ++++I   G  AY++KP++  I +ETI ++
Sbjct: 755 ATQRLRKLTNYVHTPIVALTAHALGSEQKQIVSSGMNAYLTKPVNEDILLETITQW 810


>gi|326794409|ref|YP_004312229.1| multi-sensor hybrid histidine kinase [Marinomonas mediterranea
           MMB-1]
 gi|326545173|gb|ADZ90393.1| multi-sensor hybrid histidine kinase [Marinomonas mediterranea
           MMB-1]
          Length = 939

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 77/116 (66%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++ V+D ++N++L    +E  G       +G +A+E+A++ + D+I+MDIQ+ E+ G+E
Sbjct: 695 QILAVDDTQINLQLLGHWLEPHGLQVDLAYSGKQAIEMAKETQYDLILMDIQMPEMDGME 754

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+++++ +     P++A+TA A+  ++++I   G  AY++KP++  I +ETI ++
Sbjct: 755 ATQRLRKLTNYVHTPIVALTAHALGSEQKQIVSSGMNAYLTKPVNEDILLETITQW 810


>gi|298482642|ref|ZP_07000826.1| two-component system sensor histidine kinase [Bacteroides sp. D22]
 gi|298271105|gb|EFI12682.1| two-component system sensor histidine kinase [Bacteroides sp. D22]
          Length = 637

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 73/119 (61%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++VED E N     ++     YI    RNG EA+    + KPD+I+MDI++  + G+
Sbjct: 522 KKILVVEDIESNFVQL-NIFLNKEYIISWVRNGQEAINSFIREKPDLILMDIRMPIMDGI 580

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T++I+  S    +P+IAVTA+A   ++++  + GC A ISKP SL    ETI+ YIG
Sbjct: 581 QATEKIRTIS--LTVPIIAVTAYAFYTEQQQAIQAGCNAVISKPYSLERLKETIESYIG 637


>gi|298530758|ref|ZP_07018160.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
 gi|298510132|gb|EFI34036.1| PAS/PAC sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
          Length = 1186

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 67/116 (57%), Gaps = 10/116 (8%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ ED+  N    + ++E  G+I L  +NG EALE  ++H  D I+MDI +  + G+E
Sbjct: 1056 RVLLAEDDPSNRFFMQKVLEREGHIPLIAQNGQEALEQFQKHAFDCILMDINMPVMDGME 1115

Query: 64   ITKQIK----------EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             TK+I+          ED     IP+IA+TA AM GD ER  + G   Y+SKP+ +
Sbjct: 1116 ATKEIRRLEAGGSRQEEDGTYPAIPIIALTAHAMGGDRERFLEMGMNDYLSKPVQV 1171


>gi|167630674|ref|YP_001681173.1| two-component system sensor protein [Heliobacterium modesticaldum
           Ice1]
 gi|167593414|gb|ABZ85162.1| two-component system sensor protein [Heliobacterium modesticaldum
           Ice1]
          Length = 305

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 74/119 (62%), Gaps = 4/119 (3%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTR-NGMEALELARQHKPDVIIMDIQLQEISGLE 63
           V++VEDN +N+K+ R  ++  G   + T  NG EA++LARQ++  +I+MD Q+  + G  
Sbjct: 31  VLVVEDNPINLKMIRSQLKQLGIDMIHTAVNGNEAVQLARQNQYGLILMDCQMPVMDGYS 90

Query: 64  ITKQIKEDSELQEI--PVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T  I+ + E QE   P++AVTA A+ GD E+  + G + YISKP+ L    E ++ ++
Sbjct: 91  ATALIRAN-EGQETHTPIVAVTAHALPGDREKCLEAGMDDYISKPVRLQRLFEALQCWL 148


>gi|332704411|ref|ZP_08424499.1| Hpt sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554560|gb|EGJ51604.1| Hpt sensor hybrid histidine kinase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 600

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VEDN++N    R+++   G+  +   NG EA+++  + + D+++MDIQ+  + G+E
Sbjct: 347 SVLLVEDNKVNQLFTREMLLAEGHSVIVAENGQEAVDILARQRFDIVLMDIQMPVMDGVE 406

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T+ I++ S      ++P+IA+TA A+KGD ER  + G   Y++KP+  
Sbjct: 407 ATRTIRDPSSAVLDHDVPIIALTAHAIKGDRERFIQAGMTDYLTKPVDF 455


>gi|254475084|ref|ZP_05088470.1| multi-sensor hybrid histidine kinase [Ruegeria sp. R11]
 gi|214029327|gb|EEB70162.1| multi-sensor hybrid histidine kinase [Ruegeria sp. R11]
          Length = 843

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 69/112 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ +DN+ N  L    ++++    ++  NG EA++L R H PD+I+MD+ + E+ G+E 
Sbjct: 711 LILADDNQTNRLLINKYLQSTPLDIIEATNGREAVDLCRTHAPDIILMDMSMPEVDGIEA 770

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           T+QI+ D+++ +  +IA+TA A + D       G   ++ KPI  ++ +ETI
Sbjct: 771 TRQIRADADINQPIIIALTANAFESDRRACLDAGMNHFLQKPIRKALLLETI 822


>gi|238786791|ref|ZP_04630592.1| Signal transduction histidine-protein kinase barA [Yersinia
           frederiksenii ATCC 33641]
 gi|238725159|gb|EEQ16798.1| Signal transduction histidine-protein kinase barA [Yersinia
           frederiksenii ATCC 33641]
          Length = 911

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 73/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 660 KVMAVDDNPANLKLIGTLLEELVEETMLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 719

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S  Q+ P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + +Y
Sbjct: 720 ASEIIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQALSRY 775


>gi|153830878|ref|ZP_01983545.1| sensor histidine kinase/response regulator [Vibrio cholerae 623-39]
 gi|148873647|gb|EDL71782.1| sensor histidine kinase/response regulator [Vibrio cholerae 623-39]
          Length = 714

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 454 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 513

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 514 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 568


>gi|124004919|ref|ZP_01689762.1| signal transduction histidine kinase [Microscilla marina ATCC 23134]
 gi|123989597|gb|EAY29143.1| signal transduction histidine kinase [Microscilla marina ATCC 23134]
          Length = 1367

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 73/117 (62%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++IV+DN +N K+  +++  +G I     +G +AL+  + H  D+I MDIQ+  + G+E
Sbjct: 1107 RILIVDDNIVNRKVASEILNNAGCIISLAESGYQALDKVQAHSYDLIFMDIQMPGMDGVE 1166

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ IK     Q  P++A+TA++MK D ER  + G + Y+SKP+     ++ +++YI
Sbjct: 1167 TTRAIKGLGIEQLPPIVAMTAYSMKEDRERFMEEGLDDYVSKPVKAQTLIQKVQEYI 1223


>gi|329907837|ref|ZP_08274716.1| PAS/PAC sensor hybrid histidine kinase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546908|gb|EGF31823.1| PAS/PAC sensor hybrid histidine kinase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 375

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 2/110 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN +N +L   L++  G+      NG+EA+ L+ QH  DVI+MD+Q+ ++ GLE 
Sbjct: 251 VLVAEDNPVNQRLAEVLLKKWGHRFSMASNGLEAIALSAQHDFDVILMDLQMPDMGGLEA 310

Query: 65  TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIF 112
           T++I+E  +LQ    P+IA+TA A+  D +     G + YISKP+ +++ 
Sbjct: 311 TRRIREREQLQGKHTPIIAMTANALSEDRQICLDAGMDDYISKPLDVTLL 360


>gi|16330816|ref|NP_441544.1| CheY family protein [Synechocystis sp. PCC 6803]
 gi|1653309|dbj|BAA18224.1| CheY subfamily [Synechocystis sp. PCC 6803]
          Length = 123

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 67/120 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VEDNE+N  +    +   GY  +   +G +A+ +A    P +I+MD+ L  I G
Sbjct: 4   MAKVLLVEDNEMNRDMLSRRLIRKGYEVVIAVDGEQAVTMAISESPQLILMDMSLPIIDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              TKQIK   +   IP+IA+TA AM  D ER    GC+ Y +KPI +   ++ ++  I 
Sbjct: 64  WTATKQIKGHPDGAHIPIIALTAHAMASDRERAIAAGCDDYDTKPIEIKRLLQKMEALIN 123


>gi|330720374|gb|EGG98706.1| multi-sensor hybrid histidine kinase [gamma proteobacterium
           IMCC2047]
          Length = 137

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGME-ALELARQHKPDVIIMDIQLQEISGL 62
           +V+ +EDN  N++L   ++     + L   +  E  LELA  H+PD+I++DI +  + G 
Sbjct: 17  QVLYIEDNPANLRLVSHILAKRKDVDLIAAHEPELGLELANAHRPDLILLDINMPRLDGY 76

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           ++   ++ + +LQ+ PVIAV+A AM  D E+ ++ G   Y++KP+++  F+ T+ +++
Sbjct: 77  QVLALLRSNQQLQDTPVIAVSAAAMPRDIEKGKQAGFSDYLTKPLNVVAFLATVDRFL 134


>gi|153803093|ref|ZP_01957679.1| sensor histidine kinase/response regulator [Vibrio cholerae MZO-3]
 gi|229521281|ref|ZP_04410701.1| BarA sensory histidine kinase [Vibrio cholerae TM 11079-80]
 gi|124121375|gb|EAY40118.1| sensor histidine kinase/response regulator [Vibrio cholerae MZO-3]
 gi|229341813|gb|EEO06815.1| BarA sensory histidine kinase [Vibrio cholerae TM 11079-80]
          Length = 927

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|297581077|ref|ZP_06943002.1| sensor histidine kinase/response regulator [Vibrio cholerae RC385]
 gi|297534903|gb|EFH73739.1| sensor histidine kinase/response regulator [Vibrio cholerae RC385]
          Length = 927

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|298530375|ref|ZP_07017777.1| response regulator receiver modulated diguanylate cyclase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509749|gb|EFI33653.1| response regulator receiver modulated diguanylate cyclase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 301

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-KPDVIIMDIQLQEISGL 62
           +++IV+D ++N+++  DL++   Y  +  R+G +AL+LA Q  +PD+I++DI +  +SG 
Sbjct: 7   RILIVDDEKINLRVLADLLKDK-YTIMLARSGEQALKLAHQEPRPDLILLDIAMPGMSGF 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ K++K D     IPVI +TA   +  EE+  K G   YI+KPIS  I    ++ Y+
Sbjct: 66  EVIKKLKHDDATNHIPVIFITALDSREQEEKGLKLGAVDYITKPISPPIVKIRVRNYL 123


>gi|149276155|ref|ZP_01882299.1| two-component hybrid sensor and regulator [Pedobacter sp. BAL39]
 gi|149232675|gb|EDM38050.1| two-component hybrid sensor and regulator [Pedobacter sp. BAL39]
          Length = 633

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++I EDN +N+KL   ++   GY A    +G EALE+    + D+++MD+ + E+ GLE
Sbjct: 506 RILIAEDNPINIKLATTILLKLGYQADVAHDGHEALEMCIAKRYDLVLMDVMMPEMDGLE 565

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T+QI+   ++++  +IA+TA AMK D E+    G + Y+SKP+++++ M T++ 
Sbjct: 566 ATRQIRL-LDIKQPTIIAMTANAMKEDREKCLNAGMDEYLSKPLNMNLLMSTLEH 619


>gi|332704490|ref|ZP_08424578.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332554639|gb|EGJ51683.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 842

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 79/119 (66%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDNE+N  L  +L++  G+     ++G +ALE+  + + D+++MD+Q+ ++ G E
Sbjct: 718 RILLAEDNEINRFLAVELLKGLGHEVTTVQDGRQALEILSKERFDLVLMDVQMPQMHGDE 777

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +T++I+  ++    +P++A+TA+A+KGD ER    G + Y+SKPI +   +E + K IG
Sbjct: 778 VTRRIRAGEAGDPHVPIVALTAYALKGDRERFLAAGMDDYLSKPIDMQ-ELERVLKRIG 835


>gi|310819598|ref|YP_003951956.1| response regulator [Stigmatella aurantiaca DW4/3-1]
 gi|309392670|gb|ADO70129.1| Response regulator [Stigmatella aurantiaca DW4/3-1]
          Length = 132

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 70/117 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D +   +++ + +E SG+   + +NG EAL+ A +  PDVI+MD+ L  I G E 
Sbjct: 8   VLVVDDYQDAREMYAEYLEFSGFRVAEAKNGAEALDKAFELLPDVILMDLSLPIIDGWEA 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+++K D   + IPV+A+T  A+ G     +  GC++++ KP      +E +++ + 
Sbjct: 68  TRRLKNDERTKTIPVVALTGHALTGQPGGAQDAGCDSFVIKPCLPDALVEEVRRMLA 124


>gi|254492365|ref|ZP_05105537.1| hypothetical protein MDMS009_2707 [Methylophaga thiooxidans DMS010]
 gi|224462257|gb|EEF78534.1| hypothetical protein MDMS009_2707 [Methylophaga thiooxydans DMS010]
          Length = 994

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 75/123 (60%), Gaps = 3/123 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VEDN  N+ + + L++          +G +AL L  ++  D+++MD Q+  + G E
Sbjct: 864 NVLVVEDNTTNIVIIQGLLKKFNVTTDVAEDGEQALNLLAKNNYDLVLMDCQMPVMDGFE 923

Query: 64  ITKQI-KEDSEL--QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I K DS++  +EIP+IA+TA AM+GDE   R+ G + Y+SKPI   +  + + K++
Sbjct: 924 TTRTIRKADSDILNREIPIIALTAQAMRGDEAACREAGMDDYLSKPIEPRLLYDKLSKWL 983

Query: 121 GEA 123
            EA
Sbjct: 984 PEA 986


>gi|307297187|ref|ZP_07577000.1| multi-sensor hybrid histidine kinase [Sphingobium chlorophenolicum
           L-1]
 gi|306877411|gb|EFN08642.1| multi-sensor hybrid histidine kinase [Sphingobium chlorophenolicum
           L-1]
          Length = 914

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN +N +L   L+E  G+      +G +A+E   Q   DV++MD+Q+ E+ G + 
Sbjct: 783 VLVAEDNAVNQRLALRLLEKRGHRVKIVGDGAQAVEALAQDSFDVVLMDVQMPEMDGFQA 842

Query: 65  TKQIKEDSE--LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T  I+E      Q +P++A+TA AM+GD ER    G + YISKP+    F E ++     
Sbjct: 843 TAAIRERERGTGQHMPIVAMTAHAMRGDRERCLAAGMDDYISKPLRAEDFYEVVEGRFAS 902

Query: 123 A 123
           A
Sbjct: 903 A 903



 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH----KP-DVIIMDIQLQEI 59
           V+IV+DN  N ++  ++I   G   L   +G +AL   R      +P  ++++D+ + ++
Sbjct: 640 VLIVDDNATNRRILDEMIRGWGMKPLAVESGPKALAALRNAAGIGRPLRLVLLDMMMPDM 699

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            G  + K+I      +   VI +++        R    G  A++ KP+  S  +E I
Sbjct: 700 DGFAVAKEIARGGGDERPAVIMLSSAQKDEMARRNWATGIAAFLLKPVRQSELLEAI 756


>gi|189466077|ref|ZP_03014862.1| hypothetical protein BACINT_02447 [Bacteroides intestinalis DSM
            17393]
 gi|189434341|gb|EDV03326.1| hypothetical protein BACINT_02447 [Bacteroides intestinalis DSM
            17393]
          Length = 1045

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V+I EDNE N  LF  +++   Y  L   +G EA+EL +++ P +I+MDI + + +G E 
Sbjct: 926  VLIAEDNESNFLLFESILKRK-YNILHAWDGEEAVELFKKYNPHLILMDINMPKKTGYEA 984

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T+ I+E S    +P++AVTA+    DEERI   G +AY SKPI+
Sbjct: 985  TQIIREIS--PTVPIMAVTAYVYAEDEERILNSGFDAYTSKPIN 1026


>gi|15642449|ref|NP_232082.1| hybrid sensory histidine kinase BarA [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|153819819|ref|ZP_01972486.1| sensor histidine kinase/response regulator [Vibrio cholerae NCTC
           8457]
 gi|153823739|ref|ZP_01976406.1| sensor histidine kinase/response regulator [Vibrio cholerae B33]
 gi|227082574|ref|YP_002811125.1| sensor histidine kinase/response regulator [Vibrio cholerae M66-2]
 gi|229507487|ref|ZP_04396992.1| BarA sensory histidine kinase [Vibrio cholerae BX 330286]
 gi|229512318|ref|ZP_04401797.1| BarA sensory histidine kinase [Vibrio cholerae B33]
 gi|229519454|ref|ZP_04408897.1| BarA sensory histidine kinase [Vibrio cholerae RC9]
 gi|229606992|ref|YP_002877640.1| hybrid sensory histidine kinase BarA [Vibrio cholerae MJ-1236]
 gi|254849577|ref|ZP_05238927.1| sensor histidine kinase/response regulator [Vibrio cholerae MO10]
 gi|298500190|ref|ZP_07009995.1| sensor histidine kinase/response regulator [Vibrio cholerae MAK
           757]
 gi|9657030|gb|AAF95595.1| sensor histidine kinase/response regulator [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|126509638|gb|EAZ72232.1| sensor histidine kinase/response regulator [Vibrio cholerae NCTC
           8457]
 gi|126518744|gb|EAZ75967.1| sensor histidine kinase/response regulator [Vibrio cholerae B33]
 gi|227010462|gb|ACP06674.1| sensor histidine kinase/response regulator [Vibrio cholerae M66-2]
 gi|229344143|gb|EEO09118.1| BarA sensory histidine kinase [Vibrio cholerae RC9]
 gi|229352283|gb|EEO17224.1| BarA sensory histidine kinase [Vibrio cholerae B33]
 gi|229354992|gb|EEO19913.1| BarA sensory histidine kinase [Vibrio cholerae BX 330286]
 gi|229369647|gb|ACQ60070.1| BarA sensory histidine kinase [Vibrio cholerae MJ-1236]
 gi|254845282|gb|EET23696.1| sensor histidine kinase/response regulator [Vibrio cholerae MO10]
 gi|297540883|gb|EFH76937.1| sensor histidine kinase/response regulator [Vibrio cholerae MAK
           757]
          Length = 927

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|239995384|ref|ZP_04715908.1| two-component hybrid sensor and regulator [Alteromonas macleodii
           ATCC 27126]
          Length = 707

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++ EDNE+N ++ + ++++ GY  L  +NG +A+++ ++H+ D+I+MD  +  + G+
Sbjct: 590 KRILLAEDNEINAEIVKTILQSEGYKFLHVKNGKDAVDVGKRHQFDLILMDCNMPVMGGI 649

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E +  +++  E+ + P++A+TA A   D+E     G   +++KP+     +  IKKYIG
Sbjct: 650 EASTILRKALEV-DTPIVALTANAFAEDKEECLAAGMTDFLAKPLDKDTLLVCIKKYIG 707


>gi|229524439|ref|ZP_04413844.1| BarA sensory histidine kinase [Vibrio cholerae bv. albensis VL426]
 gi|229338020|gb|EEO03037.1| BarA sensory histidine kinase [Vibrio cholerae bv. albensis VL426]
          Length = 927

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|255746876|ref|ZP_05420821.1| BarA sensory histidine kinase [Vibrio cholera CIRS 101]
 gi|262162041|ref|ZP_06031057.1| BarA sensory histidine kinase [Vibrio cholerae INDRE 91/1]
 gi|255735278|gb|EET90678.1| BarA sensory histidine kinase [Vibrio cholera CIRS 101]
 gi|262028290|gb|EEY46947.1| BarA sensory histidine kinase [Vibrio cholerae INDRE 91/1]
          Length = 916

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 656 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 715

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 716 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 770


>gi|70730615|ref|YP_260356.1| sensor histidine kinase/response regulator [Pseudomonas fluorescens
            Pf-5]
 gi|68344914|gb|AAY92520.1| sensor histidine kinase/response regulator [Pseudomonas fluorescens
            Pf-5]
          Length = 1164

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G + +  RNG EA+  L      D+++MD+ + E+ G
Sbjct: 1040 RKILLVDDDVRNIFALTSALEHKGAVVVIGRNGHEAIARLNEVEDIDLVLMDVMMPEMDG 1099

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T QI++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1100 FEATVQIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1158



 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED      +  DL    GY  L      E   LA Q  PD I++D++L + SGL +
Sbjct: 774 ILVVEDEANFAHILFDLAHELGYHCLVAHGADEGYSLAAQFIPDAILLDMRLPDHSGLTV 833

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE+++ + IPV  ++       E+R+      G   Y  KP +
Sbjct: 834 LQRLKENAQTRHIPVHVISV------EDRVEAAMHMGAVGYAVKPTT 874



 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED++L       LI              EAL+L R++  D +++D++L ++ G
Sbjct: 893 VKRVLLVEDDDLQRDSIARLIGDDDIEITAVGLAQEALDLLRENVYDCMVIDLKLPDMLG 952

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            ++ K++  +      PVI  T   +  DEE
Sbjct: 953 NDLLKRMSTEDICSFPPVIVYTGRNLTRDEE 983


>gi|209522754|ref|ZP_03271312.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209496803|gb|EDZ97100.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 1769

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 65/119 (54%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE N+      +   GY     +NG EA+  A    PD+I+MDIQ+  + GLE 
Sbjct: 1640 LLLAEDNEANISTISSYLTAKGYRIELAKNGQEAINQAVALSPDLILMDIQMPGMDGLEA 1699

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             K+I+E  EL   P+IA+TA AM+ D +     G   Y+SKP+ L     TI+  +  +
Sbjct: 1700 MKRIREIPELATTPIIALTALAMESDRKACLLAGANEYLSKPVRLKQLTMTIQDLLNSS 1758


>gi|153214510|ref|ZP_01949419.1| sensor histidine kinase/response regulator [Vibrio cholerae 1587]
 gi|124115312|gb|EAY34132.1| sensor histidine kinase/response regulator [Vibrio cholerae 1587]
          Length = 927

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|88861388|ref|ZP_01136018.1| Response regulator CheB (receptor modification enzyme,
           protein-glutamate methylesterase) [Pseudoalteromonas
           tunicata D2]
 gi|88816654|gb|EAR26479.1| Response regulator CheB (receptor modification enzyme,
           protein-glutamate methylesterase) [Pseudoalteromonas
           tunicata D2]
          Length = 331

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + +++V+D  +N+++ + L+    Y  +  ++G EAL+LA Q +PD+I++DI + +++G 
Sbjct: 9   QTLLLVDDEPVNLRILKQLLHPD-YQLIFAKHGEEALKLALQERPDLILLDIMMPDMTGF 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +Q+K+  E Q IPVI VTA + + DE      G   YI+KPIS ++    IK ++ 
Sbjct: 68  EVCQQLKQRPETQAIPVIFVTALSEEHDEAAGFAVGAVDYITKPISTAVVKARIKTHLS 126


>gi|303248386|ref|ZP_07334646.1| integral membrane sensor hybrid histidine kinase [Desulfovibrio
           fructosovorans JJ]
 gi|302490184|gb|EFL50102.1| integral membrane sensor hybrid histidine kinase [Desulfovibrio
           fructosovorans JJ]
          Length = 651

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 75/123 (60%), Gaps = 3/123 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED++++    R L+E  G++ +   +G +AL+L  +   D++ MDIQ+  + G+E
Sbjct: 513 RILLAEDDQISAIACRHLLEHMGHVVVTAADGRQALDLFAKENFDLVFMDIQMPTLDGVE 572

Query: 64  ITKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++++     ++  + P+IA+TA+AM GD +R    G   YI+KP+  +   ETI + +
Sbjct: 573 ATREMRNRDAYADKADTPIIAMTAYAMDGDAQRFLDAGMNGYIAKPVEKATLRETIARVM 632

Query: 121 GEA 123
            EA
Sbjct: 633 REA 635


>gi|262167284|ref|ZP_06034994.1| BarA sensory histidine kinase [Vibrio cholerae RC27]
 gi|262024259|gb|EEY42950.1| BarA sensory histidine kinase [Vibrio cholerae RC27]
          Length = 916

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 656 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 715

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 716 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 770


>gi|229514079|ref|ZP_04403541.1| BarA sensory histidine kinase [Vibrio cholerae TMA 21]
 gi|229349260|gb|EEO14217.1| BarA sensory histidine kinase [Vibrio cholerae TMA 21]
          Length = 927

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|254291653|ref|ZP_04962441.1| sensor histidine kinase/response regulator [Vibrio cholerae
           AM-19226]
 gi|150422425|gb|EDN14384.1| sensor histidine kinase/response regulator [Vibrio cholerae
           AM-19226]
          Length = 927

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|121728971|ref|ZP_01681975.1| sensor histidine kinase/response regulator [Vibrio cholerae V52]
 gi|147673482|ref|YP_001217955.1| hybrid sensory histidine kinase BarA [Vibrio cholerae O395]
 gi|153826897|ref|ZP_01979564.1| sensor histidine kinase/response regulator [Vibrio cholerae MZO-2]
 gi|121628737|gb|EAX61204.1| sensor histidine kinase/response regulator [Vibrio cholerae V52]
 gi|146315365|gb|ABQ19904.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
 gi|149739260|gb|EDM53522.1| sensor histidine kinase/response regulator [Vibrio cholerae MZO-2]
 gi|227014345|gb|ACP10555.1| sensor histidine kinase/response regulator [Vibrio cholerae O395]
          Length = 927

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|256828945|ref|YP_003157673.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
 gi|256578121|gb|ACU89257.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
          Length = 1143

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++V++VED++++      L+   G   +  R+G EAL+  R+   D+++MD+Q+Q++ G+
Sbjct: 1021 RRVLLVEDDQVSAVAGVALLGRHGAAVVHVRSGQEALDALRRQPFDLVVMDVQMQDMDGI 1080

Query: 63   EITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            E T +I+E      ++ IPVIA+TA AM GD ER    G  +Y++KP+ +
Sbjct: 1081 EATMRIREGEAGETVRNIPVIALTACAMAGDRERFLAAGMNSYVAKPMDI 1130


>gi|189347431|ref|YP_001943960.1| multi-sensor hybrid histidine kinase [Chlorobium limicola DSM 245]
 gi|189341578|gb|ACD90981.1| multi-sensor hybrid histidine kinase [Chlorobium limicola DSM 245]
          Length = 1397

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 70/120 (58%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED+ +N  +   ++   GY+     NG EAL   R+   D++IMDIQ+ E+ GLE
Sbjct: 1278 RILLAEDSAVNQLVVTGILSKLGYVVDPVFNGQEALARLREFAYDLVIMDIQMPEMDGLE 1337

Query: 64   ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I++ +      ++PVIA+TA AM GD E   + G   Y+SKPI     +  IKK++
Sbjct: 1338 ATRIIRDQASAVLRHDVPVIALTAHAMHGDREICLQSGMNDYVSKPIDPPALIGVIKKWL 1397



 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 65/122 (53%), Gaps = 5/122 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD-----VIIMDIQLQE 58
            ++++V+DN  N  + R L+ + G    +      A+E  RQ   +     + I+D+++ E
Sbjct: 1119 RLLVVDDNAENRNMLRMLLTSWGVRVSEVSCASTAIERLRQAAEEGDPFRIAIIDMEMPE 1178

Query: 59   ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            I GL + + IK+++ L +  ++ + +   + D E++R+ G  +++ KP+  S    T+ +
Sbjct: 1179 IDGLMLGRSIKDETALADTALLMMNSIGRRPDNEKLRRSGFFSFLVKPVRQSELYNTVSE 1238

Query: 119  YI 120
             +
Sbjct: 1239 VL 1240


>gi|320354894|ref|YP_004196233.1| histidine kinase [Desulfobulbus propionicus DSM 2032]
 gi|320123396|gb|ADW18942.1| histidine kinase [Desulfobulbus propionicus DSM 2032]
          Length = 717

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQEISG 61
           ++++ EDN +N KL   ++  +GY      NG +A++L   R    D+I+MDIQ+ E+ G
Sbjct: 594 RILLAEDNPVNQKLAVLILNKAGYQVEVASNGRKAVDLFTRRPENFDLILMDIQMPEMDG 653

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           L  TK+++       +P++A+TA AMKGD E   K G   YI+KP+   I  E I+K++
Sbjct: 654 LAATKELRSRG-FNTVPIVAMTANAMKGDREICLKAGMNDYITKPVKREIIFEIIEKWL 711



 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 71/124 (57%), Gaps = 7/124 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETS--GYIALQ-TRNGMEALELARQHKP--DVIIMDIQLQ 57
           K+V++V+DN  N+ + R ++  +    +A+  + N    L+ A ++    D+II+DIQ+ 
Sbjct: 442 KRVLVVDDNLTNLSILRHILMAAELHVVAIHDSSNVRSVLQQAIENHALFDLIILDIQMP 501

Query: 58  EISGLEITKQIKED-SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              G  +   I+ + +E   IP++A T+ + + + +R ++ G +A+++KP    I  +TI
Sbjct: 502 APDGYALAHIIRHELAETATIPLLAYTS-STERNAQRCKEAGFDAFLTKPTRREILFKTI 560

Query: 117 KKYI 120
           +K +
Sbjct: 561 EKLL 564


>gi|116331277|ref|YP_800995.1| sensor histidine kinase and response regulator of a two component
            complex [Leptospira borgpetersenii serovar Hardjo-bovis
            JB197]
 gi|116124966|gb|ABJ76237.1| Sensor histidine kinase and response regulator of a two component
            complex [Leptospira borgpetersenii serovar Hardjo-bovis
            JB197]
          Length = 1023

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 68/106 (64%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++VEDN +N K+   L+   GY A    NG+EA+E  ++ K D+I MDIQ+ E+ G E
Sbjct: 905  KILLVEDNLINQKIALRLLMKLGYTADAALNGLEAIECLKERKYDLIFMDIQMPEMDGYE 964

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T  I++D    +  ++A+T   M+GD+E+  + G +AYI+KPI +
Sbjct: 965  ATHLIRKDFAKSKPVIVAMTDNVMEGDKEKCLEAGMDAYIAKPIQI 1010


>gi|150017913|ref|YP_001310167.1| PAS/PAC sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149904378|gb|ABR35211.1| PAS/PAC sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 669

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 77/120 (64%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDNE+N+K+  +++   GY      +G +ALE  +++  D+I+MDIQ+ E++G 
Sbjct: 550 KRILLVEDNEINIKITCEMLNRLGYEYEYVYDGKQALEKLKENTFDLILMDIQMPELNGY 609

Query: 63  EITKQIKED--SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + T+ I+E      + + +IA+TA++M GD ER  + G + YISKP  ++     I ++I
Sbjct: 610 DTTRIIREKEIKTKEHVNIIAMTAYSMNGDRERCIEVGMDDYISKPFDMNKLKNVILRFI 669


>gi|255011940|ref|ZP_05284066.1| two-component system sensor histidine kinase [Bacteroides fragilis
           3_1_12]
 gi|313149776|ref|ZP_07811969.1| two-component system sensor histidine kinase [Bacteroides fragilis
           3_1_12]
 gi|313138543|gb|EFR55903.1| two-component system sensor histidine kinase [Bacteroides fragilis
           3_1_12]
          Length = 736

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+++IVED E N  L + L++  GY   +  +G+EA+E       D+++MDI++  + GL
Sbjct: 607 KRILIVEDIESNYLLMQILLKGKGYRCYRAADGVEAVEKVLSEHFDLVLMDIKMPRLDGL 666

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E T++I++ +  +E+P++A+TA A   D+E     GC+ Y+ KPI+     + + KY+ E
Sbjct: 667 EATREIRKTN--REVPIVALTAHAFNADKELAIAAGCDGYLVKPINEKALNKVLGKYLRE 724


>gi|291087446|ref|ZP_06346485.2| sensory box histidine kinase/response regulator [Clostridium sp.
           M62/1]
 gi|291075004|gb|EFE12368.1| sensory box histidine kinase/response regulator [Clostridium sp.
           M62/1]
          Length = 861

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 5/119 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEIS 60
           +V++ EDNE+NM++  +L++  G    Q  NG EA+EL R+      D+I+MD+Q+  ++
Sbjct: 719 RVLLAEDNEINMEISTELLKMYGLDVTQAWNGKEAVELFREMGEGFFDIILMDMQMPVMN 778

Query: 61  GLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           G E  +QI+  +  +   IP+IAVTA A   D    R  G  A+ISKPI   IF +T++
Sbjct: 779 GCEAARQIRAMKRPDAATIPIIAVTANAFSEDIAATRNAGMNAHISKPIDFEIFRKTVE 837


>gi|190892952|ref|YP_001979494.1| two-component sensor histidine kinase/response regulator hybrid
            protein [Rhizobium etli CIAT 652]
 gi|190698231|gb|ACE92316.1| probable two-component sensor histidine kinase/response regulator
            hybrid protein [Rhizobium etli CIAT 652]
          Length = 1126

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ EDNE+N  +F  +++ +G   L   NG +A+     H P +I+MD+ +  ++G E 
Sbjct: 997  VLVAEDNEVNQIVFTQILQGTGLSFLVVNNGEQAVAAWESHTPRIIMMDVSMPVMNGHEA 1056

Query: 65   TKQI--KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+ I  KE  + Q +P+I VTA A++   E     G + Y+SKPIS  +  E I++++G+
Sbjct: 1057 TRTIREKEKGQSQRVPIIGVTAHALESGREACLDAGMDDYMSKPISPELLEEKIRQWLGK 1116



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           ++++++DNE+N ++  + +   G+  +    G   L +           D +I+D  + +
Sbjct: 837 RILVIDDNEVNRRILTEQLSLWGFDGVAAEGGGTGLAILEAAADLGVTVDAVILDYHMPD 896

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
           ++G ++ ++++ D    E+P+I +T+  + G E+       +A++ KP   ++   T
Sbjct: 897 MNGADVARRLRADPRFVELPIIFLTSMDISGTEKEFAALNGQAHLMKPARANVLRNT 953


>gi|300865990|ref|ZP_07110724.1| Sensor protein [Oscillatoria sp. PCC 6506]
 gi|300335981|emb|CBN55882.1| Sensor protein [Oscillatoria sp. PCC 6506]
          Length = 1823

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDN +N K+   L+E  GY A    NG+EALE  R+   DV++MD+Q+ ++ GLE
Sbjct: 1534 RILLAEDNLVNQKVATHLLERIGYRADIAGNGLEALEALRKQFYDVVLMDVQMPQMDGLE 1593

Query: 64   ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             T++I ++   Q  P +IA+TA AM+GD E+    G   YI+KP+
Sbjct: 1594 ATRRICQEWPEQLRPRIIAMTANAMQGDREKCLAAGMNDYITKPV 1638



 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP--DVIIMDIQLQEIS 60
            K+++IVE+++ N ++   L +  G I +    G EA++L  QH P  D+ I+ + L ++ 
Sbjct: 1333 KRLLIVENHDTNRQVLIKLSQYWGMIPIAAATGAEAMQLL-QHNPMVDLAILAMNLADMD 1391

Query: 61   GLEITKQIK 69
            G+ +  +I+
Sbjct: 1392 GIALANKIR 1400


>gi|307822230|ref|ZP_07652462.1| PAS/PAC sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
 gi|307736796|gb|EFO07641.1| PAS/PAC sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
          Length = 1268

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 68/113 (60%), Gaps = 1/113 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIA-LQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++ VEDN  N+ L   +IE+   +  L  R+G   + LAR H PDVI+MDI L  ISG++
Sbjct: 1134 LLYVEDNPANLMLVEQIIESHPQVRMLSARDGNLGIALARAHLPDVILMDINLPGISGIQ 1193

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              K +++D     IPV+A++A AM  D E+  + G   Y++KPI ++ FM  +
Sbjct: 1194 ALKILRKDPATMHIPVVAISANAMPRDIEKGLEAGFFRYLTKPIQVNEFMNAL 1246


>gi|149199753|ref|ZP_01876784.1| transcriptional regulator [Lentisphaera araneosa HTCC2155]
 gi|149137158|gb|EDM25580.1| transcriptional regulator [Lentisphaera araneosa HTCC2155]
          Length = 630

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQT-RNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++I EDN +N ++    + +     ++T  NG E +E  +  K D+I+MDIQ+ ++ G+
Sbjct: 383 RILIAEDNHVNQRVMYSYLNSDETHYIKTAENGNEVIEFLKSDKFDLILMDIQMPDLDGI 442

Query: 63  EITKQIKEDSE-LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + T+ I++ +E    IP+IAVTA AM+GD ER  K G  +Y+ KP S  + ++T+ + + 
Sbjct: 443 QTTELIRKSNEDYNNIPIIAVTANAMEGDRERYLKLGMNSYLPKPYSKELLLKTVSQLVN 502


>gi|116328548|ref|YP_798268.1| sensor histidine kinase and response regulator of a two component
            complex [Leptospira borgpetersenii serovar Hardjo-bovis
            L550]
 gi|116121292|gb|ABJ79335.1| Sensor histidine kinase and response regulator of a two component
            complex [Leptospira borgpetersenii serovar Hardjo-bovis
            L550]
          Length = 1023

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 68/106 (64%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++VEDN +N K+   L+   GY A    NG+EA+E  ++ K D+I MDIQ+ E+ G E
Sbjct: 905  KILLVEDNLINQKIALRLLMKLGYTADAALNGLEAIECLKERKYDLIFMDIQMPEMDGYE 964

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T  I++D    +  ++A+T   M+GD+E+  + G +AYI+KPI +
Sbjct: 965  ATHLIRKDFAKSKPVIVAMTDNVMEGDKEKCLEAGMDAYIAKPIQI 1010


>gi|262404766|ref|ZP_06081321.1| BarA sensory histidine kinase [Vibrio sp. RC586]
 gi|262349798|gb|EEY98936.1| BarA sensory histidine kinase [Vibrio sp. RC586]
          Length = 927

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 70/115 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNTANLKLITALLQERVEYVVACTSGQEAIEQAQVRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K+IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + + ++
Sbjct: 727 CKEIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEYILQQVLVRW 781


>gi|95930791|ref|ZP_01313523.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans DSM
            684]
 gi|95133139|gb|EAT14806.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans DSM
            684]
          Length = 1969

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 76/120 (63%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++ EDN LN ++  +++E+ G       +G+EA+ELARQH  D+I+MDIQ+  + GL
Sbjct: 1617 QHLLLAEDNPLNQEVALEMLESLGLNVEVVEDGLEAVELARQHDFDLILMDIQMPVMDGL 1676

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            E T++I+     +  P++A+TA A + D++   + G  A+I+KP+   +  + + +++ E
Sbjct: 1677 EATRRIRTLPGCKNTPILAMTANAFEEDQKNCSEAGMNAHIAKPVDPELLYKMLLEWLPE 1736


>gi|159897749|ref|YP_001543996.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890788|gb|ABX03868.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 130

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 69/119 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+D   N +L   +++ SGY     R+G+EALE  ++ +PD+I++D+ L  + G
Sbjct: 1   MPTILVVDDMPDNRQLLGIMLQRSGYTTEMARDGVEALEAIQKSRPDLILLDLNLPRMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + + +K D  L  IP++A+TA    G+ +++       Y+SKP  +   ME +K ++
Sbjct: 61  WAVCRTVKSDPRLAHIPIVALTASCSPGEVKQLMTPDWTDYVSKPFDVMSLMEKVKLWL 119


>gi|94270843|ref|ZP_01291837.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93450645|gb|EAT01750.1| Response regulator receiver [delta proteobacterium MLMS-1]
          Length = 483

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN  N ++ + +++  G  A    NG EA+E  +    D+++MD+Q+ E+ GLE
Sbjct: 223 RILLAEDNISNQQVAQGILKKLGLSADAVANGREAIEALKTLPYDLVLMDVQMPEMDGLE 282

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+QI+        + IP+IA+TA AM+GD E+    G   Y++KP+S     E ++K++
Sbjct: 283 ATRQIRNPKSPIPNRNIPIIAMTAHAMQGDREKCLAAGMNDYVAKPVSPQDLAEALEKWL 342

Query: 121 GE 122
            E
Sbjct: 343 PE 344


>gi|115372379|ref|ZP_01459688.1| two-component response regulator [Stigmatella aurantiaca DW4/3-1]
 gi|115370592|gb|EAU69518.1| two-component response regulator [Stigmatella aurantiaca DW4/3-1]
          Length = 137

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 70/117 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D +   +++ + +E SG+   + +NG EAL+ A +  PDVI+MD+ L  I G E 
Sbjct: 13  VLVVDDYQDAREMYAEYLEFSGFRVAEAKNGAEALDKAFELLPDVILMDLSLPIIDGWEA 72

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T+++K D   + IPV+A+T  A+ G     +  GC++++ KP      +E +++ + 
Sbjct: 73  TRRLKNDERTKTIPVVALTGHALTGQPGGAQDAGCDSFVIKPCLPDALVEEVRRMLA 129


>gi|152993425|ref|YP_001359146.1| hypothetical protein SUN_1842 [Sulfurovum sp. NBC37-1]
 gi|151425286|dbj|BAF72789.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 1046

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 73/120 (60%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N KL  +++   G       NG EAL L +++  D+I MD+Q+  + G++
Sbjct: 760 NILVAEDNVINQKLILNVLNKLGLQVTLANNGEEALHLRQKNNYDMIFMDVQMPVMGGID 819

Query: 64  ITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK+I   +E +    IP++A+TA A++GD+E+  K G + Y+SKP+ L    + ++KY 
Sbjct: 820 ATKEILTYEEKNRKHHIPIVALTANALQGDKEKYIKAGMDDYLSKPLVLEHLTQLLEKYF 879


>gi|117926800|ref|YP_867417.1| Hpt sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117610556|gb|ABK46011.1| Hpt sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 920

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 72/118 (61%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGL 62
           ++++VEDNE+N ++  +L++  G   +   +G +A++ +    + D ++MDIQ+  + G 
Sbjct: 554 QILLVEDNEINQQVACELLQGEGVTVVVANSGQQAVDRVLSGERFDAVLMDIQMPGMDGY 613

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I++  +  ++P+IA+TA AM GD ER    G   +I KPI   +  ET+ +Y+
Sbjct: 614 EATQVIRKQPQFSDLPIIAMTANAMAGDRERCLAAGMNDHIGKPIQPKLLFETLGRYV 671


>gi|91216331|ref|ZP_01253298.1| sensory box histidine kinase/response regulator [Psychroflexus
            torquis ATCC 700755]
 gi|91185469|gb|EAS71845.1| sensory box histidine kinase/response regulator [Psychroflexus
            torquis ATCC 700755]
          Length = 1325

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 6/121 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K +I EDN +NM+L +  ++   S     +  +G  AL+L + H+PD I  DIQ+  ++G
Sbjct: 1073 KFLIAEDNLINMELIKSYLKNIYSNVKIYEAEDGQIALKLFKTHQPDFIFSDIQMPNMNG 1132

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             E+TK I++D   +++P+IA+TA  ++G +E+  + G   Y+SKP    I  E+IK  I 
Sbjct: 1133 YELTKAIRKDKNGKQVPIIAITAGTVEGTKEKCLESGMNDYVSKP----ILQESIKNIIF 1188

Query: 122  E 122
            E
Sbjct: 1189 E 1189


>gi|209964766|ref|YP_002297681.1| sensor histidine kinase [Rhodospirillum centenum SW]
 gi|209958232|gb|ACI98868.1| sensor histidine kinase [Rhodospirillum centenum SW]
          Length = 591

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+IVED E+N  +   ++E  G+  L T +G  ALE+ R+   D+I+MDI+LQ + G E
Sbjct: 463 RVLIVEDVEVNRLILEQMLERLGHRTLCTDSGEAALEIVRREPVDLILMDIRLQGMDGAE 522

Query: 64  ITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T++++   D+ L  +PV+AVTA     DE   R+ G  A I+KPI  
Sbjct: 523 TTRRLRALPDNRLASLPVVAVTANVFPEDEAAYRQAGMSAVIAKPIQF 570


>gi|289676330|ref|ZP_06497220.1| response regulator receiver:CheW-like protein:ATP-binding region,
           ATPase-like:Hpt [Pseudomonas syringae pv. syringae FF5]
          Length = 645

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 72/115 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 526 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEV 585

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I  +
Sbjct: 586 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESIAYW 640


>gi|239906417|ref|YP_002953158.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239796283|dbj|BAH75272.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 919

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/114 (35%), Positives = 71/114 (62%), Gaps = 4/114 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN++N    +  +  +G       +G++ALEL  Q   D+++MDIQ+ E+ G E
Sbjct: 678 RVLLAEDNQVNRLFLKHFLAEAGCQVRLAGSGLQALELLCQEPADLVLMDIQMPEMDGAE 737

Query: 64  ITKQIKEDS---ELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL-SIFM 113
            T++I+E       + +PV+A+TA++MKGD ER    G + Y+SKP+ +  +FM
Sbjct: 738 ATRRIREGEAGDAARAMPVVALTAYSMKGDRERFLSVGLDDYVSKPVDVDELFM 791


>gi|149376819|ref|ZP_01894576.1| Signal transduction histidine kinase [Marinobacter algicola DG893]
 gi|149358940|gb|EDM47407.1| Signal transduction histidine kinase [Marinobacter algicola DG893]
          Length = 783

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDN +N  L R L+E  G   +   +G  A  L + H  D+I MD  +  + G E
Sbjct: 658 KVLLVEDNPVNRTLTRRLLEKLGCDVMTANDGEAASSLWQWHPFDLIFMDCVMPRVDGFE 717

Query: 64  ITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+++++   D     +PV+A+TA AM+ DEER R+ G +++++KP+++ +    +++Y
Sbjct: 718 ATRRLRQWEKDHNRNRVPVVALTASAMEKDEERCREAGMDSFVAKPVNIEMLRAVLEQY 776



 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR----QHKP-DVIIMDIQLQ 57
           + +++V+  EL+ K+  +++          ++  EAL   R      KP D +++D  + 
Sbjct: 502 RHILVVDSYELSRKITLEMLSRHELDIEAVKSAGEALTSLRLASDNRKPFDALVLDGFVP 561

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISK--------PISL 109
           ++    + +QI+ + E     ++ +++   +GD E  R+ G +A++SK        PI  
Sbjct: 562 DMDSDLLCRQIRSNPEWGHTRLLILSSNPQRGDAEHFRQAGADAFLSKSLRESCLTPILH 621

Query: 110 SIFMETIK 117
            +F ++++
Sbjct: 622 QLFSDSVR 629


>gi|114776541|ref|ZP_01451586.1| probable two-component hybrid sensor and regulator [Mariprofundus
           ferrooxydans PV-1]
 gi|114553371|gb|EAU55769.1| probable two-component hybrid sensor and regulator [Mariprofundus
           ferrooxydans PV-1]
          Length = 125

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 70/118 (59%), Gaps = 2/118 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+ IV+DN+  + LF  L++  G +   T +G   LE      PD+I++DIQ+ ++ G 
Sbjct: 7   KKIAIVDDNDSILMLFSALLDAHGALVETTNSGEIFLEHISDMAPDLILLDIQMPDMDGY 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           ++ ++I+      EIPV+A+TA AM GD E+I + G   YI+KP+   +F   +  ++
Sbjct: 67  QVLEKIRRTG--SEIPVVALTAHAMSGDREKILERGFSDYIAKPVDTRVFPGQVASFL 122


>gi|15595606|ref|NP_249100.1| twitching motility protein PilH [Pseudomonas aeruginosa PAO1]
 gi|116054140|ref|YP_788583.1| twitching motility protein PilH [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152987748|ref|YP_001345904.1| twitching motility protein PilH [Pseudomonas aeruginosa PA7]
 gi|218889151|ref|YP_002438015.1| twitching motility protein PilH [Pseudomonas aeruginosa LESB58]
 gi|254237356|ref|ZP_04930679.1| twitching motility protein PilH [Pseudomonas aeruginosa C3719]
 gi|254243508|ref|ZP_04936830.1| twitching motility protein PilH [Pseudomonas aeruginosa 2192]
 gi|296386908|ref|ZP_06876407.1| twitching motility protein PilH [Pseudomonas aeruginosa PAb1]
 gi|313111968|ref|ZP_07797757.1| twitching motility protein PilH [Pseudomonas aeruginosa 39016]
 gi|1172507|sp|P43501|PILH_PSEAE RecName: Full=Protein pilH
 gi|9946264|gb|AAG03798.1|AE004478_3 twitching motility protein PilH [Pseudomonas aeruginosa PAO1]
 gi|401795|gb|AAA25950.1| cheY homologue [Pseudomonas aeruginosa PAO1]
 gi|115589361|gb|ABJ15376.1| type IV pilus response regulator PilH [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169287|gb|EAZ54798.1| twitching motility protein PilH [Pseudomonas aeruginosa C3719]
 gi|126196886|gb|EAZ60949.1| twitching motility protein PilH [Pseudomonas aeruginosa 2192]
 gi|150962906|gb|ABR84931.1| twitching motility protein PilH [Pseudomonas aeruginosa PA7]
 gi|218769374|emb|CAW25134.1| twitching motility protein PilH [Pseudomonas aeruginosa LESB58]
 gi|310884259|gb|EFQ42853.1| twitching motility protein PilH [Pseudomonas aeruginosa 39016]
          Length = 121

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 69/115 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPDV++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEKPDVVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D+E   IPVI VT    + D+   ++ G   Y++KP+     ++TI
Sbjct: 61  FQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYLTKPVDEETLLKTI 115


>gi|302808503|ref|XP_002985946.1| hypothetical protein SELMODRAFT_123147 [Selaginella moellendorffii]
 gi|300146453|gb|EFJ13123.1| hypothetical protein SELMODRAFT_123147 [Selaginella moellendorffii]
          Length = 176

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 70/117 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN++N+ +   +++  G+ A    NG+EALE  R+ K D++++DI +  + GL+
Sbjct: 53  KILLAEDNKVNVMVAISMLKRLGFTAQVVANGVEALEAMRKDKYDLVLLDICMPLMDGLQ 112

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +   I+       IP+IAVTA A++ D ER    G +A+I KP+      E + KY+
Sbjct: 113 VAYAIRNTGTSPRIPIIAVTANALRSDIERCFAHGMDAFIPKPVMFQKLREILSKYL 169


>gi|297568713|ref|YP_003690057.1| response regulator receiver protein [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924628|gb|ADH85438.1| response regulator receiver protein [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 128

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 67/120 (55%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VEDNE+N  +    +   G+  L+  +G + L +A    PD+I+MD+ L E+ G E
Sbjct: 3   KILLVEDNEMNRDMLSRRLRRRGFEVLEAVDGRQGLSMATAIIPDLILMDLSLPELDGWE 62

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            T+ ++   E   +P+IA+TA A   D  +    GC+ + +KPI L   +  I K + +A
Sbjct: 63  TTRLLRAQRETATLPIIALTAHAQDSDRRKALAIGCDEFETKPIDLRRLLSKIDKLLHKA 122


>gi|114777683|ref|ZP_01452643.1| probable sensor/response regulator hybrid protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114551899|gb|EAU54433.1| probable sensor/response regulator hybrid protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 1043

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQ-TRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++ EDNE+N ++   L+  +G I+LQ   NG EA+E       D ++MD+Q+  + GL
Sbjct: 712 RLLLAEDNEVNREVAEGLLTRAG-ISLQVVHNGQEAIEALEHDDFDGVLMDLQMPVMGGL 770

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ ++++   +E+P+IA+TA AM  D ER  + G   +I+KPI  +   +T+ ++I
Sbjct: 771 EATRVLRKNPRFRELPIIAMTANAMADDRERCLQAGMNDHIAKPIHPATLYDTLLRWI 828


>gi|261417268|ref|YP_003250951.1| multi-sensor hybrid histidine kinase [Fibrobacter succinogenes subsp.
            succinogenes S85]
 gi|261373724|gb|ACX76469.1| multi-sensor hybrid histidine kinase [Fibrobacter succinogenes subsp.
            succinogenes S85]
 gi|302327259|gb|ADL26460.1| sensor histidine kinase/response regulator [Fibrobacter succinogenes
            subsp. succinogenes S85]
          Length = 1329

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 75/122 (61%), Gaps = 2/122 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++VEDNE+N +L   L+ + G   +   NG +ALEL + +  D+++MDIQ+  ++GL+
Sbjct: 975  KILLVEDNEMNQELAVSLLNSVGLATMVAPNGKKALELLKINAFDLVLMDIQMPVMNGLD 1034

Query: 64   ITKQIKEDSE--LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             T+ I+  S+   + +P+IA++A A + D +   K G  +YI+KPI   +    + KY+ 
Sbjct: 1035 ATRAIRNRSDEYFKNVPIIAMSAKAFQKDRDDCLKAGMNSYIAKPIDPMMLYAELAKYLP 1094

Query: 122  EA 123
             A
Sbjct: 1095 VA 1096


>gi|46201520|ref|ZP_00054895.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 1099

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N ++   L+   G+      +G EALE  R    DV++MD+Q+ E+ GLE
Sbjct: 852 RILVAEDNPVNQQVALGLLRKLGHTVDVVGDGAEALEAVRLLPYDVVLMDVQMPEMDGLE 911

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ I+   S    IP++A+TA AM+GD++     G + YISKPI      E + KY G
Sbjct: 912 ATRAIRSLASAAARIPIVAMTANAMRGDDQMCFDAGMDGYISKPIDRHKLAEALAKYSG 970



 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 61/123 (49%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSG---YIALQTRNGM-EALELARQHKP-DVIIMDIQLQE 58
           +V++V+DN +N  +    +   G   +  L   +GM E    A    P +V ++D Q+  
Sbjct: 705 RVLVVDDNPVNCDVIERQLRAFGVEVHACLDAGSGMGELTRAAAMGTPWEVAVIDSQMPV 764

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           ++G E+ + ++    L    +I  ++  M   E++  +   +A++ KP+  S  ++TI +
Sbjct: 765 VTGSEMVRMMRAIPMLGGSRIIVTSSQGMPA-EQQDGQPAIDAFLHKPLRQSTLLDTIGR 823

Query: 119 YIG 121
            +G
Sbjct: 824 VLG 826


>gi|301057759|ref|ZP_07198828.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300448070|gb|EFK11766.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 438

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 75/134 (55%), Gaps = 18/134 (13%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQEISG 61
           ++++VEDN +N KL + +++ +GY      NG EA+E+  A Q+  D+I MD+Q+ E+ G
Sbjct: 301 RILLVEDNPVNQKLAKMMLKKAGYQVQVANNGKEAVEMLMASQNGFDLIFMDVQMPEMDG 360

Query: 62  LEITKQIK----------------EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISK 105
           L  T++I+                     + IP+IA+TA AMKGD+E     G + Y++K
Sbjct: 361 LTATREIRRLEKEHVLRPPRGRDFHPLTRRRIPIIAMTAHAMKGDQETCMDAGMDDYVAK 420

Query: 106 PISLSIFMETIKKY 119
           PI   +    ++K+
Sbjct: 421 PIKRDVVFSVVEKW 434



 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 70/132 (53%), Gaps = 14/132 (10%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-----ARQHKPDVIIMDIQLQ 57
           KK ++V+DNE N+K+    +E  G   +    GM+ L L       Q   D+ I DIQ+ 
Sbjct: 140 KKALLVDDNETNLKILARYLEPVGMRLVLLDKGMDVLPLLEKSIDEQDPFDICIADIQMP 199

Query: 58  EISGLEITKQIK--EDSE------LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           ++SG E+ +QI+  E         ++ +P++A+++  M+ D +R  + G + +++KP+  
Sbjct: 200 DMSGYEVARQIRLFESPHARLRMSIRSLPLMALSSM-MERDAKRCGEVGFDGFLAKPVRR 258

Query: 110 SIFMETIKKYIG 121
                 +++ +G
Sbjct: 259 ERLYRMLERILG 270


>gi|148653955|ref|YP_001281048.1| response regulator receiver protein [Psychrobacter sp. PRwf-1]
 gi|148573039|gb|ABQ95098.1| response regulator receiver protein [Psychrobacter sp. PRwf-1]
          Length = 120

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 73/120 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VED++  M  FR+L+  + Y  ++  +G + +E+A+ H PD I+MDI + E++G
Sbjct: 1   MHKVLVVEDSQSEMARFRELLIKNNYEVIEASDGQQGVEMAQMHLPDAILMDIVMPEMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T++I  +     IPV+ ++    + D    ++ G +AY++KP++ +  + TI   IG
Sbjct: 61  FQATRKITRNEATGHIPVVMISTKNQETDRIWGKRQGAKAYLTKPVNETELLTTIDSVIG 120


>gi|307721710|ref|YP_003892850.1| integral membrane sensor hybrid histidine kinase [Sulfurimonas
           autotrophica DSM 16294]
 gi|306979803|gb|ADN09838.1| integral membrane sensor hybrid histidine kinase [Sulfurimonas
           autotrophica DSM 16294]
          Length = 1053

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 3/107 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ EDN +N KL +  +E  G       NG+EA +  + H  D+I MDIQ+  + G E
Sbjct: 772 KVLVAEDNIINQKLIKRTLEDLGLSVDIASNGLEAFQKRKDHNYDLIFMDIQMPFLDGTE 831

Query: 64  ITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            T++I E  E+     +P+IA+TA A+KGD ER  + G + Y +KP+
Sbjct: 832 ATQEILEYEEVYNQPHVPIIALTANALKGDRERFLRAGLDEYTTKPL 878


>gi|302035961|ref|YP_003796283.1| putative histidine kinase [Candidatus Nitrospira defluvii]
 gi|300604025|emb|CBK40357.1| putative Histidine kinase [Candidatus Nitrospira defluvii]
          Length = 954

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 1/122 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+DN +N K+   ++E  GY      NGMEAL    +H+  ++ MD Q+ E+ GL
Sbjct: 815 QRLLVVDDNPVNQKVALKMLEKLGYRVDVAGNGMEALAAVCRHQYPLVFMDCQMPELDGL 874

Query: 63  EITKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E T+ I+   +    +P+IA+TA AM GD E   K G + +ISKPI      E + +++ 
Sbjct: 875 ETTRLIRSQEQAGTHLPIIAMTANAMAGDRENCLKAGMDDFISKPIVPDQLREILSRWLP 934

Query: 122 EA 123
            A
Sbjct: 935 SA 936



 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 43/74 (58%)

Query: 48  DVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           D+ I+DI + +I GL++ + IKED  ++   +I +TAF  +GD    ++ G  AY+ KP+
Sbjct: 716 DLAIIDIHMPDIGGLQLCRLIKEDPAIRATHLIVLTAFGQRGDSIAAKEAGASAYLPKPV 775

Query: 108 SLSIFMETIKKYIG 121
                 + I+  +G
Sbjct: 776 RERQLADCIRLILG 789


>gi|322419867|ref|YP_004199090.1| integral membrane sensor hybrid histidine kinase [Geobacter sp. M18]
 gi|320126254|gb|ADW13814.1| integral membrane sensor hybrid histidine kinase [Geobacter sp. M18]
          Length = 1364

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 68/117 (58%), Gaps = 1/117 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++VEDN  NM   + ++  + Y  ++  +G   L+ AR   P +I++D+ L  + G  +
Sbjct: 1242 LLVVEDNLDNMTTLKAVL-GANYRIVEATDGAAGLDAARNGLPSLILLDMHLPVMDGFTV 1300

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             +++KED     IPV+A+TA AM GD ER+   GC AY+SKP       E + +++G
Sbjct: 1301 LRKLKEDPATAAIPVVALTASAMAGDRERVLSAGCAAYLSKPYQPEELQELVGRFLG 1357



 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++V+D+   + L    +   G+  L   NG +AL LAR  +P  I +DI + ++ G 
Sbjct: 840 RSVLVVDDDPEAVSLIAGHLSQVGFDTLTALNGSDALRLARAKRPFAITLDIMMPDMDGW 899

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +++KE  +  +IPV+ ++   +  D E     G    ISKP+     MET  K  G
Sbjct: 900 EVMRELKEHPDTADIPVVIIS---LSEDRETGIALGAVGVISKPVGSEELMETFAKLAG 955



 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++IVED+E      R  +E++G+       G  AL   + H PD II+D+ + E+ G E
Sbjct: 1094 RILIVEDSEAATIQLRFALESAGFCVDAVSGGRHALGYLKTHVPDGIILDLMMPEVDGFE 1153

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMK-GDEERIRK 96
            + K ++  S  Q++PV+ +TA  +  G+ +R+R+
Sbjct: 1154 VLKAVRSSSLTQQVPVMVMTAKTLSPGEFDRLRE 1187



 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 52/101 (51%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+DNE +      L +  G   L   +G EALELA    PD+I +D+ +  + G  +
Sbjct: 961  VLVVDDNEYDRFFIASLFKEKGLDVLLAESGPEALELAAADHPDLITLDLLMPGMDGAAV 1020

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISK 105
              +++ +    +IPV+ +T+  +   E +    G  A +SK
Sbjct: 1021 LDRLRSNECTADIPVVVITSKELSMAELQRLSSGVSAILSK 1061


>gi|167622660|ref|YP_001672954.1| multi-sensor hybrid histidine kinase [Shewanella halifaxensis
            HAW-EB4]
 gi|167352682|gb|ABZ75295.1| multi-sensor hybrid histidine kinase [Shewanella halifaxensis
            HAW-EB4]
          Length = 1761

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 76/121 (62%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+V++VEDN++N ++  + +E  G +     NG  ALE       D+++MD Q+  + G 
Sbjct: 1421 KRVLLVEDNDMNQEVATEFLEQVGVVLSIAENGQVALEKLATQSFDLVLMDCQMPVMDGY 1480

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+++++   L+++PVIA+TA AM GD+E   + G   +I+KPI ++    T+ +Y+G+
Sbjct: 1481 QATRELRKMPGLEKLPVIAMTANAMAGDKEMCLRVGMNDHIAKPIEVARLYSTLLQYLGD 1540

Query: 123  A 123
            +
Sbjct: 1541 S 1541



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 61/119 (51%), Gaps = 1/119 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ +DN     + R  +E+ G+     ++G EA+E  +     V ++D  + E++G+E
Sbjct: 1280 RILVADDNATARDIMRTTLESMGFKVDAVKSGAEAIEHCQHTDYPVALIDWLMPEMNGIE 1339

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++I    E     ++ V+A A     E++      +YI+KPIS S  ++ I   +G+
Sbjct: 1340 AAQKILSGKE-HPPKILIVSAHANAEFIEQVEHSDIASYITKPISASRLLDGIMSSLGQ 1397


>gi|329848033|ref|ZP_08263061.1| response regulator [Asticcacaulis biprosthecum C19]
 gi|328843096|gb|EGF92665.1| response regulator [Asticcacaulis biprosthecum C19]
          Length = 1140

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 77/124 (62%), Gaps = 6/124 (4%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKP----DVIIMDIQL 56
            +K+++VED+  N+    ++ E  G +    RNG EALE+  + Q  P    D+++MD+ +
Sbjct: 1015 RKILLVEDDVRNVYAVTNIFEPLGAVMSIARNGREALEVLESTQGDPNQAVDLVLMDVMM 1074

Query: 57   QEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             E+ GL  TK+I+E+ + +++PVI +TA AMK D+ER  + G   Y++KPI +   +  +
Sbjct: 1075 PEMDGLTATKKIRENKDWRKLPVIMLTAKAMKDDQERCIEAGANDYMAKPIDVDKLVSLV 1134

Query: 117  KKYI 120
            + ++
Sbjct: 1135 RVWM 1138



 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 5/116 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + +++VED+    ++  DL     ++ L      +A+  ARQ+ P  I++D+ L + SGL
Sbjct: 747 RSILVVEDDPSFARILYDLAHDLDFLCLVAHTAEDAMATARQYTPSAIVLDVGLPDHSGL 806

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG-GCEAYISKPISLSIFMETIK 117
            +  ++K D   + IPV  V+A    GD        G   Y+ KP+     ++  K
Sbjct: 807 SVLDRLKRDVRTRHIPVHVVSA----GDYAHTALSLGAVGYMLKPVKREQLIDAFK 858



 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++ V+IVED+E+       L+++     +      E LE  +    D +++D+ L + SG
Sbjct: 868 MRHVLIVEDDEVQRHAMCKLLQSQDVECVAVGTAAECLEKLKDQTFDCMVLDLSLPDASG 927

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMK-GDEERIRK 96
             + + + ++      PVI  T   +   DE+R+R+
Sbjct: 928 YSLLETLSQEEAYAFPPVIVYTGRDISYDDEQRLRR 963


>gi|323699563|ref|ZP_08111475.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. ND132]
 gi|323459495|gb|EGB15360.1| multi-sensor hybrid histidine kinase [Desulfovibrio desulfuricans
           ND132]
          Length = 813

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ +DN LN +L   L+   G+  L  +NG+EAL   R+   D+++MD+Q+  + G+  
Sbjct: 555 VLLADDNPLNRELATTLLSERGHRVLAVKNGIEALNALREAPFDLVLMDVQMPIMDGVSA 614

Query: 65  TKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           T+ I++ +       +P+IA+TA A+KGD ER    G   YI+KPI +  F  TI +
Sbjct: 615 TRAIRDPNSGALNPNVPIIALTAHALKGDRERFLDAGMNDYIAKPIKMRDFYHTIAR 671


>gi|253698714|ref|YP_003019903.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M21]
 gi|251773564|gb|ACT16145.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M21]
          Length = 226

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 73/120 (60%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D ++ +++ +D  + +    L  R+G+EALE+A+  KPD+I MD+Q+  + 
Sbjct: 1   MNPTILLVDDLQMFLEIEKDFFKYAQVNLLTARDGIEALEVAKNRKPDLIFMDLQMPRMH 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  + I+ D EL  IPV+ +++ +   D+E     GC  +++KP     F+E  +++I
Sbjct: 61  GVQCCRAIRSDPELARIPVVIISSSSDAKDKEISLAAGCSYFLTKPAGRDRFLEIAREFI 120


>gi|319643002|ref|ZP_07997636.1| hypothetical protein HMPREF9011_03237 [Bacteroides sp. 3_1_40A]
 gi|317385367|gb|EFV66312.1| hypothetical protein HMPREF9011_03237 [Bacteroides sp. 3_1_40A]
          Length = 295

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 9/119 (7%)

Query: 5   VMIVEDNELNMKLFRDLIET---SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++ ED + N     DLIE      Y  +   +GMEA+    Q+KPD+I+MDI++  I+G
Sbjct: 180 ILVAEDYQSNY----DLIEAMLGKMYKLVHAHDGMEAIIFYEQYKPDLILMDIKMPNING 235

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           L+ TK I+E S    +PVIAV+A+A + D+    + GC  +++KP+S  +   TI KY+
Sbjct: 236 LDATKAIREMS--ASVPVIAVSAYAYEKDKIAAIESGCNEFLTKPVSADLLKMTINKYL 292


>gi|154147903|ref|YP_001406226.1| sensor histidine kinase/response regulator [Campylobacter hominis
            ATCC BAA-381]
 gi|153803912|gb|ABS50919.1| sensor histidine kinase/response regulator [Campylobacter hominis
            ATCC BAA-381]
          Length = 1385

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 68/120 (56%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             ++I EDNE+N KL +  + +         NG+ ALE  +    D++ MDI +  + G+E
Sbjct: 1041 NILIAEDNEINQKLMKHTLSSFKANLTIVENGLLALEARKSGDFDLVFMDISMPVMDGIE 1100

Query: 64   ITKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TKQIK   +++ L+ IP++AVTA A+KGD ER    G + Y +KPI   I    +  +I
Sbjct: 1101 ATKQIKQYEQENNLKHIPIVAVTANALKGDRERFMSQGLDEYCTKPIKKDILASMLDMFI 1160


>gi|258576055|ref|XP_002542209.1| hypothetical protein UREG_01725 [Uncinocarpus reesii 1704]
 gi|237902475|gb|EEP76876.1| hypothetical protein UREG_01725 [Uncinocarpus reesii 1704]
          Length = 1290

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N ++   ++E   +      NG+ A+E  +QH+ DVI+MD+Q+  + G E 
Sbjct: 1105 ILLAEDNDVNQRVAVKILEKCNHGVTVVSNGLAAVEAVKQHRYDVILMDVQMPIMGGFEA 1164

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y++KP+  +  M+TI K
Sbjct: 1165 TGKIREWEKETGLSRTPIIALTAHAMLGDREKCLQAQMDEYLAKPLKQNQMMQTILK 1221


>gi|254479954|ref|ZP_05093202.1| putative response regulator recevier domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039516|gb|EEB80175.1| putative response regulator recevier domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 123

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VEDNELN  +    +  +G   +   +G +AL+L R  KP V++MD+ L  ++
Sbjct: 1   MTGTILLVEDNELNRDMLIRRLVRAGKEVVSAADGQQALDLMRSEKPAVVLMDMNLPILN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    +Q + D  ++ IP+IA+TA A   D     + GC+ Y +KP+     +  I+K  
Sbjct: 61  GWTACRQARADDTIKHIPIIALTAHASDADRLNALEAGCDDYATKPVDFPGLLIKIEKLT 120

Query: 121 GEA 123
           G  
Sbjct: 121 GNC 123


>gi|150006465|ref|YP_001301209.1| two-component hybrid sensor kinase/response regulator [Bacteroides
           vulgatus ATCC 8482]
 gi|294777014|ref|ZP_06742472.1| sensor histidine kinase/response regulator [Bacteroides vulgatus
           PC510]
 gi|149934889|gb|ABR41587.1| two-component system sensor histidine kinase, with a response
           regulator receiver domain [Bacteroides vulgatus ATCC
           8482]
 gi|294449072|gb|EFG17614.1| sensor histidine kinase/response regulator [Bacteroides vulgatus
           PC510]
          Length = 616

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 9/119 (7%)

Query: 5   VMIVEDNELNMKLFRDLIET---SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++ ED + N     DLIE      Y  +   +GMEA+    Q+KPD+I+MDI++  I+G
Sbjct: 501 ILVAEDYQSNY----DLIEAMLGKMYKLVHAHDGMEAIIFYEQYKPDLILMDIKMPNING 556

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           L+ TK I+E S    +PVIAV+A+A + D+    + GC  +++KP+S  +   TI KY+
Sbjct: 557 LDATKAIREMS--ASVPVIAVSAYAYEKDKIAAIESGCNEFLTKPVSADLLKMTINKYL 613


>gi|327542393|gb|EGF28876.1| multi-sensor hybrid histidine kinase [Rhodopirellula baltica WH47]
          Length = 993

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 76/125 (60%), Gaps = 7/125 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-----HKPDVIIMDIQLQ 57
           K+V++V+D E N +L   +++ +G   +   NG EAL++  +     +  ++++MD+Q+ 
Sbjct: 582 KRVLVVDDGEANRRLIELVLKRAGATVMSAENGQEALDMIAEGNESGYPYELVLMDMQMP 641

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            + G   T+ ++E  +    PVIA+T  AM+GD E+    GC+ +++KP++L   +E + 
Sbjct: 642 VLDGYSATRLLRERED--TTPVIALTGNAMRGDREKCMDAGCDDFLTKPVNLDELLEMVS 699

Query: 118 KYIGE 122
           +Y+GE
Sbjct: 700 QYLGE 704


>gi|254881618|ref|ZP_05254328.1| two-component system sensor histidine kinase [Bacteroides sp.
           4_3_47FAA]
 gi|254834411|gb|EET14720.1| two-component system sensor histidine kinase [Bacteroides sp.
           4_3_47FAA]
          Length = 616

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 9/119 (7%)

Query: 5   VMIVEDNELNMKLFRDLIET---SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++ ED + N     DLIE      Y  +   +GMEA+    Q+KPD+I+MDI++  I+G
Sbjct: 501 ILVAEDYQSNY----DLIEAMLGKMYKLVHAHDGMEAIIFYEQYKPDLILMDIKMPNING 556

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           L+ TK I+E S    +PVIAV+A+A + D+    + GC  +++KP+S  +   TI KY+
Sbjct: 557 LDATKAIREMS--ASVPVIAVSAYAYEKDKIAAIESGCNEFLTKPVSADLLKMTINKYL 613


>gi|229527059|ref|ZP_04416454.1| BarA sensory histidine kinase [Vibrio cholerae 12129(1)]
 gi|229335456|gb|EEO00938.1| BarA sensory histidine kinase [Vibrio cholerae 12129(1)]
          Length = 927

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IK+    ++ P+IAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKAIKQLKGYRDTPIIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|146305444|ref|YP_001185909.1| response regulator receiver protein [Pseudomonas mendocina ymp]
 gi|145573645|gb|ABP83177.1| response regulator receiver protein [Pseudomonas mendocina ymp]
          Length = 121

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 69/115 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D+E   IPVI VT    + D+   ++ G + Y++KPI     ++T+
Sbjct: 61  FQATRQLTKDAETSHIPVIIVTTKDQETDKVWGKRQGAKDYLTKPIDEDTLLKTL 115


>gi|71908503|ref|YP_286090.1| peptidase M52, hydrogen uptake protein [Dechloromonas aromatica
           RCB]
 gi|71848124|gb|AAZ47620.1| Peptidase M52, hydrogen uptake protein [Dechloromonas aromatica
           RCB]
          Length = 1053

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 67/116 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D ELN  L R+L  T+G       NG EA+      KPD+++MD Q+  + G   
Sbjct: 791 ILVVDDIELNRDLMRELFATAGLNIRLACNGREAITAIHSKKPDLVLMDCQMPVMDGFSA 850

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T++++   E  E+P+IA+TA A+  D E+    G  AY++KP++L   +  I + +
Sbjct: 851 TRELRARPEYAELPIIALTAGALDHDREQCLAAGMNAYVTKPVNLEKLLRVIAEQL 906


>gi|239907358|ref|YP_002954099.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
 gi|239797224|dbj|BAH76213.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
          Length = 1062

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 72/121 (59%), Gaps = 3/121 (2%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +++++ ED+ L+    + ++E SGY      +G EAL+   ++  D+I+MD+Q+  ++G+
Sbjct: 939  RRILLAEDDPLSSLTCKRMLEKSGYSVTAANDGQEALQRLTENDFDLILMDVQMPVMNGI 998

Query: 63   EITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            E TK I+  + L     IP++A+TA+AM GD+E     G   YI+KP+      E I++ 
Sbjct: 999  EATKAIRGANNLGAKSSIPIVAMTAYAMTGDKESFLAAGMNGYIAKPVDKGALFEAIERV 1058

Query: 120  I 120
            +
Sbjct: 1059 L 1059


>gi|330967661|gb|EGH67921.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            actinidiae str. M302091]
          Length = 1170

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATTEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED++L       LI              +AL+L R H  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDDLQRDSIARLIGDDDIEITAVGFAQQALDLLRDHIYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|283851135|ref|ZP_06368419.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283573531|gb|EFC21507.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 886

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 72/121 (59%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+ +N    R L+E  G+      +G EA+++A   +PD+++MD+ +  + G++
Sbjct: 756 RILVAEDDAVNALALRRLLEKIGHAVSVAHDGQEAVDMALAGRPDLVLMDVGMPVLDGVQ 815

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + ++E + L     IPVIA+TA AM GD E +   G + Y++KP+     +ET+ + +
Sbjct: 816 AMRLLREKTGLAGVAAIPVIALTAHAMAGDRENLLAAGMDGYVAKPVDREDLLETMGQVL 875

Query: 121 G 121
           G
Sbjct: 876 G 876


>gi|284035554|ref|YP_003385484.1| multi-sensor hybrid histidine kinase [Spirosoma linguale DSM 74]
 gi|283814847|gb|ADB36685.1| multi-sensor hybrid histidine kinase [Spirosoma linguale DSM 74]
          Length = 1309

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 73/116 (62%), Gaps = 5/116 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIA--LQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            KV+I EDN +N  L R +I      A  ++  NG+EA++L RQ + D+I+MDIQ+ E++G
Sbjct: 1063 KVLIAEDNPVNQLLTRTIINRIAPQAQIVEAANGIEAIQLYRQERADLILMDIQMPEMNG 1122

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI---SLSIFME 114
             E T+QI+E +    + +IA+TA  +KG+ E+    G + +I+KPI   SL  F +
Sbjct: 1123 YEATRQIRELNPTAPVRIIALTAGTVKGEREKCLAAGMDDFITKPIVEESLRPFFD 1178



 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 9/116 (7%)

Query: 1    MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQE 58
             +K+V++V+DN  N  + R L         +  NG EAL+L  A+    DVI+MD  +  
Sbjct: 911  WIKRVLLVDDNANNRLILRQLFLLKQIAVEEASNGFEALQLLAAQPQGFDVILMDYHMPY 970

Query: 59   ISGLEITKQIKED-SELQEIPVIAVTAFAMKGDEERIRKG----GCEAYISKPISL 109
            + GLE  ++I+ + S     P I +       ++ERI K     G      KP+ +
Sbjct: 971  LDGLETIEKIRANFSTSPAEPTILL--LHSSSEDERIDKACARLGVHQRFVKPLKI 1024


>gi|332534411|ref|ZP_08410251.1| sensor protein [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036145|gb|EGI72620.1| sensor protein [Pseudoalteromonas haloplanktis ANT/505]
          Length = 786

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 72/117 (61%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VEDN LN  +   +++T G IA    +G EA+E   ++  D+++MDIQ+ ++ GL+
Sbjct: 667 KLLLVEDNPLNQHVANAILKTKGCIADIANDGFEAIEKLAENSYDIVLMDIQMPKMDGLK 726

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK I+ D EL ++P+I ++A A   D ++    G   YI+KPI  +   +T+  ++
Sbjct: 727 ATKVIRRDLELIDLPIIGLSANAHDDDVKKALACGMNGYITKPIDANTLFKTLWHHL 783


>gi|167036030|ref|YP_001671261.1| response regulator receiver protein [Pseudomonas putida GB-1]
 gi|166862518|gb|ABZ00926.1| response regulator receiver protein [Pseudomonas putida GB-1]
          Length = 121

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 67/120 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M    + +E  GY  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMYRLTEWLEKHGYQVLKASNGADGVALARQDKPDAVLMDIVMPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D E   IPVI VT    + D     + G   +++KP+     +  +K+ +G
Sbjct: 61  FQATRQLSKDPETSAIPVIVVTTKDQETDRIWATRQGARDFLTKPVEEDALIAKLKEVLG 120


>gi|212634200|ref|YP_002310725.1| hybrid sensory histidine kinase BarA [Shewanella piezotolerans WP3]
 gi|212555684|gb|ACJ28138.1| Response regulator receiver:ATP-binding region,
           ATPase-like:Histidine kinase, HAMP region:Histidine
           kinase A:Hpt [Shewanella piezotolerans WP3]
          Length = 935

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 67/118 (56%), Gaps = 6/118 (5%)

Query: 5   VMIVEDNELNMKLFRDLIE---TSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           V+ V+DN  N+KL   L+    T  +IA    NG  A++LA+Q   D+I MDIQ+    G
Sbjct: 689 VLAVDDNPANLKLIDTLLNELVTQVHIA---DNGDAAVQLAKQRSFDLIFMDIQMPGTDG 745

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +  TKQI+++S  +  P+IAVTA A+  + ERI   G   Y+ KPI  +     I K+
Sbjct: 746 ISATKQIRQNSANRNTPIIAVTAHAIAEERERISSSGMNGYLPKPIDETALKNVIHKW 803


>gi|83645119|ref|YP_433554.1| signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
 gi|83633162|gb|ABC29129.1| Signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
          Length = 797

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 68/118 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V++VEDN++N  + + ++   GY      NG +AL+L      D+I+MD  +  + G 
Sbjct: 667 KHVLLVEDNQVNQLVAKTILRKLGYEVSIANNGQDALDLVGNDHYDIILMDCHMPVMDGY 726

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T+ I+++S+   +P+IAVTA  M+GD+ER    G   Y++KP       + + K++
Sbjct: 727 EATRLIRQNSKYDALPIIAVTANVMQGDKERCLSCGMNDYLTKPYEKKALTQMLAKWL 784


>gi|120555156|ref|YP_959507.1| multi-sensor hybrid histidine kinase [Marinobacter aquaeolei VT8]
 gi|120325005|gb|ABM19320.1| multi-sensor hybrid histidine kinase [Marinobacter aquaeolei VT8]
          Length = 956

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++ V+DNE N+KL   L+      A    +G EAL   RQ   D++ MD+Q+  + G+E
Sbjct: 684 RILAVDDNEANLKLVMTLLNDCRLEAEGASSGFEALTKVRQKAFDLVFMDLQMPGMDGVE 743

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T +I++ DS     P+IA+TA A+  ++ER+ + G + Y+ KPIS S  +E I++Y G
Sbjct: 744 TTARIRDLDSGSHHTPIIALTAHALADEQERLAQQGFDGYMPKPISSSQLVELIREYTG 802


>gi|254443896|ref|ZP_05057372.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
 gi|198258204|gb|EDY82512.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
          Length = 560

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 66/111 (59%), Gaps = 4/111 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQ-TRNGMEALELARQHKPDVIIMDIQLQEISG 61
           K+++IVEDN +N+ +  DL+E  GY      ++G+EA ++ R+   D++ MD+Q+  + G
Sbjct: 440 KRILIVEDNSMNLGVLNDLVECLGYANTDFAKDGIEARDMLRERPYDIVFMDVQMPRLDG 499

Query: 62  LEITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           L +T+ I++       + +P++ VTAF  + D E     G   YISKP+ L
Sbjct: 500 LSLTRLIRDGGSCPINRTVPIVGVTAFTSEYDREECMMAGMNDYISKPVVL 550


>gi|116253334|ref|YP_769172.1| two-component sensor histidine kinase transcriptional regulatory
            protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257982|emb|CAK09080.1| putative two-component sensor histidine kinase transcriptional
            regulatory protein [Rhizobium leguminosarum bv. viciae
            3841]
          Length = 1118

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 73/121 (60%), Gaps = 2/121 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ EDNE+N  +F  +++ +G   L   NG EA+    +H P +I+MD+ +  ++G + 
Sbjct: 989  VLVAEDNEVNQIVFTQILQGTGLSFLVVDNGEEAVAAWERHTPRIIMMDVSMPVMNGHQA 1048

Query: 65   TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+ I+E  + Q   +P+I VTA A++ D E     G + Y+SKPIS  +  E I++++G 
Sbjct: 1049 TQTIREREKGQGHRVPIIGVTAHALESDRELCLDAGMDDYMSKPISPELLEEKIRQWLGT 1108

Query: 123  A 123
            +
Sbjct: 1109 S 1109



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           ++++V+DNE+N ++  + +   G+  +   +G   L +           D +++D  + +
Sbjct: 829 RILVVDDNEVNRRILTEQLSLWGFDGVAAESGGTGLAILEAAANLGVTVDAVVLDYHMPD 888

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           ++G ++ ++++ D    E+P+I +T+  + G E+        A++ KP   ++   T+
Sbjct: 889 MNGADVARRLRADPRFVELPIIFLTSMDISGTEKEFAALNGHAHLMKPARANVLRNTV 946


>gi|332140272|ref|YP_004426010.1| multi-sensor hybrid histidine kinase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550294|gb|AEA97012.1| multi-sensor hybrid histidine kinase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 959

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 69/110 (62%), Gaps = 7/110 (6%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP--DVIIMDIQLQEIS 60
           +KV+IVEDN++N  + +  +  S +  L  ++G+EAL+   + K   DVI+MD Q+ E+ 
Sbjct: 827 RKVLIVEDNDINQVIAKQHL--SNHTTLSAKSGVEALQALNKMKVTFDVILMDCQMPEMD 884

Query: 61  GLEITKQIKED---SELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           G E TK+I+     S    +P+IA+TA AMKGD+ER    G + Y+SKP 
Sbjct: 885 GFEATKRIRNGEAGSRYLNVPIIALTANAMKGDKERCVSAGMDDYLSKPF 934


>gi|253996017|ref|YP_003048081.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Methylotenera mobilis JLW8]
 gi|253982696|gb|ACT47554.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Methylotenera mobilis JLW8]
          Length = 332

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 71/118 (60%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D   N+K+ + +++    ++   +NGM+ALEL +  +P +I++D+ + +++G E
Sbjct: 11  KVLIVDDEPFNLKVLKQILQDHYRLSF-AKNGMDALELVKTEQPQLILLDVMMPDMTGFE 69

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +  ++K D   Q IPVI VTA + + DE      G   YI+KP+  ++    +K ++ 
Sbjct: 70  VCAKLKADPNTQNIPVIFVTALSDENDEATGLTHGAVDYITKPVYPAVVKARVKTHLS 127


>gi|91776937|ref|YP_546693.1| multi-sensor hybrid histidine kinase [Methylobacillus flagellatus KT]
 gi|91710924|gb|ABE50852.1| multi-sensor hybrid histidine kinase [Methylobacillus flagellatus KT]
          Length = 1158

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            + +++V+D+  N+      +E  G      RNG+EA+E L R    ++++MD+ + E+ G
Sbjct: 1032 RHILLVDDDVRNVFALTSALEQKGMKIEVARNGLEAIEKLNRIPDINLVLMDVMMPEMDG 1091

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            LE T++I+ DS  + +P+IA+TA AMK D+E+  K G   Y++KPI LS     ++ ++
Sbjct: 1092 LEATRRIRADSRFERLPIIAITAKAMKDDQEQCMKAGMNDYLAKPIELSRLYSLLRVWL 1150



 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+++ED     ++  DL    GY  L      E L +A +++P  I++DI+L + SGL +
Sbjct: 766 VLVIEDEPAFARILFDLAHEMGYQCLVAHAADEGLLVAEKYQPQAILLDIRLPDESGLSV 825

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            + +K++   + IPV  V++   +   E     G   Y  KP +L
Sbjct: 826 LQTLKQNGLTRHIPVHVVSS---EDHSEAALHLGAIGYALKPTTL 867



 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED+    +    LI       +    G +ALE  R +  D +I+D++L ++ G
Sbjct: 885 IKRVLLVEDDARQRESVHQLIADDDVEIIAVEFGEQALEQLRHNIFDCMIIDLKLPDMQG 944

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ +++  +      PVI  T   +  DEE
Sbjct: 945 SELLQRMSSEDICAFPPVIVYTGRNLSRDEE 975


>gi|265751905|ref|ZP_06087698.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_33FAA]
 gi|263236697|gb|EEZ22167.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_33FAA]
          Length = 616

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED + N  L   +I    Y  +   +GMEA+    Q+KPD+I+MDI++  I+GL+ 
Sbjct: 501 ILVAEDYQSNYDLIEAMI-GKIYKLVHAHDGMEAIIFYEQYKPDLILMDIKMPNINGLDA 559

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E S   ++PVIAV+A+A + D+    + GC  +++KP+S  +   TI KY+
Sbjct: 560 TRAIREMS--ADVPVIAVSAYAYEKDKIAAIESGCNDFLTKPVSADLLKMTINKYL 613


>gi|218885496|ref|YP_002434817.1| integral membrane sensor hybrid histidine kinase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218756450|gb|ACL07349.1| integral membrane sensor hybrid histidine kinase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 762

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+E++    R L+E  G+    T NG +AL+  R  + D ++MD+Q+  + G+E
Sbjct: 637 RILLAEDDEVSRLCARRLLEQMGHEVTTTANGAQALDALRAKRFDCVLMDVQMDVMDGVE 696

Query: 64  ITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            T+QI++ +       IPVIA+TA+AM GD E+    G + Y+SKP+
Sbjct: 697 ATRQIRDGASGVLDARIPVIAMTAYAMAGDREKFLAQGMDGYVSKPV 743


>gi|159897133|ref|YP_001543380.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890172|gb|ABX03252.1| response regulator receiver protein [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 123

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 65/117 (55%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VED+E+N  + +  +E   +      +G EA++L     PD+I+MD+ L  + G  
Sbjct: 2   HILLVEDHEMNRDMLKRRLERRDFQVSVAVDGQEAIDLVESLMPDIILMDMSLPNVDGWT 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ IK +  + +IP+I +TA AM GD ER  + GC  Y  KP+  +  +  I+  +
Sbjct: 62  ATRIIKANPAVNQIPIIGLTAHAMAGDRERCLEAGCNEYEIKPVDFTSLVSKIQALV 118


>gi|212691341|ref|ZP_03299469.1| hypothetical protein BACDOR_00833 [Bacteroides dorei DSM 17855]
 gi|237712212|ref|ZP_04542693.1| two-component system sensor histidine kinase [Bacteroides sp.
           9_1_42FAA]
 gi|237726358|ref|ZP_04556839.1| two-component system sensor histidine kinase [Bacteroides sp. D4]
 gi|212666094|gb|EEB26666.1| hypothetical protein BACDOR_00833 [Bacteroides dorei DSM 17855]
 gi|229434884|gb|EEO44961.1| two-component system sensor histidine kinase [Bacteroides dorei
           5_1_36/D4]
 gi|229453533|gb|EEO59254.1| two-component system sensor histidine kinase [Bacteroides sp.
           9_1_42FAA]
          Length = 616

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED + N  L   +I    Y  +   +GMEA+    Q+KPD+I+MDI++  I+GL+ 
Sbjct: 501 ILVAEDYQSNYDLIEAMI-GKIYKLVHAHDGMEAIIFYEQYKPDLILMDIKMPNINGLDA 559

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I+E S   ++PVIAV+A+A + D+    + GC  +++KP+S  +   TI KY+
Sbjct: 560 TRAIREMS--ADVPVIAVSAYAYEKDKIAAIESGCNDFLTKPVSADLLKMTINKYL 613


>gi|83649318|ref|YP_437753.1| signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
 gi|83637361|gb|ABC33328.1| Signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
          Length = 599

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 72/119 (60%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIAL-QTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           V+ +EDN  N++L   L  +   I L  T NG + + +AR ++P ++++D+ L   SGL+
Sbjct: 477 VLYIEDNYSNIRLMESLFASMRNIQLLTTNNGEQGIAMARTYRPQLVLLDLNLPTTSGLD 536

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG-GCEAYISKPISLSIFMETIKKYIG 121
           +  + +ED EL +IP++AVTA  + G +E  R G   + +I KPI + +   TI KY+G
Sbjct: 537 VCSRFQEDPELADIPIVAVTA-NVNGSQEASRLGLKFQEFILKPIDVEVMKSTIFKYLG 594


>gi|32470753|ref|NP_863746.1| sensory transduction histidine kinase [Rhodopirellula baltica SH 1]
 gi|32442898|emb|CAD71417.1| sensory transduction histidine kinase [Rhodopirellula baltica SH 1]
          Length = 993

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 76/125 (60%), Gaps = 7/125 (5%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-----HKPDVIIMDIQLQ 57
           K+V++V+D E N +L   +++ +G   +   NG EAL++  +     +  ++++MD+Q+ 
Sbjct: 582 KRVLVVDDGEANRRLIELVLKRAGATVMSAENGQEALDMIAEGNESGYPYELVLMDMQMP 641

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            + G   T+ ++E  +    PVIA+T  AM+GD E+    GC+ +++KP++L   +E + 
Sbjct: 642 VLDGYSATRLLRERED--TTPVIALTGNAMRGDREKCMDAGCDDFLTKPVNLDELLEMVS 699

Query: 118 KYIGE 122
           +Y+GE
Sbjct: 700 QYLGE 704


>gi|330875153|gb|EGH09302.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            morsprunorum str. M302280PT]
          Length = 1170

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLDEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATTEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED++L       LI              +AL+L R H  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDDLQRDSIARLIGDDDIEITAVGFAQQALDLLRDHIYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|307152260|ref|YP_003887644.1| AraC family two component transcriptional regulator [Cyanothece sp.
           PCC 7822]
 gi|306982488|gb|ADN14369.1| two component transcriptional regulator, AraC family [Cyanothece
           sp. PCC 7822]
          Length = 265

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 68/107 (63%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++++ED++LN  L ++ +E+ G+  +   NG++ L+ ARQH PD+I+ DI + E+ G
Sbjct: 1   MTRILLIEDDDLNCTLLQECLESEGFHIISAENGLQGLQQARQHLPDLILCDIMMPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
             +  Q+++D     IP I +TA   K ++ R  + G + Y++KP++
Sbjct: 61  YSVLLQLRQDPITAFIPFIFLTAKTTKAEQRRGMELGADDYLTKPLT 107


>gi|94501651|ref|ZP_01308167.1| type IV pilus response regulator Pilh [Oceanobacter sp. RED65]
 gi|94426227|gb|EAT11219.1| type IV pilus response regulator Pilh [Oceanobacter sp. RED65]
          Length = 122

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 72/119 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M   + ++E  G+  L+  NG + + LAR+  PDV++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMFTLKSMLEAKGFEVLEADNGADGVALAREELPDVVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + T+Q+ +D++ + IPVI VT    + D+   ++ G + Y+ KP++     ETI+  I
Sbjct: 61  FQATRQLTKDAKTEHIPVIIVTTKDQETDKVWGQRQGAKGYLVKPVTEDQLAETIQSVI 119


>gi|75911092|ref|YP_325388.1| response regulator receiver domain-containing protein [Anabaena
           variabilis ATCC 29413]
 gi|75704817|gb|ABA24493.1| Response regulator receiver domain protein (CheY) [Anabaena
           variabilis ATCC 29413]
          Length = 133

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 70/117 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VE+N  N++L    ++T  Y  +  + G+ A+ LA+  +PD+II+D+ L ++SG ++
Sbjct: 7   ILVVEENLHNLELLNSHLKTLNYDCICAKQGVRAIILAQTQRPDLIILDMILSDLSGSQV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              +K+DS+   IP+IAV  F +  +++R+   G + YI+KP +       I  Y+ 
Sbjct: 67  INHLKQDSKTANIPIIAVVPFILVQNQDRLFLTGADDYITKPYNFIQLNTLINHYVN 123


>gi|117925402|ref|YP_866019.1| Cache sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609158|gb|ABK44613.1| Cache sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1361

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 71/116 (61%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++ V+D+  N+ +    +E +G    +  NG++ALE+ +QH  D+I+MDI + E++G E 
Sbjct: 1242 ILAVDDDPRNLFVLTASLEQNGAEVHKALNGLKALEILKQHSVDLILMDIMMPEMNGYEA 1301

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +I+ +    EIP+IA+TA A+K D+++    G   Y+SKP+   I +  ++ +I
Sbjct: 1302 IHEIRANPSYCEIPIIALTAKALKEDKQKCLDAGANDYLSKPVDYEILINMVQTWI 1357



 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++++D+ L ++    + +  G   L   +G E L +A+ H P  II+D+ L ++ G E
Sbjct: 977  KILVIDDDLLFVENISYINQAQGLDTLSAHDGREGLRVAKSHHPVGIILDLGLPDMRGEE 1036

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            + +Q+K   EL+ IPV  ++A   K  +  +   G   ++ KP++
Sbjct: 1037 VLEQLKRSPELRHIPVYIISA---KDKQRALVDQGAIGFLQKPVN 1078


>gi|83814442|ref|YP_446396.1| response regulator DrrA [Salinibacter ruber DSM 13855]
 gi|294508333|ref|YP_003572391.1| response regulator DrrA [Salinibacter ruber M8]
 gi|83755836|gb|ABC43949.1| response regulator DrrA [Salinibacter ruber DSM 13855]
 gi|294344661|emb|CBH25439.1| response regulator DrrA [Salinibacter ruber M8]
          Length = 236

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 76/119 (63%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D E  + L    +E  G+  L  R+G+EALE AR+H PD+II+DI + ++ G+E+
Sbjct: 13  ILVVDDEEDLLSLVEYNLEQEGFGVLLARDGVEALEQAREHDPDLIILDIMMPKMDGIEV 72

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +++++D+ L+ IP++ +TA   + D+ +    G + Y+ KP+S+S+ +   K  +  A
Sbjct: 73  CQKLRKDAHLRTIPIMMLTARNEEDDKVQGLDVGADIYLGKPVSVSVIVSQTKALLRSA 131


>gi|313500967|gb|ADR62333.1| Response regulator receiver protein [Pseudomonas putida BIRD-1]
          Length = 121

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 67/120 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M    + +E  GY  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMYRLTEWLEKHGYQVLKASNGADGVALARQDKPDAVLMDIVMPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D E   IPVI VT    + D     + G   +++KP+     +  +K+ +G
Sbjct: 61  FQATRQLSKDPETSAIPVIVVTTKDQETDRIWATRQGARDFLTKPVEEEALIAKLKEVLG 120


>gi|312887983|ref|ZP_07747567.1| multi-sensor hybrid histidine kinase [Mucilaginibacter paludis DSM
           18603]
 gi|311299464|gb|EFQ76549.1| multi-sensor hybrid histidine kinase [Mucilaginibacter paludis DSM
           18603]
          Length = 733

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 71/118 (60%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+DN +N  L + L+   G       NG+EALE  +    D+++MDIQ+ ++ G  
Sbjct: 491 QILVVDDNTMNQSLMKHLLIQWGAAFTIAANGLEALEELKAKSFDLVLMDIQMPKMDGYT 550

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ I+E+ +L + P++A+TA AM G+ E+    G   YISKPI+     + I K++G
Sbjct: 551 ATRHIREELKL-DTPIVAMTAHAMAGEREKCLSNGMNDYISKPINEEHLFKMIVKFVG 607


>gi|304313291|ref|YP_003812889.1| Type IV pilus response regulator, CheY analog, possibly involved in
           chemotaxis [gamma proteobacterium HdN1]
 gi|301799024|emb|CBL47267.1| Type IV pilus response regulator, CheY analog, possibly involved in
           chemotaxis [gamma proteobacterium HdN1]
          Length = 126

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 75/122 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+      F ++++ +G+  L+  NG + + L R+ KPD+++MD+ +  ++G
Sbjct: 1   MPRVLIVDDSPTETYKFEEILKKNGFGVLKADNGADGVALCRKEKPDLVLMDVVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +  + + IPV+ VT    + D+   ++ G  AY++KPI   + M+TI++ + 
Sbjct: 61  FQATRQLAKGEDTKHIPVVIVTTKDQETDKVWGQRQGASAYLTKPIDEKVLMDTIRQTLQ 120

Query: 122 EA 123
            A
Sbjct: 121 SA 122


>gi|156741627|ref|YP_001431756.1| response regulator receiver sensor signal transduction histidine
           kinase [Roseiflexus castenholzii DSM 13941]
 gi|156232955|gb|ABU57738.1| response regulator receiver sensor signal transduction histidine
           kinase [Roseiflexus castenholzii DSM 13941]
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 67/117 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++ +EDN  N  L R ++E+ GY      +G   + LAR+ +P +I++DI +  + G E 
Sbjct: 7   ILYIEDNRDNQLLVRRILESRGYALQICEDGPSGIALARESQPALILVDINIAGMDGYET 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T +++    LQ  P++A+TA A  G  ER    GC+ +I+KPI   +  E I +++G
Sbjct: 67  TTRLRSLPHLQSTPIVAITADARPGTRERALAAGCDGFITKPIDPRLLPEQIAEFLG 123


>gi|294498311|ref|YP_003562011.1| two-component sensor histidine kinase/response regulator [Bacillus
           megaterium QM B1551]
 gi|294348248|gb|ADE68577.1| two-component sensor histidine kinase/response regulator [Bacillus
           megaterium QM B1551]
          Length = 917

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 74/119 (62%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K+V+IV+D++ N+   +  +   G   +   NG+E LE+ +  +P D+I+MDI + ++ G
Sbjct: 797 KRVLIVDDDQRNIFALKTALAKQGMTIMTAHNGIECLEMMKNSEPFDLILMDIMMPQMDG 856

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E  ++I+ + +L ++P+IA+TA AMK D E+  + G   YISKP+ L+     ++ ++
Sbjct: 857 YEAMQKIRGELKLVDLPIIALTAKAMKNDREKCLEAGASDYISKPLDLNQLFSVMRVWL 915


>gi|270296316|ref|ZP_06202516.1| two-component system sensor histidine kinase [Bacteroides sp. D20]
 gi|270273720|gb|EFA19582.1| two-component system sensor histidine kinase [Bacteroides sp. D20]
          Length = 1037

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ ED++ N +L   ++    Y  +   NG EA+ + R++ P +I+MDI +  ++G E 
Sbjct: 918  VLVAEDHDSNFRLIESILR-KDYNLIHAWNGQEAVSMFREYDPQLILMDINMPVMNGYEA 976

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+++ + G +AY++KPI+
Sbjct: 977  TREIRKYS--TQVPIIAVTAFAYASDEQQVMENGFDAYMAKPIN 1018


>gi|330872154|gb|EGH06303.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 710

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 72/115 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 591 VMLVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 650

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I  +
Sbjct: 651 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESIAYW 705


>gi|218439787|ref|YP_002378116.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
 gi|218172515|gb|ACK71248.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
          Length = 936

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED  +N ++ R  +E  GY+     NG+E LE  R+H  DVI+MD+++ E+ G+ 
Sbjct: 674 RILVAEDINVNQEVIRLQLEKLGYLPDIVSNGVEVLEALRRHPYDVILMDVRMPEMDGMS 733

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T QI+++      P +IA+TA AM+GD E+  + G + YISKPI L      I K
Sbjct: 734 ATHQIRKEWMPNVRPRIIAMTADAMQGDREKCLESGMDDYISKPIRLEELHRAISK 789



 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K+++IV+D   N K+      + G +    ++  +ALE  +Q    DV+I+D+ + +I G
Sbjct: 530 KRMLIVDDIITNQKILTHQANSWGMLTCSVQSAPKALEWLKQGWAFDVVILDMNMPKIDG 589

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           L + ++I+     + +P++ +++       E++ K    A ++KPI
Sbjct: 590 LTLAQEIRNLPHCKRLPLVLLSSLGKPEMTEKVEKIEFAAILTKPI 635


>gi|330501377|ref|YP_004378246.1| response regulator receiver protein [Pseudomonas mendocina NK-01]
 gi|328915663|gb|AEB56494.1| response regulator receiver protein [Pseudomonas mendocina NK-01]
          Length = 121

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 69/115 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D+E   IPVI VT    + D+   ++ G + Y++KP+     ++T+
Sbjct: 61  FQATRQLTKDAETSHIPVIIVTTKDQETDKVWGKRQGAKDYLTKPVDEDTLLKTL 115


>gi|289673815|ref|ZP_06494705.1| response regulator receiver:GAF:ATP-binding region,
           ATPase-like:histidine kinase A, N-terminal:CHASE3
           [Pseudomonas syringae pv. syringae FF5]
          Length = 569

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
           +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 445 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 504

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 505 FEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 563



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 179 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 238

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 239 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 279



 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 298 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 357

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 358 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 388


>gi|302187737|ref|ZP_07264410.1| response regulator receiver [Pseudomonas syringae pv. syringae 642]
          Length = 1172

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 FEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 991


>gi|320158373|ref|YP_004190751.1| two-component system sensor protein [Vibrio vulnificus MO6-24/O]
 gi|319933685|gb|ADV88548.1| two-component system sensor protein [Vibrio vulnificus MO6-24/O]
          Length = 1072

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE----LAR-QHKPDVIIMDIQLQE 58
           KV++ EDNE+N ++  +L+E +G +     NG EALE    +A+ +   D++ MD+Q+  
Sbjct: 696 KVLLTEDNEINQQIAVELMEGNGLLVTVANNGQEALEHLEAMAKGESHFDIVFMDLQMPV 755

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G E + +I+ +S    IP+IA+TA AM  + ER    G   +ISKPI   I   TI+K
Sbjct: 756 MDGYEASHRIRANSSYDTIPLIAMTAHAMVEERERCLNLGMNDHISKPIDPEILFNTIRK 815

Query: 119 Y 119
           +
Sbjct: 816 W 816



 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 67/125 (53%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIET-SGYIALQTRNGMEALELAR-----QHKPDVIIMDIQLQ 57
           ++++V+DNE  +++ ++++ T  G +AL   +G +A++  R     + K D+I MD  + 
Sbjct: 546 RILVVDDNEHALEIMQEMLSTLPGKVAL-ANSGQQAVDCIRKASEQREKFDLIFMDWNMP 604

Query: 58  EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E+ G+E ++ I+E    +  P ++ VTA+  +   +         ++SKP+  S   + +
Sbjct: 605 EMDGIETSRLIRESFASEYQPQIVIVTAYDKEDVLDATNDLDIAGFLSKPVGQSYLFDLL 664

Query: 117 KKYIG 121
            +  G
Sbjct: 665 VELFG 669


>gi|300866841|ref|ZP_07111518.1| putative Response regulator receiver modulated diguanylate cyclase
           [Oscillatoria sp. PCC 6506]
 gi|300335151|emb|CBN56678.1| putative Response regulator receiver modulated diguanylate cyclase
           [Oscillatoria sp. PCC 6506]
          Length = 320

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 66/104 (63%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IV+DN  N++L   ++E+ GYI  ++ NG  AL+ A +  PD+II+DI + +++G E
Sbjct: 12  NILIVDDNPDNLRLLSKILESQGYIVRKSLNGKMALQAAYRDPPDLIILDINMPDMNGYE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           + +Q+KE    Q++P+I ++A     D+ R  + G   YI+KP 
Sbjct: 72  VCQQLKESEATQDLPIIFISALDRVNDKVRAFEMGAVDYITKPF 115


>gi|307718270|ref|YP_003873802.1| hypothetical protein STHERM_c05640 [Spirochaeta thermophila DSM 6192]
 gi|306531995|gb|ADN01529.1| hypothetical protein STHERM_c05640 [Spirochaeta thermophila DSM 6192]
          Length = 1272

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 65/118 (55%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K +++V+D +LN  L ++ +  +G   ++  NG EAL  A  H PD+I+MDI++  + GL
Sbjct: 1043 KVILVVDDKDLNRTLLKEYLAPTGATVIEASNGQEALSRAEAHPPDLILMDIRMPVMDGL 1102

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               K+   D   + IPVIA+TA  +K   E   + G    ++KPI       T++ ++
Sbjct: 1103 SFIKEYYRDPSHRNIPVIALTASVLKERHEEFLRNGFVEVLTKPIQKDALFSTLRSFL 1160


>gi|281417527|ref|ZP_06248547.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum
           JW20]
 gi|281408929|gb|EFB39187.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum
           JW20]
          Length = 902

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED+++N ++   +++          NG EA++L  +++ D+I+MD+Q+ E+ G+E 
Sbjct: 667 ILLAEDDKVNQQVIAGMLKKEQCSLTIAENGFEAIKLFEENEFDLILMDVQMPEMDGIEA 726

Query: 65  TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           TK+I+  E+   + IP+IAVTAFA + D E+I + G + YISKP S 
Sbjct: 727 TKRIRKMEEGTFRHIPIIAVTAFAFENDREKILEAGMDDYISKPFSF 773


>gi|71278636|ref|YP_270772.1| hybrid sensory histidine kinase BarA [Colwellia psychrerythraea
           34H]
 gi|71144376|gb|AAZ24849.1| sensor histidine kinase/response regulator [Colwellia
           psychrerythraea 34H]
          Length = 948

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 69/116 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+ V+DNE N+KL + L+       ++  NGM A+EL +     +I MDIQ+  + G+ 
Sbjct: 689 KVLAVDDNEANLKLIKALLLEQVAEVVEADNGMSAVELCKVENFSLIFMDIQMPIMDGIS 748

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             K+IK+ +     P+IAVTA A+ G+ E++ + G  AY++KPI  ++    I +Y
Sbjct: 749 ALKEIKQLTNNNNTPIIAVTAHALSGEREKMHQQGFNAYMTKPIDETMLRHIIYEY 804


>gi|153870769|ref|ZP_02000098.1| two-component histidine kinase [Beggiatoa sp. PS]
 gi|152072765|gb|EDN69902.1| two-component histidine kinase [Beggiatoa sp. PS]
          Length = 1262

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 70/117 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VEDN +N ++ +  IE+ G I     NG EA+ +      D ++MD+Q+ E+ G+E
Sbjct: 947  RILVVEDNSINQQVIQKTIESEGLIVEIANNGKEAVMMVDNIHFDAVLMDMQMPEMDGME 1006

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I++ ++   +P+IA+TA AM G  E++   G   YI+KP  +      ++K+I
Sbjct: 1007 ATQLIRQKTQHDNLPIIAMTAHAMSGVREKLLAVGMNDYITKPFDVDDLFSVLEKWI 1063



 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 4/123 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNG---MEALELARQHKP-DVIIMDIQLQEI 59
           K +IV+DN+ +  + +  + T     +   +G   + ALE A Q +P D++ +D ++  +
Sbjct: 799 KALIVDDNKTSRTILQQELNTFSLQVIAVDSGEAAIVALETAAQTQPYDLVFLDWKMPGM 858

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +G+E  + IK+++ L  + +I +TAF+ +       K   +A+++KP++ S+  +TI   
Sbjct: 859 NGIETARCIKQNANLPPVSIIMMTAFSRENFLTETDKDYLDAFLTKPVTQSLLFDTIMTV 918

Query: 120 IGE 122
            G+
Sbjct: 919 FGK 921


>gi|254457181|ref|ZP_05070609.1| multi-sensor hybrid histidine kinase [Campylobacterales bacterium
           GD 1]
 gi|207085973|gb|EDZ63257.1| multi-sensor hybrid histidine kinase [Campylobacterales bacterium
           GD 1]
          Length = 1127

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 74/122 (60%), Gaps = 5/122 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH--KPDVIIMDIQLQEISG 61
           KV++VEDN+ N  + + ++ + G  A    NG+EALEL +    K DV++MD Q+ E+ G
Sbjct: 801 KVLLVEDNQTNQIVAQGILNSFGLNADVANNGIEALELLKDSAKKYDVVLMDCQMPELDG 860

Query: 62  LEITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            + T+ I++    +    IP+IA+TA AM GD+E+    G + Y+SKP+   +   T+ K
Sbjct: 861 YDTTRAIRDAKAGKAYISIPIIAMTANAMAGDKEKCSIAGMDDYLSKPLDPELLRSTLAK 920

Query: 119 YI 120
           ++
Sbjct: 921 WL 922


>gi|158520998|ref|YP_001528868.1| PAS/PAC sensor hybrid histidine kinase [Desulfococcus oleovorans
            Hxd3]
 gi|158509824|gb|ABW66791.1| PAS/PAC sensor hybrid histidine kinase [Desulfococcus oleovorans
            Hxd3]
          Length = 1791

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 74/117 (63%), Gaps = 2/117 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VED+ ++ ++   +++  G+ A    NG EA++L  +   D+++MDIQ+  + G+ 
Sbjct: 1672 RILLVEDSAISRRVLLQMLDKMGHTATIAVNGAEAVKLFSRQSFDMVLMDIQMPVMDGIA 1731

Query: 64   ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             TKQIK  +    +++PVIA+TA AM GD ERI   G + Y++KP+ +    + I++
Sbjct: 1732 ATKQIKSMQKETGKKVPVIAITANAMAGDRERILSQGLDDYVAKPVKMETLADAIRR 1788


>gi|125973324|ref|YP_001037234.1| PAS/PAC sensor hybrid histidine kinase [Clostridium thermocellum
           ATCC 27405]
 gi|256005431|ref|ZP_05430394.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum DSM
           2360]
 gi|125713549|gb|ABN52041.1| PAS/PAC sensor hybrid histidine kinase [Clostridium thermocellum
           ATCC 27405]
 gi|255990571|gb|EEU00690.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum DSM
           2360]
 gi|316940443|gb|ADU74477.1| multi-sensor hybrid histidine kinase [Clostridium thermocellum DSM
           1313]
          Length = 902

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++ ED+++N ++   +++          NG EA++L  +++ D+I+MD+Q+ E+ G+E 
Sbjct: 667 ILLAEDDKVNQQVIAGMLKKEQCSLTIAENGFEAIKLFEENEFDLILMDVQMPEMDGIEA 726

Query: 65  TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           TK+I+  E+   + IP+IAVTAFA + D E+I + G + YISKP S 
Sbjct: 727 TKRIRKMEEGTFRHIPIIAVTAFAFENDREKILEAGMDDYISKPFSF 773


>gi|309790815|ref|ZP_07685359.1| PAS fold family protein [Oscillochloris trichoides DG6]
 gi|308227102|gb|EFO80786.1| PAS fold family protein [Oscillochloris trichoides DG6]
          Length = 1149

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGL 62
            ++++ EDN +N ++    +E  GY A    NG+EA+E +ARQH  DV++MD+Q+ E+ GL
Sbjct: 902  RILLAEDNAVNQRVALRTLERLGYRADVVGNGLEAIEAIARQHY-DVVLMDVQMPELDGL 960

Query: 63   EITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            E T+QI         P +IA+TA AM+GD ER    G + YISKP+ L
Sbjct: 961  EATRQIVARWPATARPRIIAMTANAMRGDRERCLAAGMDDYISKPVRL 1008


>gi|256419624|ref|YP_003120277.1| histidine kinase [Chitinophaga pinensis DSM 2588]
 gi|256034532|gb|ACU58076.1| histidine kinase [Chitinophaga pinensis DSM 2588]
          Length = 732

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+DNE+N  L + L            NGMEAL+  ++ + D+I+MDIQ+ E+ G  
Sbjct: 484 KILVVDDNEMNRSLMKHLFTEWELSFDLASNGMEALDCLKKSRYDLILMDIQMPEMDGYT 543

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+ I+++ +L EIP++A+TA A+ G+ E+    G   YISKPI+     + I ++
Sbjct: 544 ATRVIRKEMKL-EIPIVAMTAHALAGEREKCLSNGMNEYISKPINEKELYQLINRF 598


>gi|115373567|ref|ZP_01460863.1| two-component response regulator [Stigmatella aurantiaca DW4/3-1]
 gi|310825069|ref|YP_003957427.1| response regulator [Stigmatella aurantiaca DW4/3-1]
 gi|115369409|gb|EAU68348.1| two-component response regulator [Stigmatella aurantiaca DW4/3-1]
 gi|309398141|gb|ADO75600.1| Response regulator [Stigmatella aurantiaca DW4/3-1]
          Length = 150

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 70/115 (60%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+V++V+D +   +++ + +E +G+     RNG EA+E A++  PD+I+MD+ L  + G 
Sbjct: 24  KRVLVVDDFDDAREMYAEYLEFAGFAVETARNGAEAVEKAQEASPDIILMDLSLPVMDGW 83

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E T+ IK D   ++IPV+A++   + G E   ++ G + +++KP   S   + I+
Sbjct: 84  EATRLIKNDVRTRDIPVMALSGHVLAGSEHHAKEAGADEFVAKPCLPSDLEDKIR 138


>gi|295703661|ref|YP_003596736.1| two-component sensor histidine kinase/response regulator [Bacillus
           megaterium DSM 319]
 gi|294801320|gb|ADF38386.1| two-component sensor histidine kinase/response regulator [Bacillus
           megaterium DSM 319]
          Length = 917

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 74/119 (62%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K+V+IV+D++ N+   +  +   G   +   NG+E LE+ +  +P D+I+MDI + ++ G
Sbjct: 797 KRVLIVDDDQRNIFALKTALAKQGMTIMTAHNGIECLEMMKNSEPFDLILMDIMMPQMDG 856

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E  ++I+ + +L ++P+IA+TA AMK D E+  + G   YISKP+ L+     ++ ++
Sbjct: 857 YEAMQKIRGELKLVDLPIIALTAKAMKNDREKCLEAGASDYISKPLDLNQLFSVMRVWL 915


>gi|238758178|ref|ZP_04619357.1| Signal transduction histidine-protein kinase barA [Yersinia aldovae
           ATCC 35236]
 gi|238703508|gb|EEP96046.1| Signal transduction histidine-protein kinase barA [Yersinia aldovae
           ATCC 35236]
          Length = 937

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 73/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 686 KVMAVDDNPANLKLIGTLLEELVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 745

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S  Q+ P+IAVTA A++G +E++ K G   Y++KP+  +  ++ + +Y
Sbjct: 746 ASEIIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPLDEARLIQALSRY 801


>gi|256829959|ref|YP_003158687.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579135|gb|ACU90271.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 705

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED+E++      L++  G+      NG+EALE  R+   D ++MD+Q++ + GLE
Sbjct: 581 RILLVEDDEISRVAETQLLKKMGHTVQTAGNGIEALESMRRSTFDCVLMDVQMEVMDGLE 640

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
            TK I+ D       +IP++A+TA+AM+GD ER    G + YI+KP
Sbjct: 641 ATKNIRTDVSKFFDPKIPIVAMTAYAMRGDRERFIMAGMDDYIAKP 686


>gi|330953354|gb|EGH53614.1| response regulator receiver [Pseudomonas syringae Cit 7]
          Length = 1172

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 FEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 991


>gi|332703162|ref|ZP_08423250.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553311|gb|EGJ50355.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 657

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+I EDN +N  L  ++++  G+      NG  ALE  R+ K D+++MD ++  + G E
Sbjct: 531 KVLIAEDNSINQILATEILKEKGHSMFVVENGQAALEALRKEKFDLVLMDAKMPVMDGEE 590

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            T++I+  ++   ++P++A+TA+A+KGD ER    G + YISKPI +
Sbjct: 591 ATRRIRAGEAGDPDVPIVALTAYALKGDRERFLAAGMDDYISKPIDM 637


>gi|95930680|ref|ZP_01313414.1| response regulator receiver protein [Desulfuromonas acetoxidans DSM
           684]
 gi|95133332|gb|EAT14997.1| response regulator receiver protein [Desulfuromonas acetoxidans DSM
           684]
          Length = 125

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 73/118 (61%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + +++VED E  +KL   L+ + GY  +   NG+ AL++  + K D++++DI L EI G 
Sbjct: 4   RTILVVEDEESLLKLESILLTSKGYEVIGVPNGLAALDVLDKEKVDLVLLDIMLPEIDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ ++IK + E Q++PVI +TA     D  R  + G + Y++KP   +  +ETI+++I
Sbjct: 64  EVCRRIKNNPETQKLPVIMLTAKKSHEDMSRGDEVGADWYVTKPFKSAKVIETIERFI 121


>gi|163760024|ref|ZP_02167108.1| Hybrid sensory histidine kinase [Hoeflea phototrophica DFL-43]
 gi|162282982|gb|EDQ33269.1| Hybrid sensory histidine kinase [Hoeflea phototrophica DFL-43]
          Length = 848

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN++N  +F+  ++  G       NG EA+    + +PD+++MD+ + E++GLE 
Sbjct: 720 VLVAEDNQINQIVFQQSLQGMGVNHELAINGREAVTKWSELRPDIVLMDVSMPELNGLEA 779

Query: 65  TKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T +I+       L   P+IAVTA  +KGDE+R    G + Y+SKPIS       I++++
Sbjct: 780 TAEIRAIEARDGLAPTPIIAVTAHTLKGDEDRCLAAGMDDYMSKPISPEKLAAMIERWL 838


>gi|162451977|ref|YP_001614344.1| two-component hybrid sensor and regulator [Sorangium cellulosum 'So
           ce 56']
 gi|161162559|emb|CAN93864.1| two-component hybrid sensor and regulator [Sorangium cellulosum 'So
           ce 56']
          Length = 438

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 72/122 (59%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++ +ED+  N  L R L++ +GY  L+  +G+E + LA    PD++++D+ +  + G
Sbjct: 15  MSKILHIEDDPANRLLVRKLLQNAGYEVLEAADGLEGVRLACTQHPDLVLVDLNIPGLDG 74

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+T +++ ++ L  +P++A+TA   +GD +     GC+ ++ KPI    F   I +Y+ 
Sbjct: 75  FEVTLRLRGEASLAGVPIVAITA---EGDRDTSLAVGCDGFLQKPIDARSFPSIIARYLS 131

Query: 122 EA 123
            A
Sbjct: 132 GA 133


>gi|330878816|gb|EGH12965.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 410

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
           +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 286 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 345

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 346 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 404



 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 20  ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 79

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 80  LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 120



 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 139 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 198

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 199 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 229


>gi|269101851|ref|ZP_06154548.1| BarA sensory histidine kinase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161749|gb|EEZ40245.1| BarA sensory histidine kinase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 921

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 69/118 (58%), Gaps = 2/118 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       +    G +A+E A+Q   D+I MDIQ+ E+ G+  
Sbjct: 669 VMAVDDNTANLKLISALLCERVETVITATGGRKAVEYAKQKAFDLIFMDIQMPEMDGVTA 728

Query: 65  TKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            +QI  D+EL +  PVIAVTA AM G+ ER+   G + Y++KPI   I  + + ++I 
Sbjct: 729 CQQI-HDTELNRTTPVIAVTAHAMAGERERLINAGMDDYLTKPIEEHILQQVLGRWIA 785


>gi|301064957|ref|ZP_07205311.1| PAS domain S-box protein [delta proteobacterium NaphS2]
 gi|300440940|gb|EFK05351.1| PAS domain S-box protein [delta proteobacterium NaphS2]
          Length = 914

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN +N ++   ++E +G+      +G+ ALE  ++   DV+ MDIQ+  + G  
Sbjct: 664 RVLLVEDNLVNQRVAVRILEKAGHTVHVAGDGLVALEAVKKDNYDVVFMDIQMPGMDGYA 723

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T  I++      E+P+IA+TA AMKGD E+    G + YISKP+     ++ ++++ G+
Sbjct: 724 ATATIRKMAPRFSELPIIAMTAHAMKGDREKCIASGMDDYISKPVKPKGLLKMVQRWAGK 783



 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 62/117 (52%), Gaps = 5/117 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH----KP-DVIIMDIQLQEI 59
           V+IV+DN  N  +    + + G    +  +G EA+EL  Q     +P D +++D Q+ E+
Sbjct: 511 VLIVDDNATNRTILNKTLVSFGCFPEEAESGGEAMELLAQRMAEGRPFDAVLLDHQMPEM 570

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            G  + + I+     +   ++ +T+   +GD  R +  GC AY++KP+  S+ ++ +
Sbjct: 571 DGEAVVRAIRSKPGNENTRILILTSVGERGDARRFKDLGCCAYLNKPVRQSLLLDAL 627


>gi|302806276|ref|XP_002984888.1| pseudo response regulator [Selaginella moellendorffii]
 gi|300147474|gb|EFJ14138.1| pseudo response regulator [Selaginella moellendorffii]
          Length = 176

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 70/117 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN++N+ +   +++  G+ A    NG+EALE  R+ K D++++DI +  + GL+
Sbjct: 53  RILLAEDNKVNVMVAISMLKRLGFTAQVVANGVEALEAMRKDKYDLVLLDICMPLMDGLQ 112

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +   I+       IP+IAVTA A++ D ER    G +A+I KP+      E + KY+
Sbjct: 113 VAYAIRNTGTSPRIPIIAVTANALRSDIERCFAHGMDAFIPKPVMFQKLREILSKYL 169


>gi|209809112|ref|YP_002264650.1| response regulator, histidine kinase [Aliivibrio salmonicida
           LFI1238]
 gi|208010674|emb|CAQ81061.1| response regulator, histidine kinase [Aliivibrio salmonicida
           LFI1238]
          Length = 755

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN  N  + ++ +  +GY      NG EA+ +      D+I MDI + E+ G+ 
Sbjct: 495 RLLVVEDNLANQIVIKNTLSYAGYTIDIANNGKEAISMVTDTDYDLIFMDISMPEMDGMT 554

Query: 64  ITKQIKEDSELQE-IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            TK+I+  S+  E +P+IA+TA A+ GD+ER    G   Y+SKP + +  +E +  Y+ 
Sbjct: 555 ATKKIRTLSKHHEKMPIIALTAHALSGDKERFIDAGMTDYLSKPFNRTALLECLATYLS 613


>gi|197117105|ref|YP_002137532.1| PilZ domain-containing response regulator [Geobacter bemidjiensis
           Bem]
 gi|197086465|gb|ACH37736.1| response regulator, PilZ domain-containing protein [Geobacter
           bemidjiensis Bem]
          Length = 240

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 67/116 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+M+V+D  L ++L +  ++ S    +   NG EALEL R+  PD+I MD+ +  + G+ 
Sbjct: 5   KIMLVDDTRLILELEKSFLKLSHVDVVTAGNGAEALELIRKDPPDLIFMDMHMPVMDGIA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              ++K D  L  IPV+ +T    + D E  +  GC+ +++KP+   +F++  +KY
Sbjct: 65  CCTELKADPFLCGIPVVMLTTAGKEEDRELAKAAGCDNFLTKPVDRRLFLDLARKY 120


>gi|332704399|ref|ZP_08424487.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
 gi|332554548|gb|EGJ51592.1| multi-sensor hybrid histidine kinase [Desulfovibrio africanus str.
            Walvis Bay]
          Length = 1202

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 1/107 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDN +NM L ++L++  G        G EALE   +   D+++MD+Q+ E+ G E
Sbjct: 1079 RVLLAEDNAINMHLAKELLKKRGNSVTGVSTGKEALEALAKESFDLVLMDVQMPEMDGEE 1138

Query: 64   ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T++I+  ++    +P++A+TA+A++GD ER    G + Y+SKPI++
Sbjct: 1139 ATRRIRAGEAGDPSVPIVALTAYALEGDRERFLAAGMDDYLSKPINM 1185


>gi|239908139|ref|YP_002954880.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239798005|dbj|BAH76994.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 807

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 71/116 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VEDN +N ++ R+ +E+ G       NG EA+E+ R    DV++MD+Q+  + GL  
Sbjct: 315 VLLVEDNAINQQVARETLESLGAAVDVAINGREAVEMVRSSLYDVVLMDVQMPVMDGLAA 374

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           T+ I++     E+P++A+TA A+  D ER  + G   Y++KP+ +   + ++ ++I
Sbjct: 375 TRAIRQLPGTAELPIVALTAHALAEDRERCLEAGMNDYLTKPLEVDRLLASLGQWI 430



 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           +V++V+D +LN  +F  ++ + G+  +   NG +A       KP     D+I+MDI++ E
Sbjct: 586 RVLLVDDAKLNRAIFSQILRSGGHEVVTAENGKDACRRLFGQKPDGRPFDLILMDIEMPE 645

Query: 59  ISGLEITKQIKEDSELQ-------EIPVIAVTAFAMKGDEERIRKGGCEAYISK 105
           + G    + I+              +P++A+T+   K +  R  + G +A + K
Sbjct: 646 MDGPTAARTIRRLLAASVAPPCAPGVPIVALTSHDCKDEAARCLEAGMDACLHK 699


>gi|83312537|ref|YP_422801.1| sensor protein gacS [Magnetospirillum magneticum AMB-1]
 gi|82947378|dbj|BAE52242.1| Sensor protein gacS [Magnetospirillum magneticum AMB-1]
          Length = 1117

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N ++   L+   G+      +G EALE  R    DV++MD+Q+ E+ GLE
Sbjct: 869 RILVAEDNPVNQQVALGLLRKLGHTVDVVGDGAEALEAVRLLPYDVVLMDVQMPEMDGLE 928

Query: 64  ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ I+       ++P++A+TA AM+GD++     G + YISKPI      E + KY G
Sbjct: 929 ATRAIRALPLAAAQVPIVAMTANAMRGDDQMCFDAGMDGYISKPIDRHKLAEALAKYSG 987



 Score = 37.0 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSG---YIALQTRNGM-EALELARQHKP-DVIIMDIQLQE 58
           +V++V+DN +N  +    +   G   +  L   +GM E    A    P +V ++D Q+  
Sbjct: 722 RVLVVDDNPVNCDVIERQLRAFGVEVHACLDAGSGMGELTRAAAMGTPWEVAVVDSQMPV 781

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           ++G E+ + I     L    ++  ++  M  D+    +   +A++ KP+  S  ++TI +
Sbjct: 782 VTGSEMVRMIHAIPMLAGTRIVVTSSQGMPADQND-GQPAIDAFLHKPLRQSTLLDTIGR 840

Query: 119 YIG 121
            +G
Sbjct: 841 VLG 843


>gi|88813512|ref|ZP_01128746.1| Response regulator receiver:ATP-binding region,
           ATPase-like:Histidine kinase A, N-terminal:Hpt
           [Nitrococcus mobilis Nb-231]
 gi|88789225|gb|EAR20358.1| Response regulator receiver:ATP-binding region,
           ATPase-like:Histidine kinase A, N-terminal:Hpt
           [Nitrococcus mobilis Nb-231]
          Length = 715

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 2/106 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+ +N KL   L++  G+  +   NG EA+ +  + + D+++MD+Q+ E+ GLE
Sbjct: 453 RILLAEDSIVNQKLALALLKKHGHDVVVANNGKEAVAVFDRDRFDLVLMDVQMPEMDGLE 512

Query: 64  ITKQI--KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            T  +  KE +  + +P+IA+TA AMKGD E+  + G + Y+SKPI
Sbjct: 513 ATAAVRAKEANSDRHVPIIALTAHAMKGDREQCLEAGMDGYVSKPI 558



 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTR---NGMEALELA-RQHKP-DVIIMDIQLQE 58
           + +IV+DN  N  +  +++   G  A        G+ AL  A    +P  ++I D  +  
Sbjct: 311 RALIVDDNATNRLILNEMLGNWGMQATSVAAVAEGLAALRTAYAARRPFRLVITDCHMPG 370

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             G ++ ++IK+D +L +I ++ +T+ +  GD     + G  A++ KP+  S   + I  
Sbjct: 371 EDGFDLAEKIKQDGQLSDIQLVMLTSGSEPGDIAHCEQLGVVAHLLKPVKQSELFDAIGS 430

Query: 119 YIG 121
            +G
Sbjct: 431 ALG 433


>gi|323698341|ref|ZP_08110253.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. ND132]
 gi|323458273|gb|EGB14138.1| multi-sensor hybrid histidine kinase [Desulfovibrio desulfuricans
           ND132]
          Length = 1141

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 76/121 (62%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VEDNE+N ++ ++++ + G    +  NG +ALE  + +  D+++MDIQ+  + G 
Sbjct: 790 KRILLVEDNEINRQVAQEILASVGMEVFEAYNGEKALEFLKGNDVDLVLMDIQMPVMDGH 849

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E T++I++ +  +++P+IA+TA AM  D E+ ++ G   +I+KP         + +++  
Sbjct: 850 EATRRIRDQARFKDLPIIAMTAHAMLADIEKSKEVGMNDHIAKPFDPDDLFAVLNRWLSG 909

Query: 123 A 123
           A
Sbjct: 910 A 910



 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 63/124 (50%), Gaps = 5/124 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPD---VIIMDIQLQEIS 60
            ++V+DN  +  + + ++E  G      ++G EA++ L  +   D   ++++D ++ E+ 
Sbjct: 647 ALVVDDNPTSRIILKGMLEYMGLSVTTVKSGAEAIDALHGRRGADAFRLLVVDWRMPEMD 706

Query: 61  GLEITKQIKEDSELQ-EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           GLE  ++I +D  +  + P+  V+A+      +R  + G    + KP++ S     + + 
Sbjct: 707 GLETAERILKDEAIAVKPPMFMVSAYGNASLVKRTNELGFRGLLFKPVNQSFLFNLVVET 766

Query: 120 IGEA 123
           +G+ 
Sbjct: 767 LGKG 770


>gi|262166495|ref|ZP_06034232.1| BarA sensory histidine kinase [Vibrio mimicus VM223]
 gi|262026211|gb|EEY44879.1| BarA sensory histidine kinase [Vibrio mimicus VM223]
          Length = 927

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+    D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVECVVACTSGQEAIEQAQIRHFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K+IK+     + PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKEIKQLKGYNDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|186683956|ref|YP_001867152.1| hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186466408|gb|ACC82209.1| hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 609

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 62/115 (53%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VE++  N  L +  +   GY     +N  E  E   Q  P VI+MD+ L + +GL +
Sbjct: 490 VLLVENDLPNADLMQIYLRKLGYQVTWVKNAAEMWEALTQLDPAVILMDVYLPDGNGLNL 549

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            +Q++E  + Q IPVI  TA AMKGD E     G   YISKPI L +    + KY
Sbjct: 550 VRQLREHEQYQTIPVIVQTAMAMKGDRETCLTAGVNDYISKPIDLPLLASLVAKY 604


>gi|242280762|ref|YP_002992891.1| multi-sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
            2638]
 gi|242123656|gb|ACS81352.1| multi-sensor hybrid histidine kinase [Desulfovibrio salexigens DSM
            2638]
          Length = 1670

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 68/117 (58%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++VEDNELN ++ R ++E  G       NG +ALE        ++IMDIQ+ E+ GL 
Sbjct: 1333 KILLVEDNELNQQVARRMLEGMGLDVDVADNGRKALEALESEPYSLVIMDIQMPEMDGLT 1392

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++ I+ D   + +P++A+TA AM GD E+  + G   +++KPI        + KY+
Sbjct: 1393 ASRIIRSDERYRNLPILAMTAHAMPGDREKSFEAGMNEHLTKPIDPEELKRALVKYL 1449



 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 62/118 (52%), Gaps = 12/118 (10%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPD---VIIMDIQLQEI 59
            K +++E N +  +  R  +E SG   +       ALE LA     D   +I++  ++Q++
Sbjct: 1185 KSLVIEGNMMAREFIRSTMEKSGITVMVDSTASSALERLAESIDVDGLGLILVSGKIQDM 1244

Query: 60   SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG----GCEAYISKPIS-LSIF 112
              LE+ ++I+   +L  +P+I ++   M   +E  RK     G + ++++P+S LS++
Sbjct: 1245 HVLEVVERIRNMPKLMHVPIILMSPVNM---DESFRKEAALVGVDGFVTRPVSRLSLY 1299


>gi|120601627|ref|YP_966027.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio vulgaris DP4]
 gi|120561856|gb|ABM27600.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio vulgaris DP4]
          Length = 1005

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ ED  +N       +   G+ A+   NG+EA+E  R+ + D ++MDIQ+ E+ GLE
Sbjct: 882 KVLVAEDEAVNRMTLSRCLHHLGHEAVCVTNGLEAVEALREGRFDCVLMDIQMPELDGLE 941

Query: 64  ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              +I+ ++  Q     PV+A+TA AM+GD ER    G  AYI KPI L
Sbjct: 942 ALARIRAEAGEQARALPPVVALTAHAMEGDRERFLAAGMSAYIPKPIEL 990


>gi|70989279|ref|XP_749489.1| two-component osmosensing histidine kinase (Bos1) [Aspergillus
            fumigatus Af293]
 gi|66847120|gb|EAL87451.1| two-component osmosensing histidine kinase (Bos1), putative
            [Aspergillus fumigatus Af293]
 gi|159128901|gb|EDP54015.1| two-component osmosensing histidine kinase (Bos1), putative
            [Aspergillus fumigatus A1163]
          Length = 1337

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 72/117 (61%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N KL   ++E   +      NG+EA+E  ++ + DVI+MD+Q+  + G E 
Sbjct: 1147 ILLAEDNDVNQKLAVKILEKHNHNVSVVGNGLEAVEAVKKRRYDVILMDVQMPVMGGFEA 1206

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  M+TI K
Sbjct: 1207 TGKIREYEREAGLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMMQTILK 1263


>gi|322420174|ref|YP_004199397.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M18]
 gi|320126561|gb|ADW14121.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter sp. M18]
          Length = 237

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV++V+D  + ++L +D +  S       RNG +AL + ++H+PD+++MD+ +  ++
Sbjct: 1   MAHKVLLVDDVTMFLELEKDFLSLSSVDVHIARNGQDALRVCQEHQPDLVVMDLHMPVMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G +    IK+D +L   PVI VT+   + D +   + GC+ +++KP+   +F+E  +K +
Sbjct: 61  GADCCLAIKKDPQLSS-PVILVTSEGKEADRQLCLQAGCDDFLTKPLDRQVFLEAARKLL 119


>gi|83643743|ref|YP_432178.1| signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
 gi|83631786|gb|ABC27753.1| Signal transduction histidine kinase [Hahella chejuensis KCTC 2396]
          Length = 834

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (59%), Gaps = 6/126 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-----LARQHK-PDVIIMDIQLQ 57
           +V++VEDN  N ++ R L+   G       NG++A+      L R+    D+I MDIQ+ 
Sbjct: 477 RVLVVEDNPGNQEVARHLLGDLGLHVDICNNGLQAINRIKDALYRKEGLWDLIFMDIQMP 536

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ GL+ T+ +++   L + PVIA+TA A+ GD+ER  K G   YI+KPI ++    T+K
Sbjct: 537 EMDGLQATQLLRKLPGLDKTPVIAMTAMAIAGDKERCLKAGMNDYITKPIDVNQLYRTLK 596

Query: 118 KYIGEA 123
            ++ EA
Sbjct: 597 AWMREA 602


>gi|262193605|ref|YP_003264814.1| response regulator receiver protein [Haliangium ochraceum DSM
           14365]
 gi|262076952|gb|ACY12921.1| response regulator receiver protein [Haliangium ochraceum DSM
           14365]
          Length = 295

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 71/120 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           +LKK+++ ED++    +    +  +G++ L+  +G EAL L R H PD++++D+ +  + 
Sbjct: 2   LLKKIVVAEDDDAIAHMVNMSLGDAGFLCLRASDGEEALNLVRLHTPDLLVLDVMMPRMD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++IK D  L +IP++ +TA +   ++    + G +AY+SKP  L  F    K  I
Sbjct: 62  GIEVARRIKGDVVLSKIPILMLTALSAVDNKLEGYEAGADAYLSKPFDLREFSAQAKALI 121


>gi|153870138|ref|ZP_01999599.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
 gi|152073399|gb|EDN70404.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
          Length = 280

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 73/119 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K+++V+D E N  + ++L+   G+   +  NG++ +E A ++ PDVI+MD+ + E++G
Sbjct: 71  VQKILVVDDKEANRSVLKNLLSPLGFEIREAINGVDGIEKALKYFPDVILMDLIMPEMNG 130

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           LE T  I+   +L ++ +IAV+A A +   E     GC  +I+KPI      E ++KY+
Sbjct: 131 LEATHWIRNSLKLPDVVIIAVSASAFQQHREESLASGCNDFIAKPIQTDEIREKLQKYL 189


>gi|46581083|ref|YP_011891.1| sensory box histidine kinase/response regulator [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46450504|gb|AAS97151.1| sensory box histidine kinase/response regulator [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234760|gb|ADP87614.1| multi-sensor hybrid histidine kinase [Desulfovibrio vulgaris RCH1]
          Length = 1005

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ ED  +N       +   G+ A+   NG+EA+E  R+ + D ++MDIQ+ E+ GLE
Sbjct: 882 KVLVAEDEAVNRMTLSRCLHHLGHEAVCVTNGLEAVEALREGRFDCVLMDIQMPELDGLE 941

Query: 64  ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
              +I+ ++  Q     PV+A+TA AM+GD ER    G  AYI KPI L
Sbjct: 942 ALARIRAEAGEQARALPPVVALTAHAMEGDRERFLAAGMSAYIPKPIEL 990


>gi|330982197|gb|EGH80300.1| response regulator receiver [Pseudomonas syringae pv. aptata str. DSM
            50252]
          Length = 1031

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 907  RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 966

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 967  FEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1025



 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 641 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 700

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 701 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 741



 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 760 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 819

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 820 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 850


>gi|330900706|gb|EGH32125.1| response regulator receiver [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 934

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
           +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 810 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 869

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 870 FEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 928



 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 544 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 603

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 604 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 644



 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 663 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 722

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 723 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 753


>gi|302337012|ref|YP_003802218.1| multi-sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
 gi|301634197|gb|ADK79624.1| multi-sensor hybrid histidine kinase [Spirochaeta smaragdinae DSM
           11293]
          Length = 944

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 72/121 (59%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDNELN +     +E +G++     NG EA+E+ ++   D+I+MD+Q+ E+ G+E
Sbjct: 680 RVLLAEDNELNQRSISYFLEEAGHLVTIAANGREAIEVLKREPFDLILMDVQMPEMDGME 739

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T  I+  ++      IP+IA+TA+A+K DE R    G + +++KPI   +    I +  
Sbjct: 740 ATGIIRSHTDRLFNPNIPIIALTAYALKEDELRFIAAGMDRFVTKPIKKELLFLAIYEMT 799

Query: 121 G 121
           G
Sbjct: 800 G 800


>gi|253567011|ref|ZP_04844462.1| two-component system sensor histidine kinase [Bacteroides sp. 3_2_5]
 gi|251944135|gb|EES84644.1| two-component system sensor histidine kinase [Bacteroides sp. 3_2_5]
          Length = 1039

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF  ++    Y  +   +G EA+E  ++  P +I+MDI +  + G E 
Sbjct: 920  ILIAEDNESNYRLFESIL-GHDYHLIHAWDGREAVERFKRENPQIILMDINMPVMDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 979  TQEIRKYS--AKVPIIAVTAFAYTSDEQRVMENGFDGYMPKPIN 1020


>gi|60682196|ref|YP_212340.1| putative two-component system histidne kinase/reponse regulator
           fusion protein [Bacteroides fragilis NCTC 9343]
 gi|60493630|emb|CAH08419.1| putative two-component system histidne kinase/reponse regulator
           fusion protein [Bacteroides fragilis NCTC 9343]
          Length = 1015

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N +LF  ++    Y  +   +G EA+E  ++  P +I+MDI +  + G E 
Sbjct: 896 ILIAEDNESNYRLFESIL-GHDYHLIHAWDGREAVERFKRENPQIILMDINMPVMDGYEA 954

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 955 TQEIRKYS--AKVPIIAVTAFAYASDEQRVMENGFDGYMPKPIN 996


>gi|301163674|emb|CBW23228.1| putative two-component system histidne kinase/reponse regulator
           fusion protein [Bacteroides fragilis 638R]
          Length = 1015

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE N +LF  ++    Y  +   +G EA+E  ++  P +I+MDI +  + G E 
Sbjct: 896 ILIAEDNESNYRLFESIL-GHDYHLIHAWDGREAVERFKRENPQIILMDINMPVMDGYEA 954

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
           T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 955 TQEIRKYS--AKVPIIAVTAFAYASDEQRVMENGFDGYMPKPIN 996


>gi|262195449|ref|YP_003266658.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
 gi|262078796|gb|ACY14765.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
          Length = 928

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ ED+  N  L R L+E +G+  +Q  NG+EA+      + D+++MDIQ+ E+ GLE
Sbjct: 684 RVLLAEDHPTNALLTRRLLERAGHEVVQVSNGLEAVATWAAQRFDLVLMDIQMPELDGLE 743

Query: 64  ITKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            T++I+ +   +    P++A+TA  +K DE+R    G +AY+ KP+
Sbjct: 744 ATRRIRSEERARGGYTPIVALTANTLKDDEQRCLDAGMDAYLGKPL 789


>gi|297537876|ref|YP_003673645.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Methylotenera sp. 301]
 gi|297257223|gb|ADI29068.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Methylotenera sp. 301]
          Length = 331

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           +L K++IV+D   N+K+ + +++    ++   +NG++ALELA +  PD+I++D+ + E++
Sbjct: 7   LLPKLLIVDDEPTNLKVLKQVLQQDYRLSF-AKNGVDALELAARELPDLILLDVMMPEMT 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +Q+K     Q IPVI VTA   + DE +  + G   YI+KPI+  I    ++ ++
Sbjct: 66  GFEVCQQLKSQLNTQHIPVIFVTALKDEVDETKGFECGAVDYITKPITPVIVKARVRTHL 125

Query: 121 G 121
            
Sbjct: 126 S 126


>gi|258622337|ref|ZP_05717362.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
           VM573]
 gi|258585353|gb|EEW10077.1| Signal transduction histidine-protein kinase barA [Vibrio mimicus
           VM573]
          Length = 927

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+    D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLQERVECVVACTSGQEAIEQAQIRHFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K+IK+     + PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 727 CKEIKQLKGYSDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 781


>gi|256423935|ref|YP_003124588.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM
           2588]
 gi|256038843|gb|ACU62387.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM
           2588]
          Length = 1016

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIA--LQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            ++IVEDN +NM L   +++   + A   + ++G++A+ + R   PD+I+MDIQ+  ++G
Sbjct: 766 NILIVEDNPINMLLATTVVKRIAHDARIYEAQDGIDAIRICRAQLPDLILMDIQMPIMNG 825

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T +I+E    Q IP+IA+TA  +KG+ E+  + G   +ISKP+     ME  +K++
Sbjct: 826 YEATGRIREIKGGQRIPIIALTAGNLKGEREKCMEAGMNDFISKPLIQEKLMELFRKWL 884



 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEIS 60
           +K V+IV+DN+ N  + +++++  G    + R+G +ALEL   +   D+I+MD  +  + 
Sbjct: 621 IKDVLIVDDNDNNRHILKEMLQMKGISCTEARSGFDALELLSANDGYDIILMDYHMPYMD 680

Query: 61  GLEITKQIKE 70
           GLE  ++++ 
Sbjct: 681 GLETVRKMRH 690


>gi|265764347|ref|ZP_06092915.1| two-component system sensor histidine kinase [Bacteroides sp. 2_1_16]
 gi|263256955|gb|EEZ28301.1| two-component system sensor histidine kinase [Bacteroides sp. 2_1_16]
          Length = 1039

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF  ++    Y  +   +G EA+E  ++  P +I+MDI +  + G E 
Sbjct: 920  ILIAEDNESNYRLFESIL-GHDYHLIHAWDGREAVERFKRENPQIILMDINMPVMDGYEA 978

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 979  TQEIRKYS--AKVPIIAVTAFAYASDEQRVMENGFDGYMPKPIN 1020


>gi|53713997|ref|YP_099989.1| two-component system sensor histidine kinase [Bacteroides fragilis
            YCH46]
 gi|52216862|dbj|BAD49455.1| two-component system sensor histidine kinase [Bacteroides fragilis
            YCH46]
          Length = 1053

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++I EDNE N +LF  ++    Y  +   +G EA+E  ++  P +I+MDI +  + G E 
Sbjct: 934  ILIAEDNESNYRLFESIL-GHDYHLIHAWDGREAVERFKRENPQIILMDINMPVMDGYEA 992

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            T++I++ S   ++P+IAVTAFA   DE+R+ + G + Y+ KPI+
Sbjct: 993  TQEIRKYS--AKVPIIAVTAFAYASDEQRVMENGFDGYMPKPIN 1034


>gi|330890756|gb|EGH23417.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 647

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
           +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 523 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 582

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 583 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 641



 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 257 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 316

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 317 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 357



 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 376 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 435

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 436 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 466


>gi|209526062|ref|ZP_03274594.1| two component transcriptional regulator, LuxR family [Arthrospira
           maxima CS-328]
 gi|209493450|gb|EDZ93773.1| two component transcriptional regulator, LuxR family [Arthrospira
           maxima CS-328]
          Length = 222

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 5/108 (4%)

Query: 5   VMIVEDNELNMKL-FRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++V D++L  +L   D +E SGY+ +   NG EALEL  +H+P +I+ DI + E+ G E
Sbjct: 4   TLLVVDDDLGTRLSISDYLEMSGYMVISATNGQEALELVEKHQPHLIVTDIAMPEMDGFE 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKPISL 109
           + K+++     + +PVI +TA      EERIR  + GC+ Y+ KP  L
Sbjct: 64  LVKRVRSQPGFRLLPVIFLTAHT--STEERIRGYQLGCDNYLPKPFEL 109


>gi|239995050|ref|ZP_04715574.1| GGDEF domain protein [Alteromonas macleodii ATCC 27126]
          Length = 637

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 76/126 (60%), Gaps = 7/126 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHK----PDVIIMDIQLQEI 59
           ++++VEDN +N  +  +++E+ GY+     NG+EALEL +  K       I+MD Q+ E+
Sbjct: 510 RILLVEDNAINQIVATNVLESEGYVVDVANNGVEALELLKSSKLKAHYSAIVMDCQMPEM 569

Query: 60  SGLEITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            G E TK I+  +     + +P+IA+TA AM+GD++   K G + +++KPI  +    T+
Sbjct: 570 DGFEATKLIRYGAAGEVYKRVPIIAMTANAMQGDKDMCMKAGMDDFLTKPIEHNKVTSTL 629

Query: 117 KKYIGE 122
           + ++ +
Sbjct: 630 QHWLNK 635


>gi|158333826|ref|YP_001514998.1| two-component hybrid sensor and regulator histidine kinase
           [Acaryochloris marina MBIC11017]
 gi|158304067|gb|ABW25684.1| two-component hybrid sensor and regulator histidine kinase,
           putative [Acaryochloris marina MBIC11017]
          Length = 653

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 74/118 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED+  N  L   L+ T G++    +NG EALE+ ++  P +I MDI++  + GLE
Sbjct: 446 RILVVEDHADNRCLLVTLLATIGFLVKSAQNGQEALEICQEWHPHLIWMDIKMPLMDGLE 505

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++I+   ++ +  +IA+TA A   D+ER    GC+ ++ KP + +I +E + +++G
Sbjct: 506 ATQRIRAMPQIPQPVIIALTANAFDEDKERALTCGCDDFLHKPCNETIILEKMTQHLG 563


>gi|117925519|ref|YP_866136.1| PAS/PAC sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609275|gb|ABK44730.1| PAS/PAC sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1049

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 72/119 (60%), Gaps = 4/119 (3%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K++I ED++ N+ L +  ++ S +     RNG+EAL+   QH  D+++MD+Q+  + GLE
Sbjct: 924  KILIAEDSDDNILLLQSYLKGSDHQLTIVRNGLEALQQVEQHHFDLVLMDVQMPVMDGLE 983

Query: 64   ITKQIK----EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T++I+    +    Q +P++ +TA AM  D+ R  + GC  +++KPI   + ++ I K
Sbjct: 984  ATRKIRLMEQQQGARQPLPIVTLTAHAMLEDKRRSVEAGCTDHLTKPIKKQVLLKAIAK 1042


>gi|325982034|ref|YP_004294436.1| multi-sensor hybrid histidine kinase [Nitrosomonas sp. AL212]
 gi|325531553|gb|ADZ26274.1| multi-sensor hybrid histidine kinase [Nitrosomonas sp. AL212]
          Length = 1236

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N K+ R  +   GY A    +G EAL+  +    D+++ D+ + E+ G E+
Sbjct: 981  ILVAEDNDINQKVIRQQLNLLGYAADIASDGKEALKRWQTGDYDLLLTDLHMPEMDGFEL 1040

Query: 65   TKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I+  ++  + IP++A+TA A+KG++ER  + G + Y+SKP+ L      ++KY+
Sbjct: 1041 TREIRTIEANQKRIPIVALTANALKGEKERCLQTGMDDYLSKPVQLEDLRAMLEKYL 1097


>gi|150015596|ref|YP_001307850.1| histidine kinase [Clostridium beijerinckii NCIMB 8052]
 gi|149902061|gb|ABR32894.1| histidine kinase [Clostridium beijerinckii NCIMB 8052]
          Length = 781

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 72/118 (61%), Gaps = 2/118 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++ VED+ ++ +    L + +G+      NG+EAL +      D+I+MDIQ+ ++SG+E
Sbjct: 659 RILQVEDDIISQRFMNQLCKIAGWKIKIASNGLEALNILENEDFDIILMDIQMPDMSGIE 718

Query: 64  ITKQIKEDSEL--QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +TK I+E  +L  + I +IA+TA+AM GD +     G + YISKPI +    E I KY
Sbjct: 719 LTKIIREKEKLTGKHITIIAMTAYAMGGDRDICINTGMDDYISKPIEVMKLKEVITKY 776


>gi|332525017|ref|ZP_08401198.1| Signal transduction histidine kinase-like protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332108307|gb|EGJ09531.1| Signal transduction histidine kinase-like protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 331

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 68/118 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN +N +L  +L+  +G       +G+EAL    + + D ++MD+Q+  + GLE
Sbjct: 66  RVLLAEDNPVNQELTLELLRQAGASTALAGDGLEALAWLARERFDAVLMDVQMPVLDGLE 125

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++++    L+ +PVIA+TA AM  D E     G   +++KP    + +E ++ + G
Sbjct: 126 ATRRLRRLPGLEALPVIAMTAHAMASDREACLAAGMNDHLAKPFEPDVLIERLRHWTG 183


>gi|323499989|ref|ZP_08104945.1| hybrid sensory histidine kinase BarA [Vibrio sinaloensis DSM 21326]
 gi|323314955|gb|EGA68010.1| hybrid sensory histidine kinase BarA [Vibrio sinaloensis DSM 21326]
          Length = 929

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   NG++A++ A  HK D+I+MDIQ+ ++ G+  
Sbjct: 668 VMAVDDNPANLKLISALLQERVEQVITCTNGVDAVKQAEMHKFDMILMDIQMPQMDGVTA 727

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++IK+       PVIAVTA AM G+ +R+   G + Y++KPI   +  + +  +
Sbjct: 728 CEKIKQTELNASTPVIAVTAHAMSGERDRLLNAGMDDYLTKPIEEHVLQQVLMHW 782


>gi|217970145|ref|YP_002355379.1| multi-sensor hybrid histidine kinase [Thauera sp. MZ1T]
 gi|217507472|gb|ACK54483.1| multi-sensor hybrid histidine kinase [Thauera sp. MZ1T]
          Length = 833

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN +N  + + ++E  G+      NG EALE       DV++MD+Q+  + G+E
Sbjct: 572 EVLVVEDNPVNQTVAKRMLEHVGHSVTVANNGEEALEAIDNRHFDVVLMDVQMPVMGGIE 631

Query: 64  ITKQIKEDS---------ELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
            T+ I+            + + +P+IA+TA AM+GD ER  + G + Y++KP+       
Sbjct: 632 ATQAIRAREARRSWVLAGDWKPVPIIAMTAHAMEGDRERCLQAGMDDYVAKPVRPEALFA 691

Query: 115 TIKKYIGEA 123
            I++ +G A
Sbjct: 692 AIERVLGPA 700


>gi|78224411|ref|YP_386158.1| response regulator receiver domain-containing protein [Geobacter
           metallireducens GS-15]
 gi|78195666|gb|ABB33433.1| response regulator receiver domain protein (CheY-like) [Geobacter
           metallireducens GS-15]
          Length = 233

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D    + + RD ++ S    L    G EAL +AR+ +PD+I +D ++ E+ G+  
Sbjct: 6   VLLVDDERFFLSVQRDFLKGSPIAVLSASGGEEALRIAREQRPDLIYLDCRMPEMDGVAC 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              +K D EL+ IPV+ +     + D ER    GC+  I+KPI    F+E  ++++ E
Sbjct: 66  CTILKGDRELRTIPVLMMVPEGKEKDRERCLAAGCDGIIAKPIDRREFLEAGRRFVPE 123


>gi|220908073|ref|YP_002483384.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864684|gb|ACL45023.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1305

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++VED  +N K+   L++  GY A    NG+EALE  ++   DVI MD+Q+ E+ GLE
Sbjct: 1024 RILLVEDIAVNQKIALQLLQRLGYRADVANNGLEALEALQRQVYDVIFMDVQMPEMDGLE 1083

Query: 64   ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             T+ I++D +L   P +IA+TA A   D +     G   YISKP+ L    + +++Y
Sbjct: 1084 TTQHIRQDLQLSTQPWIIAMTAHARAEDRQACLHIGMNDYISKPLRLETLRQVLEQY 1140


>gi|116753699|ref|YP_842817.1| multi-sensor hybrid histidine kinase [Methanosaeta thermophila PT]
 gi|116665150|gb|ABK14177.1| multi-sensor hybrid histidine kinase [Methanosaeta thermophila PT]
          Length = 1692

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 70/117 (59%), Gaps = 4/117 (3%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDN +N+K+   ++   GY A   RNG+E L        D++ MD+Q+ ++ GLE
Sbjct: 1461 RILVAEDNPVNLKVVLMMLSHLGYRADSARNGLEVLSALEHRDYDLVFMDVQMPDMDGLE 1520

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              ++I++    +   ++A+TA+A++GD +R    G + YISKP++    ME +K  I
Sbjct: 1521 AARRIRDMKGYEGPRIVAITAYALEGDRDRCIAAGMDDYISKPVT----MEKLKAAI 1573


>gi|28869899|ref|NP_792518.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato str. DC3000]
 gi|28853144|gb|AAO56213.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato str. DC3000]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED++L       LI              +AL+L R H  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDDLQRDSIARLIGDDDIEITAVGFAQQALDLLRDHIYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|37676244|ref|NP_936640.1| hypothetical protein VVA0584 [Vibrio vulnificus YJ016]
 gi|37200785|dbj|BAC96610.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 1072

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE----LAR-QHKPDVIIMDIQLQE 58
           KV++ EDNE+N ++  +L+E +G +     NG EAL+    +A+ +   D+I MD+Q+  
Sbjct: 696 KVLLTEDNEINQQIAVELMEGNGLLVTVANNGQEALDHLEAMAKGESHFDIIFMDLQMPV 755

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G E + +I+ +S    IP+IA+TA AM  + ER    G   +ISKPI   I   TI+K
Sbjct: 756 MDGYEASHRIRANSSYDTIPLIAMTAHAMVEERERCLNLGMNDHISKPIDPEILFNTIRK 815

Query: 119 Y 119
           +
Sbjct: 816 W 816



 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 67/125 (53%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIET-SGYIALQTRNGMEALELAR-----QHKPDVIIMDIQLQ 57
           ++++V+DNE  +++ ++++ T  G +AL   +G +A++  R     + K D+I MD  + 
Sbjct: 546 RILVVDDNEHALEIMQEMLSTLPGKVAL-ANSGQQAVDCIRKASEQREKFDLIFMDWNMP 604

Query: 58  EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E+ G+E ++ I+E    +  P ++ VTA+  +   +         ++SKP+  S   + +
Sbjct: 605 EMDGIETSRLIRESFASEYQPQIVIVTAYDKEDVLDATNDLDIAGFLSKPVGQSYLFDLL 664

Query: 117 KKYIG 121
            +  G
Sbjct: 665 VELFG 669


>gi|283852351|ref|ZP_06369622.1| signal transduction histidine kinase with CheB and CheR activity
            [Desulfovibrio sp. FW1012B]
 gi|283572308|gb|EFC20297.1| signal transduction histidine kinase with CheB and CheR activity
            [Desulfovibrio sp. FW1012B]
          Length = 1919

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 72/118 (61%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED+ ++M  F  ++E +G+      +G +A  +  + + D ++MD+Q+  + G+ 
Sbjct: 1781 RLLLAEDDAVSMLSFARMLEKAGHRVDTADDGAKATAMVARGEYDCVLMDVQMPVMDGVA 1840

Query: 64   ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T+ I+ D+ L +   +P+IA+TA+AM GD E+    G + Y+SKP+ L   ME +K+
Sbjct: 1841 ATRAIRADASLGQKARVPIIAMTAYAMAGDREKFLAAGMDDYVSKPVDLDALMEALKR 1898


>gi|256830078|ref|YP_003158806.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
 gi|256579254|gb|ACU90390.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
            DSM 4028]
          Length = 1055

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 72/120 (60%), Gaps = 3/120 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VED+  N    + L+E +G+  L   NG +A EL      D I+MDIQ+  + G+E 
Sbjct: 932  VLLVEDDPSNRLPIQKLLEKAGHEVLLAENGRQAFELLAASDIDCILMDIQMPVMDGIEA 991

Query: 65   TKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+ I+E + L   +++P+IA+TA+AM GD+E+    G   Y +KP+++   ++ + + + 
Sbjct: 992  TRIIRESAALGPKKDVPIIALTAYAMDGDKEKFLAAGMNGYAAKPVTIENLLQKMDEVLA 1051


>gi|189424609|ref|YP_001951786.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
 gi|189420868|gb|ACD95266.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
          Length = 995

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 70/118 (59%), Gaps = 2/118 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ EDN +N +    L++  G     T NG EALE  +Q   D+I+MDIQ+  + G   
Sbjct: 870 VLVAEDNVMNQQFISGLLKKLGLGCQLTSNGQEALERWQQGDIDLILMDIQMPVMGGEAA 929

Query: 65  TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             Q++  E    + +PV+A+TA A++GD+ER+   G + Y+SKP++L   M  +K+ I
Sbjct: 930 LHQLRQMESESGRHVPVVALTAHALRGDQERLLAAGFDGYLSKPLNLKELMVELKRAI 987


>gi|83646963|ref|YP_435398.1| CheY-like receiver protein [Hahella chejuensis KCTC 2396]
 gi|83635006|gb|ABC30973.1| FOG: CheY-like receiver [Hahella chejuensis KCTC 2396]
          Length = 121

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 73/118 (61%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGY-IALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++IVEDN++N  +    +   GY IAL   +G EA+ +A++ +P +I+MD+ L  + G E
Sbjct: 4   LLIVEDNDMNADMLTRRLRRKGYEIALAC-DGGEAVTMAQECRPALILMDLSLPVMDGYE 62

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++IKE     + P+IA+TA A+  D ++    GC+ Y +KP++    +E I++++ 
Sbjct: 63  ATRRIKESGRC-DAPIIALTAHALSEDRDKALAAGCDDYETKPVNFPRLLEKIERFLA 119


>gi|320324583|gb|EFW80660.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            glycinea str. B076]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|213967062|ref|ZP_03395212.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato T1]
 gi|301385247|ref|ZP_07233665.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato Max13]
 gi|302063302|ref|ZP_07254843.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato K40]
 gi|302130188|ref|ZP_07256178.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato NCPPB 1108]
 gi|213928384|gb|EEB61929.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato T1]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEMRFAQILFDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED++L       LI              +AL+L R H  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDDLQRDSIARLIGDDDIEITAVGFAQQALDLLRDHIYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|71735952|ref|YP_274795.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            phaseolicola 1448A]
 gi|71556505|gb|AAZ35716.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            phaseolicola 1448A]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYECLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|325273064|ref|ZP_08139372.1| response regulator receiver protein [Pseudomonas sp. TJI-51]
 gi|324101798|gb|EGB99336.1| response regulator receiver protein [Pseudomonas sp. TJI-51]
          Length = 121

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 67/120 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M      +E +G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMTSLTQFLEKNGHEVLKANNGADGVALARQEKPDAVLMDIVMPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D E   IPVI VT    + D     + G   +++KP+     +  +K+ +G
Sbjct: 61  FQATRQLSKDPETSAIPVIVVTTKDQETDRIWATRQGARDFLTKPVGEEALIAKLKEVLG 120


>gi|320328955|gb|EFW84954.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            glycinea str. race 4]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|213961802|ref|ZP_03390068.1| putative DNA-binding response regulator/sensor histidine kinase
           [Capnocytophaga sputigena Capno]
 gi|213955591|gb|EEB66907.1| putative DNA-binding response regulator/sensor histidine kinase
           [Capnocytophaga sputigena Capno]
          Length = 903

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVEDNE +M+ F   I +  Y  ++  NG E  E+A++H PDV+I D+ + +  G ++
Sbjct: 656 VLIVEDNE-DMRQFIRYILSDSYNLIEAENGEEGFEVAKKHLPDVVISDVMMPKTDGFDL 714

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + +K +     IPVI +TA+A+   ++   + G +AYISKP ++ +    ++K I
Sbjct: 715 CQLLKTNVATNHIPVILLTAYALDEQKQVGFESGADAYISKPFNVKLLKTRVRKLI 770


>gi|37521841|ref|NP_925218.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
 gi|35212840|dbj|BAC90213.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
          Length = 138

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV+++ED  ++  L R ++  +G+  L+  +G   L  A   +PD+I+MD+ L  + G
Sbjct: 16  MAKVLVIEDVPISRNLLRRVLHLAGHQVLEAEDGPGGLIAALAGEPDLILMDLSLPLLDG 75

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             +  +++E      +PV+A+TA A+ GD ER+   G + Y+SKPI +  F   ++ Y+
Sbjct: 76  WSVLPRLREQG--VGVPVVALTAHALVGDRERVLAAGFDGYMSKPIDVRTFHRDLESYL 132


>gi|330985282|gb|EGH83385.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            lachrymans str. M301315]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|66045681|ref|YP_235522.1| response regulator receiver [Pseudomonas syringae pv. syringae B728a]
 gi|63256388|gb|AAY37484.1| Response regulator receiver:GAF:ATP-binding region,
            ATPase-like:Histidine kinase A, N-terminal:CHASE3
            [Pseudomonas syringae pv. syringae B728a]
          Length = 1172

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 991


>gi|260778745|ref|ZP_05887637.1| signal transduction histidine kinase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604909|gb|EEX31204.1| signal transduction histidine kinase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 749

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 70/122 (57%), Gaps = 2/122 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN+ N  + R++ +  G       NG  A+E+  Q+  D+I MDI + E+ G+E
Sbjct: 474 SILVAEDNKANQLVIREMFKRMGLSMDIAENGRRAIEMVEQYHYDLIFMDISMPEMDGME 533

Query: 64  ITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + I+   D +  +IP+IA+TA ++ GD+E+    G   Y+SKPI LS  +E I  ++ 
Sbjct: 534 TCRAIRSMTDEKTCQIPIIALTAHSLSGDKEQFLDAGMNDYLSKPIRLSQLIEKINLFLS 593

Query: 122 EA 123
           + 
Sbjct: 594 DG 595


>gi|331008579|gb|EGH88635.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tabaci ATCC 11528]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|255528095|ref|ZP_05394926.1| histidine kinase [Clostridium carboxidivorans P7]
 gi|296186822|ref|ZP_06855223.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
 gi|255508217|gb|EET84626.1| histidine kinase [Clostridium carboxidivorans P7]
 gi|296048536|gb|EFG87969.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
          Length = 393

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 75/118 (63%), Gaps = 2/118 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED++ +  +  +L +  G+I     NG EAL + +  + D+I+MDIQ+  + G++ 
Sbjct: 250 ILIVEDDKASQIVMYNLFKKYGHICDIANNGQEALNVLKTKQYDLILMDIQMPIMDGVQA 309

Query: 65  TKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           TK I+  E+   + IP+IA+TA+A+KGD+E     G + YISKP ++   ++T+ K +
Sbjct: 310 TKFIRKSEEGNDKHIPIIALTAYALKGDKEHFLGLGMDEYISKPFNVEELLQTVYKIV 367


>gi|170719659|ref|YP_001747347.1| response regulator receiver protein [Pseudomonas putida W619]
 gi|169757662|gb|ACA70978.1| response regulator receiver protein [Pseudomonas putida W619]
          Length = 121

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 68/120 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M    + +E  G+  L+  NG +A+ LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMYRLTEWLEKHGHQVLKANNGADAVALARQEKPDAVLMDIVMPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D E   IPV+ VT    + D    ++ G   +++KP+     +  + + +G
Sbjct: 61  FQATRQLSKDPETSAIPVLIVTTKDQETDRIWAQRQGARGFVTKPVEEHALIAKLNEVLG 120


>gi|298487166|ref|ZP_07005215.1| Signal transduction histidine kinase [Pseudomonas savastanoi pv.
            savastanoi NCPPB 3335]
 gi|298158190|gb|EFH99261.1| Signal transduction histidine kinase [Pseudomonas savastanoi pv.
            savastanoi NCPPB 3335]
          Length = 1172

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 991


>gi|289646781|ref|ZP_06478124.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            aesculi str. 2250]
          Length = 1172

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 991


>gi|257487872|ref|ZP_05641913.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tabaci ATCC 11528]
          Length = 1170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+ +L      D+++MD+ + E+ G
Sbjct: 1046 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIAKLNEVEDIDLVLMDVMMPEMDG 1105

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1106 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1164



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 780 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADEGFNLASRYTPDAILLDMRLPDHSGLTV 839

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 840 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 880



 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R++  D +I+D++L ++ G
Sbjct: 899 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRENVYDCMIIDLKLPDMLG 958

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 959 NELLKRMSTEDICAFPPVIVYTGRNMTRDEE 989


>gi|238786285|ref|ZP_04630227.1| Signal transduction histidine-protein kinase barA [Yersinia
           bercovieri ATCC 43970]
 gi|238712808|gb|EEQ04878.1| Signal transduction histidine-protein kinase barA [Yersinia
           bercovieri ATCC 43970]
          Length = 911

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 72/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 660 KVMAVDDNPANLKLIGTLLEEQVAETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 719

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S   + P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + +Y
Sbjct: 720 ASEIIHQMSHHLDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQALSRY 775


>gi|254409559|ref|ZP_05023340.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183556|gb|EDX78539.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 287

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 68/116 (58%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N K    L++  GY      NG EAL+  +    DV+ MD+++ E+ GL 
Sbjct: 13  RILLAEDNRVNQKFALLLLKKLGYQTDVVSNGAEALQALQSQSYDVVFMDVEMPEMDGLT 72

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T+QI E     E P +IA+TA+A +GD E+    G + YI+KPI L   ++ ++K
Sbjct: 73  ATRQICEQWAAGERPRIIALTAYARRGDREQCLAAGMDDYITKPIELPKLVQALQK 128


>gi|262195772|ref|YP_003266981.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
 gi|262079119|gb|ACY15088.1| multi-sensor hybrid histidine kinase [Haliangium ochraceum DSM
           14365]
          Length = 876

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 69/120 (57%), Gaps = 2/120 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN +N K+ R ++   G       NG EAL+L  Q   D++ MD+Q+ E+ G  
Sbjct: 626 RVLVVEDNVVNQKVARRMLSHLGCRVDVAGNGREALQLIDQVPYDLVFMDVQMPEMDGFA 685

Query: 64  ITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T  ++    ++ + +P+IA+TA AM GD ER    G + Y+SKPI      E + +Y+G
Sbjct: 686 ATAAVRARPPTDGKRLPIIAMTARAMSGDRERCLAAGMDGYVSKPIVQEHLGEILLQYLG 745


>gi|238755038|ref|ZP_04616386.1| PAS/PAC domain [Yersinia ruckeri ATCC 29473]
 gi|238706742|gb|EEP99111.1| PAS/PAC domain [Yersinia ruckeri ATCC 29473]
          Length = 1522

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 72/122 (59%), Gaps = 4/122 (3%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEIS 60
            +++IVEDN  N ++ R+L+E  G +     +G EA+E+  +H P   D+++MD+Q+  + 
Sbjct: 1173 RLLIVEDNLNNQQIARELLEDEGAVVSMANHGKEAIEIL-EHNPSLFDLVLMDLQMPVMD 1231

Query: 61   GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            G   T+ I++   L+ +P+IA+TA AM  D +     G   +I KP  L+  +  I+KY 
Sbjct: 1232 GFNATQYIRKSIGLKNLPIIAMTANAMVSDRDACLAAGMNDHIGKPFDLNNLIHIIRKYT 1291

Query: 121  GE 122
            G+
Sbjct: 1292 GQ 1293



 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 66/130 (50%), Gaps = 14/130 (10%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD-----VIIMDIQLQE 58
            +V++V+DN    +L + + E+  +I     NG +AL+  +Q   +      + +D ++  
Sbjct: 1025 RVLVVDDNPTACELIKQMGESLKWIVDVATNGSDALQRIKQQYDNGVAYGALFIDWKMPG 1084

Query: 59   ISGLEITKQIKEDSELQEIPVIA-VTA-----FAMKGDEERIRKGGCEAYISKPISLSIF 112
            + G + +K ++E   +  +P+I  VTA        + +EE   +   + Y+ KPI+ S+ 
Sbjct: 1085 LDGWQTSKYVREMMPVGNLPMIVMVTAHDREMLLQRSEEE---QALLDGYLVKPITASML 1141

Query: 113  METIKKYIGE 122
            ++++   + E
Sbjct: 1142 LDSVIDALSE 1151


>gi|27366536|ref|NP_762063.1| Two-component system sensor protein [Vibrio vulnificus CMCP6]
 gi|27358102|gb|AAO07053.1| Two-component system sensor protein [Vibrio vulnificus CMCP6]
          Length = 1072

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 5/121 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR-----QHKPDVIIMDIQLQE 58
           KV++ EDNE+N ++  +L+E +G +     NG EALE        +   D++ MD+Q+  
Sbjct: 696 KVLLTEDNEINQQIAVELMEGNGLLVTVANNGQEALEHLEAMEKGESHFDIVFMDLQMPV 755

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G E + +I+ +S    IP+IA+TA AM  + ER    G   +ISKPI   I   TI+K
Sbjct: 756 MDGYEASHRIRANSSYDTIPLIAMTAHAMVEERERCLNLGMNDHISKPIDPEILFNTIRK 815

Query: 119 Y 119
           +
Sbjct: 816 W 816



 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 67/125 (53%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIET-SGYIALQTRNGMEALELAR-----QHKPDVIIMDIQLQ 57
           ++++V+DNE  +++ ++++ T  G +AL   +G +A++  R     + K D+I MD  + 
Sbjct: 546 RILVVDDNEHALEIMQEMLSTLPGKVAL-ANSGQQAVDCIRKASEQREKFDLIFMDWNMP 604

Query: 58  EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E+ G+E ++ I+E    +  P ++ VTA+  +   +         ++SKP+  S   + +
Sbjct: 605 EMDGIETSRLIRESFASEYQPQIVIVTAYDKEDVLDATNDLDIAGFLSKPVGQSYLFDLL 664

Query: 117 KKYIG 121
            +  G
Sbjct: 665 VELFG 669


>gi|309790317|ref|ZP_07684884.1| response regulator receiver protein [Oscillochloris trichoides DG6]
 gi|308227651|gb|EFO81312.1| response regulator receiver protein [Oscillochloris trichoides DG6]
          Length = 126

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 75/122 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VED+E   ++    +  SG+      +G++AL   R  +P++IIMD+ + +++G
Sbjct: 1   MPRILVVEDDETIREMVATYLRLSGFTVELAVDGIDALTKVRSVQPELIIMDMGIPKLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T++++   E  + P+IA+TA+A++ D ER    GC+A+ SKPI  +  +E I+  + 
Sbjct: 61  WQTTQRLRARKETAQTPIIALTAYALEEDRERAFNVGCDAFESKPIDFTSLIEKIQTLLA 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|238750558|ref|ZP_04612058.1| Signal transduction histidine-protein kinase barA [Yersinia rohdei
           ATCC 43380]
 gi|238711206|gb|EEQ03424.1| Signal transduction histidine-protein kinase barA [Yersinia rohdei
           ATCC 43380]
          Length = 891

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 73/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  ++I+MDIQ+ EI G+ 
Sbjct: 640 KVMAVDDNPANLKLIGTLLEELVEETVLCDSGAKAIAYARENTLEIILMDIQMPEIDGIR 699

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S  Q+ P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + +Y
Sbjct: 700 ASEVIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQALSRY 755


>gi|330971298|gb|EGH71364.1| response regulator receiver [Pseudomonas syringae pv. aceris str.
            M302273PT]
          Length = 1172

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG+EA+  L      D+++MD+ + E+ G
Sbjct: 1048 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGLEAIARLNEVEDIDLVLMDVMMPEMDG 1107

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1108 YEATIEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1166



 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 782 ILVIEDEVRFAQILYDLAHELGYDCLVAHAADDGFNLASRYTPDAILLDMRLPDHSGLTV 841

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 842 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 882



 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 901 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 960

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 961 NELLKRMSMEDICAFPPVIVYTGRNMTRDEE 991


>gi|254410456|ref|ZP_05024235.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196182662|gb|EDX77647.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 2020

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++VED  +N K+ R +++  GY A    NG EALE  R+    V+ MD+Q+ E+ GLE 
Sbjct: 1756 ILLVEDVAVNQKVARQMLQRLGYRADVANNGQEALESLRRKSYQVVFMDVQMPEMDGLEA 1815

Query: 65   TKQIK-EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T++I+ E S   +  +IA+TA AM+GD E+  + G   YISKPI     ++ +  Y
Sbjct: 1816 TRRIRAEWSSACQPWIIAMTAHAMQGDREQCLQVGMNDYISKPIRPEALVQALTTY 1871



 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            K++++V+DN  N ++     ++ G       +G +AL      +P D+ ++D Q+ E+ G
Sbjct: 1609 KRLLVVDDNATNRQIITLQAQSWGMEVTTAASGEQALNWLADSEPFDLAVLDWQMPEMDG 1668

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
            L +  QI+     +++P++ +++   +   +        A+++KPI  S
Sbjct: 1669 LTLALQIQALPNNEQLPLVMLSSVGRQTPYQPDDMPNFAAFLTKPIKQS 1717


>gi|283850337|ref|ZP_06367626.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
 gi|283574363|gb|EFC22334.1| multi-sensor hybrid histidine kinase [Desulfovibrio sp. FW1012B]
          Length = 943

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 71/115 (61%), Gaps = 6/115 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN++N    +  +  +G       +G EAL L  Q   D+++MDIQ+ E+ G E
Sbjct: 695 RVLLAEDNQVNRLFLKHFLVEAGCEVRLAGSGGEALALLAQGPADLVLMDIQMPEMDGTE 754

Query: 64  ITKQIKEDSELQE----IPVIAVTAFAMKGDEERIRKGGCEAYISKPISL-SIFM 113
            T++I+ D E+ E    +PV+A+TA++MKGD ER    G + Y+SKP+ +  +FM
Sbjct: 755 ATRRIR-DGEVGEAARRLPVVALTAYSMKGDRERFLSAGLDDYVSKPVDVDELFM 808


>gi|193214323|ref|YP_001995522.1| multi-sensor hybrid histidine kinase [Chloroherpeton thalassium ATCC
            35110]
 gi|193087800|gb|ACF13075.1| multi-sensor hybrid histidine kinase [Chloroherpeton thalassium ATCC
            35110]
          Length = 1629

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 68/117 (58%), Gaps = 1/117 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++I EDN +N KL   ++E  GY A    NG E +E  +    D+I+MD+Q+ E+ GL 
Sbjct: 1346 RILIAEDNVVNQKLVLRILEKVGYRADVAANGAEVIEALKSKTYDLILMDVQMPEMDGLT 1405

Query: 64   ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             T+ I ++    E P +IA+TA AMKGD E   + G + Y+SKP+      + + K+
Sbjct: 1406 ATRYICQNWPRLERPFIIAMTANAMKGDREACLEAGMDDYLSKPVRFDDLQKALDKW 1462



 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 7/112 (6%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            K  +IV+DN  N ++      T G  +    +G  ALEL       DV I+D  + E+ G
Sbjct: 1200 KHALIVDDNATNRRILSLQSATWGMSSHTVGSGKNALELIHSGMHFDVGILDFHMPEMDG 1259

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLS 110
            L +  ++++  + Q++P++ +T+    G+ E + +    G  A+++KPI  S
Sbjct: 1260 LMLAMELRKLPQTQDLPLVMLTS---AGNRETVSETVGVGFSAFLNKPIKQS 1308


>gi|260892897|ref|YP_003238994.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260865038|gb|ACX52144.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 231

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 63/104 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D E   KL    +   G+  L   +G +ALE+ARQH+PDVII+D+ L  + G  +
Sbjct: 4   VLVVDDEEHIQKLLHFTLSKEGFQVLVAADGPQALEMARQHRPDVIILDLMLPALDGFTV 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            + ++ D  L+EIPVI ++A   + D+ R    G + Y++KP S
Sbjct: 64  CELLRRDPSLKEIPVIVLSARGTEEDKVRGLDIGADDYVTKPFS 107


>gi|167630091|ref|YP_001680590.1| signal transduction histidine kinase [Heliobacterium modesticaldum
           Ice1]
 gi|167592831|gb|ABZ84579.1| signal transduction histidine kinase [Heliobacterium modesticaldum
           Ice1]
          Length = 567

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 66/113 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D+  N  +    +   GY   +  NG EAL +  + + D+I+MD Q+  +SG+E 
Sbjct: 445 ILLVDDDVFNRTIIGAWLRRWGYRLREATNGKEALAVLEEERFDLILMDEQMPGMSGIET 504

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
             +I+ D+  + IPVIAVTA AMKGD ER    G   Y+SKP S +  +  ++
Sbjct: 505 VDRIRADARWKNIPVIAVTANAMKGDRERFLAAGMNDYLSKPFSPADLLHVVR 557


>gi|261416190|ref|YP_003249873.1| histidine kinase [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261372646|gb|ACX75391.1| histidine kinase [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302327682|gb|ADL26883.1| sensor histidine kinase/response regulator [Fibrobacter
           succinogenes subsp. succinogenes S85]
          Length = 794

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPD---VIIMDIQLQEIS 60
           KV++VEDNELN+++ +D++E++G +     +G  A+E  ++  PD    I+MDIQ+  + 
Sbjct: 673 KVLVVEDNELNLEISKDILESAGVVVESAEDGSIAVERLKEKGPDYYDCILMDIQMPVMD 732

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E T++I++    + IP+IA++A A   D  +  + G + +++KPI ++   +++KK++
Sbjct: 733 GFEATREIRKMFPDKRIPIIALSANAFDEDRRKSFEAGMDGHLAKPIVIAQLEDSLKKFL 792


>gi|256829214|ref|YP_003157942.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578390|gb|ACU89526.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 676

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+  N      L+E +G   +   NG +A++L + H  D I+MD+Q+  + GLE
Sbjct: 551 RILLAEDDPSNQFAMIKLLEKAGNEVMLAENGKQAIDLLKIHDFDCILMDVQMPLMDGLE 610

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
            TK I+  ++L   ++IP+IA+TA+AM+GD E   K G   Y+ KP+ +
Sbjct: 611 ATKTIRSSADLGPKKDIPIIAMTAYAMRGDRETFLKWGMSDYVGKPVRM 659


>gi|11499995|ref|NP_071241.1| response regulator [Archaeoglobus fulgidus DSM 4304]
 gi|2650670|gb|AAB91243.1| response regulator [Archaeoglobus fulgidus DSM 4304]
          Length = 114

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 77/119 (64%), Gaps = 5/119 (4%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VED    +++F  ++  S Y  ++  +G EA+EL ++HKPD+++MD++L  I G
Sbjct: 1   MKKILLVEDEPDLLEIFGHML--SDYEVIKASDGNEAIELFKEHKPDIVLMDVELPGIDG 58

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +E T++I E +   +  VIA+TAFA +  +E +  G  E  + KP  +   +ETIKKY+
Sbjct: 59  VEATRRILEYNPAAK--VIAITAFASRRGKEMLEAGAVEV-LKKPFRMHELLETIKKYL 114


>gi|320330927|gb|EFW86901.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            glycinea str. race 4]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|149235444|ref|XP_001523600.1| hypothetical protein LELG_05016 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452579|gb|EDK46835.1| hypothetical protein LELG_05016 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 1142

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 72/125 (57%), Gaps = 8/125 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ EDN +N KL   ++E  G+      NG+EA E  ++++ DV++MD+Q+  + G E
Sbjct: 871 KILLAEDNLVNQKLAVRILEKQGHQVEVVENGLEAFEAVQKNRYDVVLMDVQMPVMGGFE 930

Query: 64  ITKQIKE--------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
             ++I++        D      P+IA+TA AM GD E+    G + Y+SKP+   + M+T
Sbjct: 931 SVEKIRQWEKKSNPIDYLTFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQT 990

Query: 116 IKKYI 120
           I K I
Sbjct: 991 INKCI 995


>gi|331009681|gb|EGH89737.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tabaci ATCC 11528]
          Length = 1735

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1616 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1675

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1676 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1727


>gi|303248282|ref|ZP_07334544.1| Hpt sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
 gi|302490307|gb|EFL50219.1| Hpt sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
          Length = 825

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 71/119 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDN +N ++ R+++E  G +      G EA+E+AR    D ++MD+Q+  + GL  
Sbjct: 320 ILLVEDNSINQQVAREMLERFGAVVDVAGGGREAVEMARLAFYDAVLMDVQMPVMDGLAA 379

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           T+ I+      ++P++A+TA A+ GD +R  + G   Y++KPI  +  +  + ++I  A
Sbjct: 380 TRAIRRLPGCGDLPIVALTAHALSGDRQRCLEAGMNDYLTKPIDPARLLAALGQWIAPA 438



 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           KV++V+D +LN  +F  ++ ++G+  +   NG +A       K      D I+MDI++ E
Sbjct: 588 KVLLVDDAKLNRAIFSQILRSAGHEVVTAVNGKDACRALFGQKASGRPFDCILMDIEMPE 647

Query: 59  ISGLEITKQIKE-------DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISK 105
           + G   T+ I++            +IP++A+T+     +  R  + G +  + K
Sbjct: 648 LDGPAATRIIRKLLADGVSPPCPPDIPIMALTSHDAAPELARGLEAGMDGCLRK 701


>gi|289647582|ref|ZP_06478925.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            aesculi str. 2250]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|114766988|ref|ZP_01445907.1| cytoplasmic sensor hybrid histidine kinase [Pelagibaca bermudensis
           HTCC2601]
 gi|114540834|gb|EAU43897.1| cytoplasmic sensor hybrid histidine kinase [Roseovarius sp.
           HTCC2601]
          Length = 855

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 72/123 (58%), Gaps = 5/123 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTR---NGMEALELARQHKPDVIIMDIQLQEISG 61
           V++ EDN  N  +FR + E  G + L+ R   NG+EA+E  R+ +PD+I MDI +  + G
Sbjct: 730 VILAEDNRTNQMVFRKMAEGLG-LPLELRLAGNGIEAVEAYRKRRPDLIFMDISMPRMDG 788

Query: 62  LEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + T++I+  +     +P+IAVTA AM GD + I + G + Y++KP+        I+ + 
Sbjct: 789 KQATQEIRALEPPGAHLPIIAVTAHAMTGDRDGILEAGLDDYLTKPLRKQELARLIETWA 848

Query: 121 GEA 123
           G A
Sbjct: 849 GRA 851



 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L++V++V+D+ LN  +    +ET G      +   +AL+      PD+II +  L ++SG
Sbjct: 575 LREVLVVDDHVLNRAILTQQMETVGLSVAFCKTAEDALDRM-DEPPDLIIAEQDLPDMSG 633

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           LE+ +Q+   + +Q    + + +   +   E+ ++ G  A + KP
Sbjct: 634 LELAQQL---ARVQPGLPVMLLSREPQALTEQAQRCGVRAVLPKP 675


>gi|71735650|ref|YP_272786.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            phaseolicola 1448A]
 gi|71556203|gb|AAZ35414.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            phaseolicola 1448A]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|87118375|ref|ZP_01074274.1| serine/threonine kinase with two-component sensor domain [Marinomonas
            sp. MED121]
 gi|86166009|gb|EAQ67275.1| serine/threonine kinase with two-component sensor domain [Marinomonas
            sp. MED121]
          Length = 2128

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 71/120 (59%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
             K+++VEDN LN ++ + L++ S        NG+EA+E    ++ D++ MDIQ+  + G 
Sbjct: 1771 NKILLVEDNPLNRQVAQGLLKESLLDIDLATNGLEAIEKLSNNEYDLVFMDIQMPILDGF 1830

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              TK+I+E  E + +P+IA+TA A   D ++  + G   YISKPI  +   + + K+I E
Sbjct: 1831 SATKRIREKPEWKSLPIIAMTAHATDSDRDKCLQVGMNDYISKPIDPNKLTKMLAKWIKE 1890


>gi|114566147|ref|YP_753301.1| signal transduction histidine kinase-like protein [Syntrophomonas
            wolfei subsp. wolfei str. Goettingen]
 gi|114337082|gb|ABI67930.1| multi-sensor hybrid histidine kinase [Syntrophomonas wolfei subsp.
            wolfei str. Goettingen]
          Length = 1442

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + ++VEDNE+N K+   ++E  G       +G EAL+  +Q   D++ MD Q+ E+ G E
Sbjct: 1212 RFLLVEDNEMNQKIIVKMLEKRGMYCDLACSGAEALKALQQKDYDIVFMDCQMPEMDGYE 1271

Query: 64   ITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             T +I++ + E +   ++A+TA AM+GD E+  + G + YISKP+   +    I++Y
Sbjct: 1272 TTARIRQMEGEERHTIIVAMTANAMEGDREKCLQAGMDDYISKPVDFQLLFNIIEQY 1328



 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 64/122 (52%), Gaps = 4/122 (3%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEA----LELARQHKPDVIIMDIQLQEI 59
            +V+IV+DN  N K+ R  +E +  +  ++ +  +A    L  +     DV+I+D Q+  +
Sbjct: 1064 RVLIVDDNSSNRKIIRTYLEDAQCLVEESDSAEKAITILLSASAVKSFDVVIVDFQMPAM 1123

Query: 60   SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            +G E+   +K     + I +I +T+ A KGD  R ++ G   Y++KP+     ++ I   
Sbjct: 1124 NGHELAAALKAIPSTRAIHLIMLTSAAQKGDARRAKEHGFSGYLTKPVKRDELLQCISIV 1183

Query: 120  IG 121
            +G
Sbjct: 1184 LG 1185


>gi|34557363|ref|NP_907178.1| hybrid histidine kinase [Wolinella succinogenes DSM 1740]
 gi|34483079|emb|CAE10078.1| HYBRID HISTIDINE KINASE [Wolinella succinogenes]
          Length = 1019

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D   N ++ R  +E      ++ ++G+EA+ +A++  PD+I+MDIQ+    GLE
Sbjct: 809 KILLVDDVSDNREIVRAFLEGQPLHIIEAKDGLEAIAIAQKELPDLILMDIQMPFKDGLE 868

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             K +KE  + +   +IA+TA AMK +EER+ +  CE YI KP + +  +E +  ++ 
Sbjct: 869 AAKLLKESPKTRPTKIIALTALAMK-EEERVIRSFCEGYIKKPFTKATLLEELSAHLA 925


>gi|320321968|gb|EFW78064.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            glycinea str. B076]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|298484994|ref|ZP_07003091.1| Chemotaxis protein CheA [Pseudomonas savastanoi pv. savastanoi NCPPB
            3335]
 gi|298160404|gb|EFI01428.1| Chemotaxis protein CheA [Pseudomonas savastanoi pv. savastanoi NCPPB
            3335]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|254283466|ref|ZP_04958434.1| two-component response regulator [gamma proteobacterium NOR51-B]
 gi|219679669|gb|EED36018.1| two-component response regulator [gamma proteobacterium NOR51-B]
          Length = 125

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
             +++VEDNE+N  +    +  +G+  +   +G +AL+  R  +P +++MDI L  + G 
Sbjct: 7   NSILLVEDNEVNRDMLVRRLTRAGHTVICAGDGAQALDRMRDEQPALVLMDINLPVMDGC 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             +++ + D  +  IP+IA+TA AM  D E+    GC  Y +KPI     +  I + +
Sbjct: 67  TASREARADDAIAHIPIIALTAHAMASDREQALAAGCNDYATKPIDFPQLLAKIAELM 124


>gi|289647579|ref|ZP_06478922.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 69/120 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D++   IPVI +T    + D+   ++ G   Y++KP+     M+T+   + 
Sbjct: 61  FQATRQLTKDADTNMIPVIMITTKDQETDKVWCKRQGARDYLTKPVDEETLMKTLNAVLA 120


>gi|26991668|ref|NP_747093.1| response regulator receiver protein [Pseudomonas putida KT2440]
 gi|148550067|ref|YP_001270169.1| response regulator receiver protein [Pseudomonas putida F1]
 gi|24986766|gb|AAN70557.1|AE016698_5 type IV pili response regulator PilH [Pseudomonas putida KT2440]
 gi|148514125|gb|ABQ80985.1| response regulator receiver protein [Pseudomonas putida F1]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 67/120 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V+IV+D+   M    + +E  GY  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARVLIVDDSPTEMYRLTEWLEKHGYQVLKASNGADGVALARQDKPDAVLMDIVMPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + T+Q+ +D +   IPVI VT    + D     + G   +++KP+     +  +K+ +G
Sbjct: 61  FQATRQLSKDPDTSAIPVIVVTTKDQETDRIWATRQGARDFLTKPVEEEALIAKLKEVLG 120


>gi|251797083|ref|YP_003011814.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus sp. JDR-2]
 gi|247544709|gb|ACT01728.1| PAS/PAC sensor hybrid histidine kinase [Paenibacillus sp. JDR-2]
          Length = 642

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 1/115 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I EDNE+N  +   ++E  GY      NG E +E  R+ K D++ MDIQ+  ++G+E 
Sbjct: 517 ILIAEDNEVNRLVLIRMLEKLGYRPKAVSNGAEVVEEVRRKKYDIVFMDIQMPVMNGMEA 576

Query: 65  TKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +K +++  E   +P ++AVTA A+ GD ER    G   YISKP+  S  +  I+K
Sbjct: 577 SKILRKTIEPGNLPYIVAVTANALVGDRERYMSAGMNEYISKPLHSSAVLTVIQK 631


>gi|257483605|ref|ZP_05637646.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tabaci ATCC 11528]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|28872147|ref|NP_794766.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213971486|ref|ZP_03399598.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato T1]
 gi|301385806|ref|ZP_07234224.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato Max13]
 gi|302062233|ref|ZP_07253774.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato K40]
 gi|302133696|ref|ZP_07259686.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28855401|gb|AAO58461.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213923768|gb|EEB57351.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tomato T1]
 gi|330873921|gb|EGH08070.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963796|gb|EGH64056.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331018473|gb|EGH98529.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D++   IPVI +T    + D+   ++ G   Y++KP+     M+T+
Sbjct: 61  FQATRQLTKDADTSNIPVIMITTKDQETDKVWGKRQGARDYLTKPVDEETLMKTL 115


>gi|332701531|ref|ZP_08421619.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551680|gb|EGJ48724.1| PAS/PAC sensor hybrid histidine kinase [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 840

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 69/110 (62%), Gaps = 3/110 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K+++ ED+++N  L   L+E  G+      NG EA+E  ++   D+++MD ++ E+ G 
Sbjct: 710 RKILLAEDDQINQILAMSLLERRGHKVTAVENGREAIEALQRECFDLVLMDARMPEMDGE 769

Query: 63  EITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           E T+ I+E +     + IP+IA+TA+A+KGD ER    G + YI+KP+ L
Sbjct: 770 EATRIIRESTPPGVDKNIPIIALTAYALKGDRERFLAAGMDDYIAKPLDL 819


>gi|330984642|gb|EGH82745.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            lachrymans str. M301315]
          Length = 1986

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|330961158|gb|EGH61418.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D++   IPVI +T    + D+   ++ G   Y++KP+     M+T+
Sbjct: 61  FQATRQLTKDADTSSIPVIMITTKDQETDKVWGKRQGARDYLTKPVDEETLMKTL 115


>gi|237798191|ref|ZP_04586652.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331021043|gb|EGI01100.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 460

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 73/115 (63%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM+V+D+    K+   L+E +G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 341 VMVVDDSVTVRKVTGRLLERNGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 400

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             QI+++ +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I  +
Sbjct: 401 VSQIRQNDQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESIAYW 455


>gi|330899370|gb|EGH30789.1| response regulator receiver:CheW-like protein:ATP-binding region,
            ATPase-like:Hpt [Pseudomonas syringae pv. japonica str.
            M301072PT]
          Length = 1637

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1518 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1577

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1578 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1629


>gi|304407983|ref|ZP_07389633.1| multi-sensor hybrid histidine kinase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343002|gb|EFM08846.1| multi-sensor hybrid histidine kinase [Paenibacillus curdlanolyticus
           YK9]
          Length = 1091

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++VEDN +N ++  +L++  G       NG+EALEL + H  D+I+MD+ +  ++G 
Sbjct: 843 RSVLLVEDNMINQQVAIELLKMRGLDIHVASNGLEALELLKHHAVDLILMDMYMPLMNGY 902

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E +K+I+ED+   E+P+IA+TA AM+ D E   + G    + KP+        + K++ 
Sbjct: 903 ETSKRIREDAAYAEVPIIALTANAMQQDHETYYEIGINEILLKPLEAERLNHCLNKWLA 961


>gi|254413753|ref|ZP_05027522.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Microcoleus chthonoplastes PCC 7420]
 gi|196179350|gb|EDX74345.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Microcoleus chthonoplastes PCC 7420]
          Length = 1022

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 69/118 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED+ +N +L   L++  G+      NG  A+ L ++ +P++I MD+ +  + G +
Sbjct: 810 RILVVEDHLVNRQLLVTLLKEVGFQVKSAENGQAAIALWQKWQPELIFMDMHIPIMDGYQ 869

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+QIK+ +     P+IA+TA A     E     GC+A+ISKP  L   +E I +Y+G
Sbjct: 870 ATRQIKQSNFATIPPIIAITASAFAHKREECLTAGCDAFISKPFHLEEILEIISQYLG 927


>gi|291570906|dbj|BAI93178.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 222

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 5/108 (4%)

Query: 5   VMIVEDNELNMKL-FRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++V D++L  +L   D +E SGY+ +   NG EALEL  +H+P +I+ DI + E+ G E
Sbjct: 4   TLLVVDDDLGTRLSISDYLEMSGYMVISATNGQEALELVEKHQPHLIVTDIAMPEMDGFE 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKPISL 109
           + K+++     + +PVI +TA      EERIR  + GC+ Y+ KP  L
Sbjct: 64  LVKRVRSQPIFRLLPVIFLTAHT--STEERIRGYQLGCDNYLPKPFEL 109


>gi|237745636|ref|ZP_04576116.1| signal transduction histidine kinase [Oxalobacter formigenes
           HOxBLS]
 gi|229376987|gb|EEO27078.1| signal transduction histidine kinase [Oxalobacter formigenes
           HOxBLS]
          Length = 577

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 73/123 (59%), Gaps = 5/123 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEI 59
           ++++I EDN LN ++   ++E +G +     NG EAL   R+  P    +I+MD+Q+ E+
Sbjct: 451 RRILIAEDNPLNAEIVMAMLEAAGAVLEHVTNGKEALNAFRKSPPGSYSMILMDVQMPEM 510

Query: 60  SGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           +G++ T+ I+     + + +PVIA+TA A + D +   K G   YI+KPI L+   ET+ 
Sbjct: 511 NGMDATEAIRKLHRPDAETVPVIALTANAFQEDMDAAFKSGMNGYITKPIDLNKLYETLY 570

Query: 118 KYI 120
            ++
Sbjct: 571 TFL 573


>gi|39952003|ref|XP_363718.1| hypothetical protein MGG_11174 [Magnaporthe oryzae 70-15]
 gi|145020511|gb|EDK04640.1| hypothetical protein MGG_11174 [Magnaporthe oryzae 70-15]
          Length = 1307

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 70/118 (59%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDN +N +L   ++E   ++     NG EALE  + +K DVI+MD+Q+  + G E
Sbjct: 1104 EILLAEDNTVNQRLAVKILEKYNHVVTVVSNGAEALEAVKDNKYDVILMDVQMPVMGGFE 1163

Query: 64   ITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T +I+E       Q  P+IA+TA AM GD E+  +   + Y+SKP+  +  ++TI K
Sbjct: 1164 ATAKIREYERSLGTQRTPIIALTAHAMMGDREKCIEAQMDEYLSKPLQQNHLIQTILK 1221


>gi|239908130|ref|YP_002954871.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
 gi|239797996|dbj|BAH76985.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
          Length = 1233

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 2/120 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN +N     DL+E+ G+  +   NG  ALE    H  DV++MDIQ+  + GL 
Sbjct: 982  RVLLVEDNRVNRVFATDLLESRGHEVILAENGRVALEYLVSHAVDVVLMDIQMPVMDGLA 1041

Query: 64   ITKQIKEDSELQE--IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             T+ I+      +  +PV+ ++A+AM  + ER    G + YI+KPI +  F   + + + 
Sbjct: 1042 ATRAIRAGHLDIDPGLPVVGLSAYAMDQERERFLAAGFDDYITKPIDVETFFAVVARVLA 1101


>gi|213971489|ref|ZP_03399601.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato T1]
 gi|301385803|ref|ZP_07234221.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato Max13]
 gi|302062916|ref|ZP_07254457.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato K40]
 gi|213923771|gb|EEB57354.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato T1]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|331018470|gb|EGH98526.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            lachrymans str. M302278PT]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|330960926|gb|EGH61186.1| response regulator receiver [Pseudomonas syringae pv. maculicola str.
            ES4326]
          Length = 1167

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG EA+  L      D+++MD+ + E+ G
Sbjct: 1043 RKILVVDDDVRNIFALTSALEHKGAVVEIARNGFEAIARLNEVEDIDLVLMDVMMPEMDG 1102

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I++D   +++P+IAVTA AMK D+ER  + G   Y++KPI L      I+ ++
Sbjct: 1103 YEATVEIRKDPRWRKLPIIAVTAKAMKDDQERCLQAGSNDYLAKPIDLDRLFSLIRVWL 1161



 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L      +   LA ++ PD I++D++L + SGL +
Sbjct: 777 ILVIEDEVRFAQILFDLAHELGYDCLVAHAADDGFNLAARYTPDAILLDMRLPDHSGLTV 836

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            +++KE +  + IPV  ++   ++  +E     G   Y  KP +
Sbjct: 837 LQRLKELAPTRHIPVHVIS---VEDRQEAALHMGAIGYAVKPTT 877



 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K++++VED+ L       LI              EAL+L R H  D +I+D++L ++ G
Sbjct: 896 VKRILLVEDDALQRDSIARLIGDDDIEITAVGFAQEALDLLRDHVYDCMIIDLKLPDMLG 955

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   M  DEE
Sbjct: 956 NELLKRMSTEDICSFPPVIVYTGRNMTRDEE 986


>gi|311695306|gb|ADP98179.1| sensory box sensor histidine kinase/response regulator [marine
           bacterium HP15]
          Length = 783

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDN +N  L R L+E  G   +   +G  A  L + H  D++ MD  +  + G E
Sbjct: 658 KVLLVEDNPVNRTLTRRLLEKLGCDVMTANDGEAAASLWQWHPFDLVFMDCVMPRVDGFE 717

Query: 64  ITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T++++E  +      IPV+A+TA AM+ DEER R+ G +++++KP+++ +    +++Y
Sbjct: 718 ATRRLREWEKTHNRARIPVVALTASAMEEDEERCRRCGMDSFVAKPVNIEMLRAVLEQY 776



 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 64/126 (50%), Gaps = 5/126 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ----HKP-DVIIMDIQLQ 57
           +++++V+  EL+ K+  +++          ++  EAL   R     H+P D II+D  + 
Sbjct: 502 RRILVVDSYELSRKITLEMLSRHEVHIEAVKSAGEALTSLRTAFDGHQPFDAIILDGFVP 561

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           ++    + +QI+ +    ++ ++ +++   +GD E  R+ G +A++SK +  S     + 
Sbjct: 562 DMDSDLLCRQIRSNPLWSDMRLLILSSNPQRGDAEHFRQAGADAFLSKSLRESCLTPILN 621

Query: 118 KYIGEA 123
           +   +A
Sbjct: 622 QLFADA 627


>gi|150006464|ref|YP_001301208.1| two-component system response regulator [Bacteroides vulgatus ATCC
           8482]
 gi|254881619|ref|ZP_05254329.1| two-component system response regulator [Bacteroides sp. 4_3_47FAA]
 gi|294777015|ref|ZP_06742473.1| response regulator receiver domain protein [Bacteroides vulgatus
           PC510]
 gi|319643004|ref|ZP_07997638.1| two-component system response regulator [Bacteroides sp. 3_1_40A]
 gi|149934888|gb|ABR41586.1| two-component system response regulator [Bacteroides vulgatus ATCC
           8482]
 gi|254834412|gb|EET14721.1| two-component system response regulator [Bacteroides sp. 4_3_47FAA]
 gi|294449073|gb|EFG17615.1| response regulator receiver domain protein [Bacteroides vulgatus
           PC510]
 gi|317385369|gb|EFV66314.1| two-component system response regulator [Bacteroides sp. 3_1_40A]
          Length = 118

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++ ED E N  L   +I    Y   +  +G EA+E     +PD+I+MDI++  + G
Sbjct: 1   MKKILVAEDTESNY-LLLSIILRKEYEVHRAHDGQEAIEKFESCRPDMILMDIKMPVMDG 59

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE T++I+       +P+IA+TA A   D ++  + GC+ Y++KPI      E IKKY G
Sbjct: 60  LEATRRIRLKG--GTLPIIALTANAYDSDRDKAFEAGCDDYMAKPIMAPALREMIKKYFG 117

Query: 122 E 122
           E
Sbjct: 118 E 118


>gi|28872144|ref|NP_794763.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato str. DC3000]
 gi|28855398|gb|AAO58458.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato str. DC3000]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|330951389|gb|EGH51649.1| response regulator receiver:CheW-like protein:ATP-binding region,
            ATPase-like:Hpt [Pseudomonas syringae Cit 7]
          Length = 1993

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1874 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1933

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1934 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1985


>gi|302189833|ref|ZP_07266506.1| response regulator receiver:CheW-like protein:ATP-binding region,
            ATPase-like:Hpt [Pseudomonas syringae pv. syringae 642]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESI 1979


>gi|302133693|ref|ZP_07259683.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            tomato NCPPB 1108]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|91227847|ref|ZP_01262020.1| sensor histidine kinase/response regulator [Vibrio alginolyticus
           12G01]
 gi|91188357|gb|EAS74653.1| sensor histidine kinase/response regulator [Vibrio alginolyticus
           12G01]
          Length = 932

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 65/115 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+DN  N+KL   L+           NG +A+ LA + K D+I MDIQ+ ++ G+  
Sbjct: 670 VLAVDDNPANLKLISALLRERVETVTACSNGQQAVNLATEKKYDLIFMDIQMPQMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IKE    ++ PVIAVTA AM G+ +R+   G + Y++KPI   +  + +  +
Sbjct: 730 CKHIKELELNKDTPVIAVTAHAMAGERDRLLSAGMDDYLTKPIEEHVLQQVLVHW 784


>gi|317498078|ref|ZP_07956381.1| hsp90-like protein [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316894666|gb|EFV16845.1| hsp90-like protein [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 718

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 78/123 (63%), Gaps = 5/123 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEISG 61
           V++VEDNELNM++   ++E++G   ++  NG EALE+ ++ K    D+I+MD+ +  + G
Sbjct: 591 VLLVEDNELNMEIAEFVLESAGANVIKAFNGKEALEIFKESKLGEIDIILMDVMMPVMDG 650

Query: 62  LEITKQIKEDSE--LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           LE  + I+  ++   ++IP+IA+TA A   D  R+ + G   +++KP+   + ++TI  Y
Sbjct: 651 LEAARYIRWSNKENARDIPIIAMTANAFTEDRRRVLEAGMNEHLAKPLESEVLIKTIANY 710

Query: 120 IGE 122
            G+
Sbjct: 711 CGK 713


>gi|224535689|ref|ZP_03676228.1| hypothetical protein BACCELL_00553 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522699|gb|EEF91804.1| hypothetical protein BACCELL_00553 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 1113

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/123 (36%), Positives = 77/123 (62%), Gaps = 11/123 (8%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSG--YIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ++++IVEDN+ +++++  L+ T G  Y+     NG EALE+  + KPD+++ DI + E+S
Sbjct: 844 RRILIVEDND-DLRIY--LVNTLGEDYLVQSCHNGKEALEILSEFKPDLVLSDIMMPEMS 900

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIK 117
           G E+   IK + E   IPV+ +TA    GDE+ + +G   G + Y++KP S+SI   +I 
Sbjct: 901 GDELCAAIKGNIETSHIPVLLLTAL---GDEKNMLEGLKIGADDYMAKPFSISILKASIN 957

Query: 118 KYI 120
           + I
Sbjct: 958 RLI 960


>gi|330963793|gb|EGH64053.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            actinidiae str. M302091]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|330873918|gb|EGH08067.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            morsprunorum str. M302280PT]
          Length = 1987

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 71/112 (63%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1868 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMSLLQEHTPDIMLLDIEMPRMDGFEV 1927

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ + +   +R    G   Y+SKP   ++ +E+I
Sbjct: 1928 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMALGVNEYLSKPYQENVLLESI 1979


>gi|269965226|ref|ZP_06179360.1| sensor histidine kinase/response regulator [Vibrio alginolyticus
           40B]
 gi|269830212|gb|EEZ84439.1| sensor histidine kinase/response regulator [Vibrio alginolyticus
           40B]
          Length = 932

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 65/115 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+DN  N+KL   L+           NG +A+ LA + K D+I MDIQ+ ++ G+  
Sbjct: 670 VLAVDDNPANLKLISALLRERVETVTACSNGQQAVNLATEKKYDLIFMDIQMPQMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K IKE    ++ PVIAVTA AM G+ +R+   G + Y++KPI   +  + +  +
Sbjct: 730 CKHIKELELNKDTPVIAVTAHAMAGERDRLLSAGMDDYLTKPIEEHVLQQVLVHW 784


>gi|209695938|ref|YP_002263868.1| hybrid sensory histidine kinase BarA [Aliivibrio salmonicida
           LFI1238]
 gi|208009891|emb|CAQ80204.1| response regulator, histidine kinase VarS [Aliivibrio salmonicida
           LFI1238]
          Length = 929

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+       +  +NG++A++ A + K D+I+MDIQ+ ++ G+ 
Sbjct: 670 KVMAVDDNPANLKLISALLHEQVESVVTCKNGIDAVQQATEQKFDIILMDIQMPKMDGVM 729

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             K+I++ +     P++AVTA AM G+ ER+   G + Y++KPI   +  + I  +
Sbjct: 730 ACKEIRKTALNSGTPIVAVTAHAMAGERERLISEGMDDYLTKPIEEHVLQQVIIHW 785


>gi|56460833|ref|YP_156114.1| hybrid sensor histidine kinase [Idiomarina loihiensis L2TR]
 gi|56179843|gb|AAV82565.1| Hybrid sensor histidine kinase (HisK, 2 CheY, Hpt domains)
           [Idiomarina loihiensis L2TR]
          Length = 866

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 69/115 (60%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNE+N ++ R+++ +  +      NG  A+E        +++MDIQ+  + GL+ 
Sbjct: 603 ILVVEDNEINQQVAREILSSHKFKVDIVENGQLAVEAVHNKNYSLVLMDIQMPVMDGLKA 662

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            + I+ D   Q++P++A+TA AM GDEER    G + +I+KPI     ++ I K+
Sbjct: 663 AQTIRADFNYQQLPILAMTANAMSGDEERSLAAGMQGHIAKPIDEQQLIKAIIKW 717


>gi|13591555|dbj|BAB40947.1| histidine kinase [Magnaporthe grisea]
          Length = 1307

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 70/118 (59%), Gaps = 3/118 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ EDN +N +L   ++E   ++     NG EALE  + +K DVI+MD+Q+  + G E
Sbjct: 1104 EILLAEDNTVNQRLAVKILEKYNHVVTVVSNGAEALEAVKDNKYDVILMDVQMPVMGGFE 1163

Query: 64   ITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             T +I+E       Q  P+IA+TA AM GD E+  +   + Y+SKP+  +  ++TI K
Sbjct: 1164 ATAKIREYERSLGTQRTPIIALTAHAMMGDREKCIEAQMDEYLSKPLQQNHLIQTILK 1221


>gi|120555598|ref|YP_959949.1| integral membrane sensor hybrid histidine kinase [Marinobacter
           aquaeolei VT8]
 gi|120325447|gb|ABM19762.1| integral membrane sensor hybrid histidine kinase [Marinobacter
           aquaeolei VT8]
          Length = 784

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 72/119 (60%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN +N  L R L+E  G   +   +G  A  L + H+ DV+ MD  +  + G E
Sbjct: 659 RVLLVEDNPVNRTLTRRLLEKLGCEVMTANDGQAASSLWQWHQFDVVFMDCVMPRMDGYE 718

Query: 64  ITKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+Q++    +     +PV+A+TA AM+ DEER R+ G +++++KP++L +    +++Y
Sbjct: 719 ATRQLRAWETNHGRSRVPVVALTASAMEEDEERCRQAGMDSFVAKPVNLEMLRAVLEQY 777



 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-----KPDVIIMDIQLQ 57
           ++V++V+  EL+ K+  +++          R+  EAL   RQ        D  I+D  + 
Sbjct: 502 RRVLVVDSYELSRKITLEMLSRYDVHIDAVRSAGEALTALRQAFDAGIPYDATILDGFVP 561

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           ++    + +Q++ + +  E+ ++ +++   +GD E  R+ G +A++SK +  S  +  + 
Sbjct: 562 DMDADLLCRQVRSNPQWAEMRLLILSSNPQRGDAEHFRQAGADAFLSKSLRESYLIPILN 621

Query: 118 K 118
           +
Sbjct: 622 Q 622


>gi|295090484|emb|CBK76591.1| His Kinase A (phosphoacceptor) domain./Histidine kinase-, DNA
           gyrase B-, and HSP90-like ATPase./Response regulator
           receiver domain. [Clostridium cf. saccharolyticum K10]
          Length = 384

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEIS 60
           +V++ EDNE+NM++  +L++       Q  NG EA+EL R+      D+I+MD+Q+  ++
Sbjct: 242 RVLLAEDNEINMEISTELLKMYNLDVTQAWNGKEAVELFREMGEGFFDIILMDMQMPVMN 301

Query: 61  GLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           G E  +QI+  +  +   IP+IAVTA A   D    R  G  A+ISKPI   IF +T++ 
Sbjct: 302 GCEAARQIRAMKRPDASTIPIIAVTANAFSEDIAATRNAGMNAHISKPIDFEIFRKTVES 361

Query: 119 YI 120
            +
Sbjct: 362 LL 363


>gi|330977048|gb|EGH77010.1| response regulator receiver:CheW-like protein:ATP-binding region,
           ATPase-like:Hpt [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 317

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 71/115 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 198 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEV 257

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             QI++D +L+E+P+I +T+ + +   +R    G   Y+ KP   ++ +E+I  +
Sbjct: 258 ASQIRQDEQLKELPIIMITSRSGQKHRDRAMAVGVNEYLRKPYQETVLLESIAYW 312


>gi|253571309|ref|ZP_04848716.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 1_1_6]
 gi|251839262|gb|EES67346.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 1_1_6]
          Length = 1333

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 71/123 (57%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L+++++VEDN+       D++  +GY      NG +AL + ++  PD++I DI + E+SG
Sbjct: 1080 LQRILVVEDNDDLRNYLVDML-MAGYNIQSCSNGKDALVIIKEFNPDLVISDIMMPEMSG 1138

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK   E+  IPVI +TA    GDE+ I  G   G +AYI+KP S+ I   TIK 
Sbjct: 1139 DELCSAIKTSVEMSHIPVILLTAL---GDEKNILGGLEIGADAYITKPFSVGILKVTIKN 1195

Query: 119  YIG 121
             + 
Sbjct: 1196 ILA 1198


>gi|209550469|ref|YP_002282386.1| PAS/PAC sensor hybrid histidine kinase [Rhizobium leguminosarum bv.
            trifolii WSM2304]
 gi|209536225|gb|ACI56160.1| PAS/PAC sensor hybrid histidine kinase [Rhizobium leguminosarum bv.
            trifolii WSM2304]
          Length = 1126

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 72/118 (61%), Gaps = 2/118 (1%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ EDNE+N  +F  +++ +G   L   NG EA+    +H+P +I+MD+ +  ++G + 
Sbjct: 997  VLVAEDNEVNQIVFTQILQGTGLSFLVVDNGEEAVAAWERHRPRIIMMDVSMPVMNGHQA 1056

Query: 65   TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+E  + Q   +P+I VTA A++ D E     G + Y+SKPIS  +  E I++++
Sbjct: 1057 TQTIREREKGQGHRVPIIGVTAHALESDRELCLDAGMDDYMSKPISPELLEEKIRQWL 1114



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-----DVIIMDIQLQE 58
           ++++V+DN++N ++  + +   G+  +    G   L +           D +++D  + +
Sbjct: 835 RILVVDDNDVNRRILTEQLSLWGFDGVAAEGGGTGLAILEAAADLGITVDAVVLDYHMPD 894

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           ++G ++ ++++ D    E+P+I +T+  + G E+        A++ KP   ++   T+
Sbjct: 895 MNGADVARRLRADRRFVELPIIFLTSMDISGTEKEFAALNGHAHLMKPARANVLRNTV 952


>gi|120435203|ref|YP_860889.1| two-component system sensor histidine kinase/response regulator
            hybrid [Gramella forsetii KT0803]
 gi|117577353|emb|CAL65822.1| two-component system sensor histidine kinase/response regulator
            hybrid [Gramella forsetii KT0803]
          Length = 1202

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 72/120 (60%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K++IVEDN +N  L   +I+        LQ  NG EA+    ++KPD+I MDIQ+  + G
Sbjct: 1078 KILIVEDNPVNKFLANSIIKKILPNAELLQAENGQEAMNQFEKNKPDLIFMDIQMPVMGG 1137

Query: 62   LEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T++I++ + E   IP+IA+TA A+K + ER  K G   Y++KP+ L    + + KY+
Sbjct: 1138 FEATQEIRKLEGENSYIPIIALTARAVKDERERCLKAGMNDYLTKPVILEDIRDMLYKYL 1197



 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 66/117 (56%), Gaps = 13/117 (11%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LAR-QHKPDVIIMDIQLQEI 59
            +K V+IV+DN  N  + ++++  +   +++  NG+EAL  L R Q K D+ I+D  +  +
Sbjct: 931  IKNVLIVDDNTNNRIILKEMLAANNIESVECANGIEALNVLTRNQDKFDLAIIDYNMPYM 990

Query: 60   SGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGC-----EAYISKPISL 109
            +GL +  QI+   +   +E+PVI +   +   DEE I+  GC       +++KPI +
Sbjct: 991  NGLSLIDQIRNKFNKNAEELPVILL--HSSTEDEEIIK--GCKELNVHHHMTKPIQI 1043


>gi|29349146|ref|NP_812649.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides thetaiotaomicron VPI-5482]
 gi|29341054|gb|AAO78843.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides
            thetaiotaomicron VPI-5482]
          Length = 1330

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 71/123 (57%), Gaps = 7/123 (5%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            L+++++VEDN+       D++  +GY      NG +AL + ++  PD++I DI + E+SG
Sbjct: 1077 LQRILVVEDNDDLRNYLVDML-MAGYNIQSCSNGKDALVIIKEFNPDLVISDIMMPEMSG 1135

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKK 118
             E+   IK   E+  IPVI +TA    GDE+ I  G   G +AYI+KP S+ I   TIK 
Sbjct: 1136 DELCSAIKTSVEMSHIPVILLTAL---GDEKNILGGLEIGADAYITKPFSVGILKVTIKN 1192

Query: 119  YIG 121
             + 
Sbjct: 1193 ILA 1195


>gi|256828852|ref|YP_003157580.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578028|gb|ACU89164.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 862

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 3/110 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN +N  +   L+E  G+ A+   +G EALEL      D ++MDIQ+  + G E
Sbjct: 733 RILVAEDNSVNQLMIVKLLEKLGHTAVCAHDGQEALELLSLAPYDCVLMDIQMPGLDGTE 792

Query: 64  ITKQIKEDSEL---QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
            T+ I+  +      ++P+IA+TA+A+ GD ER    G   Y+SKP+S++
Sbjct: 793 ATRMIRRRALSGIDPDVPIIALTAYALSGDRERFLAMGMSGYLSKPVSMA 842


>gi|59712689|ref|YP_205465.1| hybrid sensory histidine kinase BarA [Vibrio fischeri ES114]
 gi|59480790|gb|AAW86577.1| hybrid sensory histidine kinase, in two-component regulatory system
           with GacA [Vibrio fischeri ES114]
          Length = 931

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+       +   NG++A++ A +   D+I+MDIQ+ ++ G+ 
Sbjct: 670 KVMAVDDNPANLKLISALLSEQVETVITCDNGLDAVQQATEQHFDIILMDIQMPKMDGVM 729

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             K+I++ +   + PV+AVTA AM+G+ ER+   G + Y++KPI   +  + I  +
Sbjct: 730 ACKEIRKTALNAQTPVVAVTAHAMEGERERLISEGMDDYLTKPIEEHVLQQVIIHW 785


>gi|261250888|ref|ZP_05943462.1| hypothetical protein VIA_000906 [Vibrio orientalis CIP 102891]
 gi|260937761|gb|EEX93749.1| hypothetical protein VIA_000906 [Vibrio orientalis CIP 102891]
          Length = 1053

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (57%), Gaps = 6/121 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPD-----VIIMDIQLQ 57
            V++VEDNE+N ++  +L+E  G       NG EAL+   Q ++PD     +I MD+Q+ 
Sbjct: 694 NVLLVEDNEINQQIAVELMEEKGLKVTVANNGQEALDTLEQVYQPDSPHFEIIFMDLQMP 753

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            + G E +K+I+ D    ++P++A+TA AM  + ER    G   ++SKPI   I   TIK
Sbjct: 754 VMDGYEASKRIRGDHRFDDVPLVAMTAHAMIEERERCLSIGMNDHVSKPIDPEILFSTIK 813

Query: 118 K 118
           +
Sbjct: 814 R 814



 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 4   KVMIVEDNELNMKLFRDLIE---------TSGYIALQTRNGMEALELARQHKP-DVIIMD 53
           K M+V+DNE  + +  DL++         +SG +A++       +E  +Q++P +++ MD
Sbjct: 547 KAMVVDDNEHALLVMEDLLDVLPNRPSLVSSGELAIEA-----LMEATKQNQPYNLVFMD 601

Query: 54  IQLQEISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIF 112
            ++  +SG+E T++I+     ++ P ++ VTA+  +     +       ++SKP+  S  
Sbjct: 602 WKMPVMSGIEATQKIRHTLPAEQQPKIVIVTAYDKEDISLDLDDLDIAGFLSKPVGQSYL 661

Query: 113 METIKKYIG 121
            + +    G
Sbjct: 662 FDLLMDLFG 670


>gi|239995114|ref|ZP_04715638.1| multi-sensor hybrid histidine kinase [Alteromonas macleodii ATCC
           27126]
          Length = 490

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 71/111 (63%), Gaps = 9/111 (8%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP--DVIIMDIQLQEIS 60
           +KV+IVEDN++N  + +  +  + +  L  ++G+EALE   + K   DV++MD Q+ E+ 
Sbjct: 358 RKVLIVEDNDINQVIVKQHL--NNHTTLSAKSGLEALEALNKMKVTFDVVLMDCQMPEMD 415

Query: 61  GLEITKQIKEDSELQE----IPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           G E TK+I+ + E  E    +P+IA+TA AMKGD+ER    G + Y+SKP 
Sbjct: 416 GFEATKRIR-NGEAGERYLNVPIIALTANAMKGDKERCVNAGMDDYLSKPF 465


>gi|124009946|ref|ZP_01694611.1| response regulator [Microscilla marina ATCC 23134]
 gi|123984030|gb|EAY24408.1| response regulator [Microscilla marina ATCC 23134]
          Length = 131

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 3/115 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQL--QEISG 61
           KV+I+ED+ +N  + +  IE   Y A+  +NG EAL L +    DVI+MDI L  + + G
Sbjct: 10  KVLIIEDDAINAFVLQKFIEKK-YTAVLAKNGHEALSLVKDALFDVILMDINLGDENLDG 68

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           + + ++I+  +      + AVT+FAM+GD+E     G   Y SKPI  S+ M+ I
Sbjct: 69  VHLLQKIRAITGYANANIFAVTSFAMRGDKESFLAAGFNRYFSKPIEHSVIMKAI 123


>gi|315224472|ref|ZP_07866299.1| DNA-binding response regulator/sensor histidine kinase
           [Capnocytophaga ochracea F0287]
 gi|314945493|gb|EFS97515.1| DNA-binding response regulator/sensor histidine kinase
           [Capnocytophaga ochracea F0287]
          Length = 934

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVEDNE +M+ F   I +  Y  ++  NG E  E+A++H PDV+I D+ + +  G ++
Sbjct: 687 VLIVEDNE-DMRQFIRYILSDDYNLIEAENGEEGFEVAKKHLPDVVISDVMMPKTDGFDL 745

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + IK +     IPVI +TA+A+   ++   + G +AYI+KP ++ +    ++K I
Sbjct: 746 CQLIKTNVATNHIPVILLTAYALDEQKQVGFESGADAYIAKPFNIKLLKTRVRKLI 801


>gi|296448200|ref|ZP_06890097.1| GAF sensor hybrid histidine kinase [Methylosinus trichosporium OB3b]
 gi|296254284|gb|EFH01414.1| GAF sensor hybrid histidine kinase [Methylosinus trichosporium OB3b]
          Length = 1142

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            +++++VED+  N+     ++E  G  AL  R G EALE L R+   D I+MDI + E+ G
Sbjct: 1022 RRILLVEDDVRNIFSLTAMLEREGAKALIARTGREALECLDREASIDFILMDIMMPEMDG 1081

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            LE  +QI+   E   +P+IA+TA AM  D E   + G   Y++KPI +   + +++ ++
Sbjct: 1082 LEAIRQIRARKEFAFVPIIALTAKAMSDDRENCLEAGANDYVAKPIDVEKLLSSMRVWM 1140



 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 5/103 (4%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVED+ L  ++ RDL    G+  +      EAL LA   +P+ +++DI L + SGL +
Sbjct: 756 VLIVEDDPLFAQILRDLARELGFKCIVAGTADEALRLASAFRPEAVVLDIGLPDRSGLTV 815

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIR-KGGCEAYISKP 106
            + +K D  ++  P+  V+      D +++  + G   YI KP
Sbjct: 816 LELLKRDPAMRHAPIHIVSVH----DYQQVALEMGAVGYILKP 854



 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGY--IALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            ++IVED  +      DL+ T G   +A++T  G  ALE  R  + D +++D+ L  +SG
Sbjct: 877 SILIVEDEGMQRDALIDLLATEGTDIVAVETAEG--ALEKLRDQRFDCVVLDLMLPGVSG 934

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+  ++  +      PVI  TA ++  DEE
Sbjct: 935 FELLGELSRNERHSLPPVIVYTARSLTIDEE 965


>gi|197336284|ref|YP_002156881.1| signal transduction histidine-protein kinase BarA [Vibrio fischeri
           MJ11]
 gi|197317774|gb|ACH67221.1| signal transduction histidine-protein kinase BarA [Vibrio fischeri
           MJ11]
          Length = 931

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+       +   NG++A++ A +   D+I+MDIQ+ ++ G+ 
Sbjct: 670 KVMAVDDNPANLKLISALLSEQVETVITCDNGLDAVQQATEQHFDIILMDIQMPKMDGVM 729

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             K+I++ +   + PV+AVTA AM+G+ ER+   G + Y++KPI   +  + I  +
Sbjct: 730 ACKEIRKTALNAQTPVVAVTAHAMEGERERLISEGMDDYLTKPIEEHVLQQVIIHW 785


>gi|256819065|ref|YP_003140344.1| two component transcriptional regulator, AraC family
           [Capnocytophaga ochracea DSM 7271]
 gi|256580648|gb|ACU91783.1| two component transcriptional regulator, AraC family
           [Capnocytophaga ochracea DSM 7271]
          Length = 934

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVEDNE +M+ F   I +  Y  ++  NG E  E+A++H PDV+I D+ + +  G ++
Sbjct: 687 VLIVEDNE-DMRQFIRYILSDDYNLIEAENGEEGFEVAKKHLPDVVISDVMMPKTDGFDL 745

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + IK +     IPVI +TA+A+   ++   + G +AYI+KP ++ +    ++K I
Sbjct: 746 CQLIKTNVATNHIPVILLTAYALDEQKQVGFESGADAYIAKPFNIKLLKTRVRKLI 801


>gi|89075083|ref|ZP_01161524.1| putative sensor histidine kinase/response regulator [Photobacterium
           sp. SKA34]
 gi|89049170|gb|EAR54735.1| putative sensor histidine kinase/response regulator [Photobacterium
           sp. SKA34]
          Length = 929

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 65/117 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       +    G +A+E A+    D+I MDIQ+ E+ G+  
Sbjct: 670 VMAVDDNPANLKLISALLGERVETVITATGGKKAVEYAKNKAFDLIFMDIQMPEMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            ++I + +     PVIAVTA AM G+ ER+   G + Y++KPI   I  + + K+I 
Sbjct: 730 CQKIHDTALNHNTPVIAVTAHAMAGERERLINAGMDDYLTKPIEEHILQQILAKWIA 786


>gi|86137029|ref|ZP_01055607.1| sensor histidine kinase/response regulator [Roseobacter sp. MED193]
 gi|85826353|gb|EAQ46550.1| sensor histidine kinase/response regulator [Roseobacter sp. MED193]
          Length = 782

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 75/123 (60%), Gaps = 4/123 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQ-TRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++  EDN  N  +FR +++    I LQ   NG+EA+ L +  +PD++ MDI + E+ G 
Sbjct: 651 RILAAEDNRTNQLVFRKMVKDLN-IELQFANNGVEAVALYQSFEPDLVFMDISMPEMDGK 709

Query: 63  EITKQIKEDSEL--QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E T +I++   L  + +P++A+TA AM GD + I   G + Y++KP+  ++ +E I +++
Sbjct: 710 EATGEIRKLEALTGRHVPIVALTAHAMTGDSDGILAAGLDHYLTKPLRKAVILERILQHV 769

Query: 121 GEA 123
            E 
Sbjct: 770 SEG 772


>gi|323492710|ref|ZP_08097854.1| Signal transduction histidine kinase [Vibrio brasiliensis LMG
           20546]
 gi|323313085|gb|EGA66205.1| Signal transduction histidine kinase [Vibrio brasiliensis LMG
           20546]
          Length = 770

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN  N  + R++ +  G       NG +A+E+ +Q++ DVI MDI + E+ G++
Sbjct: 491 RVLVAEDNRANQLVIREMFKRIGLNIDIAENGRQAIEMVQQYQYDVIFMDISMPEMDGMQ 550

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             K I+  +D    ++P+IA+TA ++ GD+E+    G   Y+SKP+  S  ++ I  ++ 
Sbjct: 551 ACKAIRNLDDPATAKLPIIALTAHSLAGDKEKFLASGMNDYLSKPLRASQLIDKINLFLN 610

Query: 122 E 122
           E
Sbjct: 611 E 611


>gi|239627023|ref|ZP_04670054.1| PAS/PAC sensor hybrid histidine kinase [Clostridiales bacterium
           1_7_47_FAA]
 gi|239517169|gb|EEQ57035.1| PAS/PAC sensor hybrid histidine kinase [Clostridiales bacterium
           1_7_47FAA]
          Length = 563

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 69/121 (57%), Gaps = 5/121 (4%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEIS 60
           +V++ EDNELNM++   L+E  G +    RNG EA+EL R   P   DV++MDI++  + 
Sbjct: 439 RVLLCEDNELNMEIAVYLLEAGGAVVDCARNGSEAVELFRASGPGSYDVVLMDIRMPVMD 498

Query: 61  GLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           GLE  + I+  +  +   +P+ A+TA A   D +  R+ G + ++SKPI   +    I  
Sbjct: 499 GLEAARSIRVLDRPDASSVPIFAMTANAYDEDRKMSREAGMDEHLSKPIDAGLLYRMIWN 558

Query: 119 Y 119
           Y
Sbjct: 559 Y 559


>gi|89519306|gb|ABD75783.1| putative signal transduction histidine kinase [uncultured
           bacterium]
          Length = 962

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
           K +++V+D+  N+     ++E  G   +   NG EALEL + +   D+++MDI + E+ G
Sbjct: 843 KTILMVDDDIRNVFALSSVLEEKGMTIVIGENGKEALELLKNNPGIDLVLMDIMMPEMDG 902

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T+QI++ ++  ++P+IA+TA AMKGD ++    G   Y+SKPI +   +  ++ ++
Sbjct: 903 YEATRQIRKQTQFSKLPIIALTAKAMKGDRQKCIDAGANDYLSKPIDIDKLLSLLRVWL 961



 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++I+ED+    K+  DL    G+  L   +G   L+LA Q+ P  II+DI L  + G 
Sbjct: 575 KFLLIIEDDPKFAKILFDLAREKGFKGLIAGDGAAGLQLADQYSPVAIILDIGLPGMDGW 634

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIF 112
            + +++K++ + + IPV  ++A   +       K G   Y++KP++L I 
Sbjct: 635 AVMEKLKKNPDTRHIPVHFMSA---QDTPLEAMKMGAIGYLTKPVTLDIL 681



 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 64/130 (49%), Gaps = 8/130 (6%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VED++       +L+            G +A  L +  + D +++D+ L +ISG
Sbjct: 696 IKKLLVVEDDDTMRASMLELLNGEDVDITPAATGEKAYHLLQSERFDCMVLDLGLTDISG 755

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS--------LSIFM 113
             + ++IK D+ +  IP+I  T   +  +EE   K   E+ I K +         +++F+
Sbjct: 756 FGLLEKIKADATMSHIPIIVYTGKDLTKEEETKLKQHAESIIIKGVKSPERLLDEVTLFL 815

Query: 114 ETIKKYIGEA 123
             I+  + EA
Sbjct: 816 HRIESDLPEA 825


>gi|192359057|ref|YP_001982371.1| response regulator [Cellvibrio japonicus Ueda107]
 gi|190685222|gb|ACE82900.1| response regulator [Cellvibrio japonicus Ueda107]
          Length = 332

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 69/114 (60%), Gaps = 1/114 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D  LN+++ R +++   Y  +  R+G +A+ LA+  +P +I++DI +  I+GLE
Sbjct: 10  KLLIVDDEPLNLQVLRQILQQD-YQLIFARDGEKAIALAQSEQPQLILLDIMMPGITGLE 68

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
              ++K+    Q IPVI +TA A   DE      GC  YI+KP+S  I +  +K
Sbjct: 69  TCSRLKQHPLTQAIPVIFITALADDRDETEGFAAGCVDYITKPVSAPIVLARVK 122


>gi|104782259|ref|YP_608757.1| sensor histidine kinase/response regulator [Pseudomonas entomophila
            L48]
 gi|95111246|emb|CAK15966.1| putative sensor histidine kinase/response regulator (hybrid)
            [Pseudomonas entomophila L48]
          Length = 1156

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G I    RNG EALE L      D+++MD+ + E+ G
Sbjct: 1032 RKILLVDDDVRNIFALTSALEHKGAIVEIGRNGREALECLEANDDIDLVLMDVMMPEMDG 1091

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+ I++    +++P+IAVTA AMK D++R  + G   Y++KPI L      I+ ++
Sbjct: 1092 YEATRLIRQQPRWRKLPIIAVTAKAMKDDQQRCLQAGANDYLAKPIDLDRLFSLIRVWL 1150



 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++++ED     ++  DL    GY  L  +   E  ELA Q+ PD I++D++L + SGL +
Sbjct: 766 ILVIEDEPNFARILYDLAHELGYSCLVAQAADEGFELAAQYMPDAILLDMRLPDHSGLTV 825

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP S
Sbjct: 826 LQRLKEQASTRHIPVHIISV------EDRVEAAMHMGAVGYAVKPTS 866


>gi|90580330|ref|ZP_01236137.1| putative sensor histidine kinase/response regulator [Vibrio
           angustum S14]
 gi|90438632|gb|EAS63816.1| putative sensor histidine kinase/response regulator [Vibrio
           angustum S14]
          Length = 931

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 65/117 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       +    G +A+E A+    D+I MDIQ+ E+ G+  
Sbjct: 670 VMAVDDNPANLKLISALLGERVETVITATGGKKAVEYAKNKAFDLIFMDIQMPEMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            ++I + +     PVIAVTA AM G+ ER+   G + Y++KPI   I  + + K+I 
Sbjct: 730 CQKIHDTALNHNTPVIAVTAHAMAGERERLINAGMDDYLTKPIEEHILQQILAKWIA 786


>gi|303327814|ref|ZP_07358254.1| sensory box histidine kinase/response regulator [Desulfovibrio sp.
            3_1_syn3]
 gi|302862175|gb|EFL85109.1| sensory box histidine kinase/response regulator [Desulfovibrio sp.
            3_1_syn3]
          Length = 1165

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++ EDNE+N ++  +L+E  G   +  ++G EA+EL R    D+I MDIQ+  + GL 
Sbjct: 1042 RVLLAEDNEINQEVALNLLEGLGMRVVLAKDGAEAVELCRGQSFDLIFMDIQMPIMDGLT 1101

Query: 64   ITKQIKEDSEL--QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             T++I+    +   E P+IA+TA AM GD E+  + G   +I+KPI
Sbjct: 1102 ATRKIRALPGIGPSEPPIIAMTAHAMSGDREKSLEAGMNDHITKPI 1147


>gi|262170598|ref|ZP_06038276.1| BarA sensory histidine kinase [Vibrio mimicus MB-451]
 gi|261891674|gb|EEY37660.1| BarA sensory histidine kinase [Vibrio mimicus MB-451]
          Length = 916

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+    D+I+MDIQ+  + G+  
Sbjct: 656 VMAVDDNPANLKLITALLQERVECVVACISGQEAIEQAQIRHFDIILMDIQMPHMDGVTA 715

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            K+IK+     + PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +  +
Sbjct: 716 CKEIKQLKGYSDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHW 770


>gi|218887570|ref|YP_002436891.1| multi-sensor hybrid histidine kinase [Desulfovibrio vulgaris str.
            'Miyazaki F']
 gi|218758524|gb|ACL09423.1| multi-sensor hybrid histidine kinase [Desulfovibrio vulgaris str.
            'Miyazaki F']
          Length = 1071

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 69/112 (61%), Gaps = 6/112 (5%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++V+D+E+N+   + L+   GYIA +  +G +ALE+  +   D ++MDIQ+ ++ G+E
Sbjct: 941  RILVVDDDEVNLITAQRLLTRLGYIADRAASGRQALEMLGRDHYDAVLMDIQMPDMDGME 1000

Query: 64   ITKQIKEDSELQE------IPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T+QI+    +        +PV+A+TA AM GD ER    G   Y++KPI +
Sbjct: 1001 ATRQIRMREAVLPGTTPPWVPVLALTAHAMLGDRERFLAAGMNDYLAKPIEI 1052


>gi|255941286|ref|XP_002561412.1| Pc16g11060 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586035|emb|CAP93776.1| Pc16g11060 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1025

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 73/117 (62%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN++N K+   ++E   +      NG++A++ A++H+ DVI+MD+Q+  + G E 
Sbjct: 895  ILLAEDNDVNQKVAVRILEKFNHNVTVVENGLQAVKEAKRHRYDVILMDVQMPVMGGFEA 954

Query: 65   TKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T  I++  +   L   P++A+TA AM GD ++  + G + Y+SKP+  +  M+TI K
Sbjct: 955  TGNIRQYEKINGLPRTPIVALTAHAMLGDRDKCIEAGMDDYLSKPLDSNRMMQTILK 1011


>gi|119476447|ref|ZP_01616798.1| putative histidine kinase protein [marine gamma proteobacterium
           HTCC2143]
 gi|119450311|gb|EAW31546.1| putative histidine kinase protein [marine gamma proteobacterium
           HTCC2143]
          Length = 121

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 68/118 (57%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDN++N  +    ++   Y      NG  A+E A   KPD+I+MD++L    G   
Sbjct: 4   ILLVEDNDMNRDMLSRRLQRRQYRVTTANNGAIAVEKATLEKPDLILMDMELPIKDGWTA 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +++IK      + P+IA+TA A+ GD ++    GC+ Y +KPI+    +  I++Y+G+
Sbjct: 64  SREIK---ATLDTPIIALTAHALSGDRDKALAAGCDDYTTKPINFDHLVAMIEQYLGK 118


>gi|75910491|ref|YP_324787.1| response regulator receiver domain-containing protein [Anabaena
           variabilis ATCC 29413]
 gi|75704216|gb|ABA23892.1| Response regulator receiver domain protein (CheY) [Anabaena
           variabilis ATCC 29413]
          Length = 140

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 68/117 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           LK+++IVEDN++N  L  D +  SGY      +G    +   + +PD+I++D++L ++ G
Sbjct: 17  LKRILIVEDNDINRMLLSDYLSYSGYHVQSLSDGSNFFKTIEKFQPDLILLDLKLPDVDG 76

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             + +QI++  E   IPVI V+ FA K D++R    G   Y  KPI+L+  +  I +
Sbjct: 77  YYLLEQIQQQQEFARIPVIVVSGFAFKVDQKRAIDLGARGYFVKPINLNALLIKISQ 133


>gi|254507539|ref|ZP_05119673.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Vibrio parahaemolyticus 16]
 gi|219549609|gb|EED26600.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Vibrio parahaemolyticus 16]
          Length = 929

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 68/115 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   NG++A++ A++   D+I+MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLISALLQERVERVITCTNGLDAVQQAQERHFDIILMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++IK+       PVIAVTA AM G+ +R+ K G + Y++KPI   +  + +  +
Sbjct: 727 CEEIKKTQLNANTPVIAVTAHAMSGERDRLLKAGMDDYLTKPIEEHVLQQVLMHW 781


>gi|149192072|ref|ZP_01870297.1| hybrid sensory histidine kinase BarA [Vibrio shilonii AK1]
 gi|148834097|gb|EDL51109.1| hybrid sensory histidine kinase BarA [Vibrio shilonii AK1]
          Length = 939

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 67/116 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       +   NG  ++E A++   D++ MDIQ+  + G+  
Sbjct: 667 VMAVDDNPANLKLITALLSERVESVVSCTNGQVSVEKAQEQHFDMVFMDIQMPHMDGVTA 726

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            K IKE  +  + PV+AVTA AM G+ +R+   G + Y++KPI   + ++ + K++
Sbjct: 727 CKLIKETQQNSQTPVVAVTAHAMTGERDRLLSEGMDDYLTKPIDEKMLLQVLNKWV 782


>gi|163802963|ref|ZP_02196850.1| sensor histidine kinase/response regulator [Vibrio sp. AND4]
 gi|159173253|gb|EDP58081.1| sensor histidine kinase/response regulator [Vibrio sp. AND4]
          Length = 931

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+ V+DN  N+KL   L++          NG +A+ LA ++K D+I+MDIQ+  + G+  
Sbjct: 670 VLAVDDNPANLKLISALLKERVETVTACSNGQQAVNLATENKYDLILMDIQMPLMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            + IKE    ++ PVIAVTA AM G+ +R+   G + Y++KPI   +  + +  +
Sbjct: 730 CQHIKESELNKDTPVIAVTAHAMAGERDRLLAAGMDDYLTKPIEEHVLQQVLVHW 784


>gi|304310368|ref|YP_003809966.1| putative response regulator receiver [gamma proteobacterium HdN1]
 gi|301796101|emb|CBL44306.1| putative response regulator receiver [gamma proteobacterium HdN1]
          Length = 1044

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 68/118 (57%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++V+DNE+N K+    +   GY A    NG EAL+   +    +I+MD Q+  + G 
Sbjct: 919  KRLLVVDDNEVNRKVACGFLRKLGYEADTAENGQEALDAVLEKDYGLILMDCQMPVMDGY 978

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E T+QIK   + + +P+IAVTA AM+GD ++    G + Y +KPI      E +  ++
Sbjct: 979  EATRQIKALPKGKYLPIIAVTANAMEGDRDKCLAAGMDDYTTKPIRREKLQELLNHWL 1036


>gi|242786807|ref|XP_002480878.1| two-component osmosensing histidine kinase (Bos1), putative
            [Talaromyces stipitatus ATCC 10500]
 gi|218721025|gb|EED20444.1| two-component osmosensing histidine kinase (Bos1), putative
            [Talaromyces stipitatus ATCC 10500]
          Length = 1309

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N KL   ++E   +      NG EAL+  +  + D+I+MD+Q+  + G E 
Sbjct: 1119 ILLAEDNEVNQKLAVKILEKCNHGVTVVGNGQEALDAVKNRRYDIILMDVQMPVMGGFEA 1178

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  ++TI K
Sbjct: 1179 TDKIREYERENNLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMIQTILK 1235


>gi|242786803|ref|XP_002480877.1| two-component osmosensing histidine kinase (Bos1), putative
            [Talaromyces stipitatus ATCC 10500]
 gi|218721024|gb|EED20443.1| two-component osmosensing histidine kinase (Bos1), putative
            [Talaromyces stipitatus ATCC 10500]
          Length = 1310

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N KL   ++E   +      NG EAL+  +  + D+I+MD+Q+  + G E 
Sbjct: 1119 ILLAEDNEVNQKLAVKILEKCNHGVTVVGNGQEALDAVKNRRYDIILMDVQMPVMGGFEA 1178

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  ++TI K
Sbjct: 1179 TDKIREYERENNLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMIQTILK 1235


>gi|157960457|ref|YP_001500491.1| multi-sensor hybrid histidine kinase [Shewanella pealeana ATCC
            700345]
 gi|157845457|gb|ABV85956.1| multi-sensor hybrid histidine kinase [Shewanella pealeana ATCC
            700345]
          Length = 1765

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 71/121 (58%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K++++VEDN++N ++  + +E  G +     NG  ALE       D+++MD Q+  + G 
Sbjct: 1421 KRILLVEDNDMNQEVATEFLEQVGVVLSIADNGQIALEKLAMQSFDLVLMDCQMPVMDGY 1480

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + T+++++   L  +PVIA+TA AM GD E     G   +I+KPI +S+    + +Y+G+
Sbjct: 1481 QATRELRKLPGLANLPVIAMTANAMAGDREMCLDAGMNDHIAKPIEVSLLYSRLLQYLGD 1540

Query: 123  A 123
             
Sbjct: 1541 G 1541



 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 5/121 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ +DN     + R  +E+ G++    ++G +A+E  +     V ++D Q+ E++GLE
Sbjct: 1280 RILVADDNATARDILRTTLESMGFVVDAVKSGSDAIERCQHTHYPVALIDWQMPEMNGLE 1339

Query: 64   ITKQIKEDSELQEIP--VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              + I  +   QE P  V+ V+A A     E+I + G   YI+KPIS S  ++ I   +G
Sbjct: 1340 AAEVIFAE---QETPPKVLIVSAHANAEFLEQIERSGIAGYITKPISASRLLDGIMSSLG 1396

Query: 122  E 122
            +
Sbjct: 1397 K 1397


>gi|46205622|ref|ZP_00048279.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 124

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++VED+E         ++  GY  +   +G   ++ AR  +PDVI++D+ L  + 
Sbjct: 1   MSGKILLVEDHEEIWDFLSRRLKRRGYEVVLAHDGEAGVQQARAAQPDVILLDMNLPILD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    + +K  ++ + IP+IA+TA AM GD ++  + GC+ Y  KPI     +  I   I
Sbjct: 61  GWSTARALKAAADTRAIPIIALTAHAMSGDRDKAIQAGCDDYHPKPIDFPKLLTQISTAI 120

Query: 121 GEA 123
           G  
Sbjct: 121 GSG 123


>gi|188583918|ref|YP_001927363.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|179347416|gb|ACB82828.1| response regulator receiver protein [Methylobacterium populi BJ001]
          Length = 133

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED+E         ++  GY  +   +G   ++ AR  +PDVI++D+ L  + G  
Sbjct: 13  KILLVEDHEEIWDFLSRRLKRRGYEVVLAHDGEAGVQQARAAQPDVILLDMNLPILDGWS 72

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             + +K  ++ + IP+IA+TA AM GD ++  + GC+ Y  KPI     +  I   IG A
Sbjct: 73  TARALKAATDTRAIPIIALTAHAMSGDRDKAIQAGCDDYHPKPIDFPKLLTQIGTAIGAA 132


>gi|110597007|ref|ZP_01385296.1| PAS:Response regulator receiver:GAF:ATP-binding region,
            ATPase-like:Histidine kinase A-like [Chlorobium
            ferrooxidans DSM 13031]
 gi|110341198|gb|EAT59663.1| PAS:Response regulator receiver:GAF:ATP-binding region,
            ATPase-like:Histidine kinase A-like [Chlorobium
            ferrooxidans DSM 13031]
          Length = 1407

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 3/120 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++++ ED  +N K+   ++   GY      NG EA+        D++IMD+Q+ E+ GLE
Sbjct: 1288 RLLLAEDTSINQKVVIGILGKLGYHIDVVVNGAEAVRALETTPYDLVIMDLQMPEMDGLE 1347

Query: 64   ITKQIKE-DSEL--QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+  DS +    IPVIA+TA  M+GD E     G   Y+SKPI  +I +ETI+K++
Sbjct: 1348 ATRIIRSPDSAVLNHRIPVIALTAHTMEGDRELCMHAGMTDYVSKPIDSAILVETIRKWL 1407



 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEAL-ELARQHKPD----VIIMDIQLQE 58
            +++IV+DN  N  + R    + G +  +   G + + EL R H+      + ++D+Q+ +
Sbjct: 1134 RILIVDDNATNRTVLRRQFLSWGAVVTELSGGAQVVAELKRAHESGEPYRLALIDMQMPD 1193

Query: 59   ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            + G  + + IK+D +L    ++ +++   K  EE +++ GC A +SKPI  S   +T   
Sbjct: 1194 MDGATLCRSIKDDEKLAPTVLVMMSSLGSKCSEEDLKRMGCSACLSKPILQSDLFDTFAA 1253

Query: 119  YI 120
             I
Sbjct: 1254 II 1255


>gi|317491023|ref|ZP_07949459.1| hsp90-like protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920570|gb|EFV41893.1| hsp90-like protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 913

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 6/119 (5%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQT---RNGMEALELARQHKPDVIIMDIQLQEIS 60
            VM V+DN  N+KL   L+   G +  QT    +G EA+  A++H+ D+I+MDIQ+ E+ 
Sbjct: 665 SVMAVDDNPANLKLIGALL---GELVEQTILCNSGEEAIAKAKEHRLDIILMDIQMPEMD 721

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           G+  ++ I++     + P+IAVTA A+ G+ ER+ + G + Y++KPI  ++  + + +Y
Sbjct: 722 GIRTSELIRKLPRYIDTPIIAVTAHAINGERERLLRAGMDDYLAKPIDENMLRQLLARY 780


>gi|229590478|ref|YP_002872597.1| putative two-component system histidine kinase/response regulator
            fusion [Pseudomonas fluorescens SBW25]
 gi|229362344|emb|CAY49246.1| putative two-component system histidine kinase/response regulator
            fusion [Pseudomonas fluorescens SBW25]
          Length = 1184

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G + +  RNG EA++ L      D+++MD+ + E+ G
Sbjct: 1060 RKILLVDDDVRNIFALTSALEHKGAVVVIGRNGREAIDKLNEVDDIDLVLMDVMMPEMDG 1119

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T  I++D   +++P+IAVTA AMK D+ER    G   Y++KPI L      I+ ++
Sbjct: 1120 YEATALIRQDPRWKKLPIIAVTAKAMKDDQERCLAAGSNDYLAKPIDLDRLFSLIRVWL 1178



 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 794 ILVVEDEPNFARILFDLAHELGYHCLVAHGADEGYSLAEEYIPDAILLDMRLPDHSGLTV 853

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP +
Sbjct: 854 LQRLKEHANTRHIPVHVISV------EDRVEAAMHMGAIGYAVKPTT 894



 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            +K+V++VED++L       LI              EAL+L R +  D +I+D++L ++ G
Sbjct: 913  VKRVLLVEDDDLQRDSIARLIGDDDIEITAVGFAQEALDLLRTNAYDCMIIDLKLPDMLG 972

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
             E+ K++  +      PVI  T   +  DEE
Sbjct: 973  NELLKRMATEDICSFPPVIVYTGRNLTRDEE 1003


>gi|145300355|ref|YP_001143196.1| hybrid sensory histidine kinase BarA [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853127|gb|ABO91448.1| two-component system hybrid sensor histidine kinase/response
           regulator [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 903

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 69/116 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+ V+DN  N+KL   +++      +  +NG EA+ LA+    D+I MDIQ+  + G+ 
Sbjct: 666 KVLAVDDNAANLKLIAAMLKEMVSQVVVCKNGKEAVRLAQSQPFDIIFMDIQMPIMDGIS 725

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            T+ I+  S   E P++AVTA A+ G+ ER+ + G + Y++KPI  S+  + I  +
Sbjct: 726 ATQAIRSQSLNTETPIVAVTAHAIPGERERLIRQGMDDYLAKPIDESMLAQLITDF 781


>gi|153003908|ref|YP_001378233.1| PAS/PAC sensor hybrid histidine kinase [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027481|gb|ABS25249.1| PAS/PAC sensor hybrid histidine kinase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 664

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 70/116 (60%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++I+EDN    +   +++E  G+     R+G   + LAR+ +PDVI+ DI L ++ G 
Sbjct: 547 RSILIIEDNVDGAQSLAEILELHGHRVRIARDGSSGIALARKVQPDVILCDIGLPDVDGY 606

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           E+ + ++ D  L++  ++A++ +A + D +R R  G +A+++KP+ L   M T+ K
Sbjct: 607 EVARTLRSDGPLRDTRLVALSGYAQQEDRQRARDAGFDAHLAKPVDLEALMSTLAK 662


>gi|110834879|ref|YP_693738.1| sensor histidine kinase/response regulator [Alcanivorax borkumensis
           SK2]
 gi|110647990|emb|CAL17466.1| sensor histidine kinase/response regulator [Alcanivorax borkumensis
           SK2]
          Length = 937

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 74/123 (60%), Gaps = 3/123 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ ED+ L+ K+ R ++   G  A    NG EALELA + + D+I+MD ++ E+ G E
Sbjct: 795 KLLVAEDHYLSQKVIRGMLGKLGLKADIASNGKEALELASKTRYDLILMDCEMPEMDGFE 854

Query: 64  ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+E  + Q+   +P++A+TA  ++  ++R    G  A++ KP+ L++   T+ ++ 
Sbjct: 855 ATRMIREHEQKQDLPAVPIVALTAHILREHKDRSLAAGMNAHLPKPVELNVLRNTLVRFT 914

Query: 121 GEA 123
             A
Sbjct: 915 QSA 917


>gi|254567876|ref|XP_002491048.1| Histidine kinase osmosensor that regulates a MAP kinase cascade
           [Pichia pastoris GS115]
 gi|238030845|emb|CAY68768.1| Histidine kinase osmosensor that regulates a MAP kinase cascade
           [Pichia pastoris GS115]
 gi|328352426|emb|CCA38825.1| Hybrid signal transduction histidine kinase J [Pichia pastoris CBS
           7435]
          Length = 1113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 10/126 (7%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N KL   ++E  G+      NG+EA    ++++ DV++MD+Q+  + G E
Sbjct: 865 NILLAEDNLINQKLAVRILEKHGHKVEVVENGLEAFNAVKKNRYDVVLMDVQMPIMGGFE 924

Query: 64  ITKQIKEDSELQE---------IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
            T  I+ D E +           P+IA+TA AM GD ER  K   + Y+SKP+  ++ ++
Sbjct: 925 ATANIR-DWERKSNPVDVLGFRTPIIALTAHAMLGDRERCLKAQMDEYLSKPLKPTVLLQ 983

Query: 115 TIKKYI 120
           TI K I
Sbjct: 984 TISKCI 989


>gi|254226238|ref|ZP_04919831.1| sensor histidine kinase/response regulator [Vibrio cholerae V51]
 gi|125621211|gb|EAZ49552.1| sensor histidine kinase/response regulator [Vibrio cholerae V51]
          Length = 555

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/112 (37%), Positives = 66/112 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A   + D+I+MDIQ+  + G+  
Sbjct: 295 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAPSRQFDIILMDIQMPHMDGVTA 354

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +
Sbjct: 355 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVL 406


>gi|37676245|ref|NP_936641.1| response regulator [Vibrio vulnificus YJ016]
 gi|37200786|dbj|BAC96611.1| response regulator [Vibrio vulnificus YJ016]
          Length = 378

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+DN  N  L   L+ +S Y  L   NGM+A+   + H PD++++DI + E+ G E+
Sbjct: 8   VLVVDDNSENRSLLNGLL-SSTYRVLIATNGMQAISACQSHLPDIVLLDIMMPEMDGYEV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             Q+K D     IP+I +TA +   DE++    G   YI KPIS  I M  ++ ++
Sbjct: 67  CLQLKADPRTAHIPIIFLTAKSQIEDEQKGFDVGAVDYILKPISPPILMSRVRNHL 122


>gi|78356567|ref|YP_388016.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78218972|gb|ABB38321.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 544

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 3/117 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+ +N KL     E  G+       G+E L+   Q   D+I+MDIQ+ ++ G+E
Sbjct: 419 RILLAEDDIINRKLAVFFFEKMGHAVRAVGTGIEVLQALAQEPFDLILMDIQMPDMDGVE 478

Query: 64  ITKQIKEDSE---LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            T+ I+         +IP+IA+TA AMKGD+ER    G + Y+SKP+     M+ I+
Sbjct: 479 ATRAIRSAQGGRIRSDIPIIAMTAHAMKGDKERFLTAGMDGYVSKPVDFPALMQRIE 535



 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 2/106 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           L +V+ ++D     +      E  GY  L+  +G E +E A + +PDVI++D+++  I G
Sbjct: 10  LPRVLAIDDESSVRQSLAIFFEDCGYEVLEASDGYEGIETALRERPDVILVDLRMPGIDG 69

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           +E+ +++   SEL + P IAV+   +        + G   +ISKP+
Sbjct: 70  IEVLRRLS--SELPDTPAIAVSGVGVLEQALEAMRSGAWDFISKPV 113


>gi|88859369|ref|ZP_01134009.1| sensor histidine kinase with multiple PAS/PAC and a response
           regulator receiver domain [Pseudoalteromonas tunicata
           D2]
 gi|88818386|gb|EAR28201.1| sensor histidine kinase with multiple PAS/PAC and a response
           regulator receiver domain [Pseudoalteromonas tunicata
           D2]
          Length = 901

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++I EDN +N+ +   +++ +    +   NG+EA+EL +QH+PD+I+MDIQ+ E+ G+
Sbjct: 780 KTILIAEDNAINIIIVTAMLKPTNATLIIANNGLEAIELTQQHQPDLILMDIQMPEMDGI 839

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
              + IK       IP++A+TA A   D+    K G   Y++KP+     M  I K + 
Sbjct: 840 TACQHIKAFDPF--IPIVALTANAFAEDKILYAKVGFNGYLAKPLDSDQLMSVIHKALN 896


>gi|320158374|ref|YP_004190752.1| response regulator [Vibrio vulnificus MO6-24/O]
 gi|319933686|gb|ADV88549.1| response regulator [Vibrio vulnificus MO6-24/O]
          Length = 378

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+DN  N  L   L+ +S Y  L   NGM+A+   + H PD++++DI + E+ G E+
Sbjct: 8   VLVVDDNSENRSLLNGLL-SSTYRVLIATNGMQAISACQSHLPDIVLLDIMMPEMDGYEV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             Q+K D     IP+I +TA +   DE++    G   YI KPIS  I M  ++ ++
Sbjct: 67  CLQLKADPRTAHIPIIFLTAKSQIEDEQKGFDVGAVDYILKPISPPILMSRVRNHL 122


>gi|241763479|ref|ZP_04761532.1| multi-sensor hybrid histidine kinase [Acidovorax delafieldii 2AN]
 gi|241367320|gb|EER61651.1| multi-sensor hybrid histidine kinase [Acidovorax delafieldii 2AN]
          Length = 1618

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 69/117 (58%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDNELN  +  +L+  +G+      NG  AL+L      DV++MD+Q+  + G  
Sbjct: 1266 QVLLVEDNELNQMVAVELLRDAGFAVDVAGNGERALQLLDGKNYDVVLMDMQMPVMDGET 1325

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T++++ D    ++PVIA+TA AM+ D +R    G   +++KPI  S+    + ++I
Sbjct: 1326 ATRRLRADPRHADLPVIAMTANAMEADRQRCFAAGMNDHVAKPIEPSVLWAALARWI 1382



 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR----QHKP-DVIIMDIQLQ 57
            ++V++V+DN     +  +++++ G+   Q  +G+EALE  R    Q KP  ++++D  + 
Sbjct: 1116 RRVLVVDDNHTAATVLSEMLQSMGFHVDQAYSGLEALETLRQATQQQKPYGLLLLDWHMP 1175

Query: 58   EISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             + G+E+   I+    L EIP ++ VTA+  +      R  G EA + KP++ S+  +T+
Sbjct: 1176 GMDGVELAGHIRSMG-LAEIPQMLMVTAYGREDVMRAARAQGIEAVLIKPVNASVLFDTL 1234

Query: 117  KKYIGEA 123
             + +  A
Sbjct: 1235 MQPLENA 1241


>gi|86606801|ref|YP_475564.1| response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86555343|gb|ABD00301.1| response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 124

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 70/120 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VED     +L  D + + GY  +   N  EAL+  R  KPDV++ D+ ++ +SGLE
Sbjct: 3   KVLVVEDVASERQLISDYLRSEGYQVVAVANAQEALQQIRNDKPDVVLTDLVMEGMSGLE 62

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QIK++ E Q++PV+A T+   + D+    K G + Y++KP +    +  +K  +  A
Sbjct: 63  LCRQIKKNPETQKLPVVACTSKNQELDKLWGMKQGIDLYLTKPFTREDILRAVKSVVLSA 122


>gi|289624688|ref|ZP_06457642.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            aesculi str. NCPPB3681]
 gi|330865810|gb|EGH00519.1| sensor histidine kinase/response regulator [Pseudomonas syringae pv.
            aesculi str. 0893_23]
          Length = 1986

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 70/112 (62%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            VM+V+D+    K+   L+E  G   L  ++G++A+ L ++H PD++++DI++  + G E+
Sbjct: 1867 VMVVDDSVTVRKVTSRLLERHGMHVLTAKDGIDAMTLLQEHTPDIMLLDIEMPRMDGFEV 1926

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
              QI++D +L+E+P+I +T+ +     +R    G   Y+SKP   ++ +E+I
Sbjct: 1927 ASQIRQDEQLKELPIIMITSRSGHKHRDRAMAVGVNEYLSKPYQETVLLESI 1978


>gi|254302065|ref|ZP_04969423.1| sensor histidine kinase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148322257|gb|EDK87507.1| sensor histidine kinase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 623

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 69/117 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I ED E      + L+ET     +   NG+EAL L +  K D+I +DI +  + G++
Sbjct: 502 KILIAEDAEETRDFLKVLLETQLVEVICVENGLEALNLLKSEKFDLIFLDISMPVMDGVQ 561

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               IK +   ++IPV+A+TA A+ G +E+    G +AYI+KPI+ S+    ++K++
Sbjct: 562 TVTTIKANDNFKDIPVVALTAHAIIGYKEKYLNYGFDAYITKPINDSVLFSCLEKFV 618


>gi|320589282|gb|EFX01744.1| two-component osmosensing histidine kinase [Grosmannia clavigera
            kw1407]
          Length = 1307

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN +N +L   ++E   ++     NG EA+E  +    DVI+MD+Q+  + G+E 
Sbjct: 1118 ILLAEDNTVNQRLAVKILEKYHHVVTVVGNGEEAVEAVKHKNFDVILMDVQMPVMGGVEA 1177

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E      +Q  P+IA+TA AM GD E+  +   + Y+SKP+  +  +ETI K
Sbjct: 1178 TSKIREYERSGNVQRTPIIALTAHAMMGDREKCLQAQMDEYLSKPLQQNHLIETILK 1234


>gi|189466203|ref|ZP_03014988.1| hypothetical protein BACINT_02573 [Bacteroides intestinalis DSM
           17393]
 gi|189434467|gb|EDV03452.1| hypothetical protein BACINT_02573 [Bacteroides intestinalis DSM
           17393]
          Length = 885

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 76/121 (62%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++I ED + N  L + ++    ++  + ++GMEA+ +  +  PD+I+MD+++  + G
Sbjct: 767 MKTILIAEDTDSNYILIKAILGKEYHLE-RAKDGMEAVNMFVELNPDIILMDMKMPNLGG 825

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L+ T+ I+E S   +IP+IA+TAFA   D +   + GC  +++KP +  +  ETIKK+I 
Sbjct: 826 LDATRIIRELS--PDIPIIALTAFAYDHDRKAALEVGCNDFLTKPFTQEVLKETIKKWIR 883

Query: 122 E 122
           E
Sbjct: 884 E 884


>gi|152994395|ref|YP_001339230.1| multi-sensor hybrid histidine kinase [Marinomonas sp. MWYL1]
 gi|150835319|gb|ABR69295.1| multi-sensor hybrid histidine kinase [Marinomonas sp. MWYL1]
          Length = 1310

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            KV++VEDNE+N +L  +L+  SG +     NG EA+ L      D I+MD Q+  + G  
Sbjct: 945  KVLLVEDNEINRELAEELLSRSGILFTSATNGQEAISLLGSDDFDCILMDCQMPIMDGYT 1004

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             TK+I+  ++ ++IP+IA+TA  M  D +  +  G   +I+KPI       T++ ++
Sbjct: 1005 ATKKIRTMTQYKDIPIIAMTANVMPEDIKYAKASGMNDHIAKPIHFETMFNTLRTWV 1061



 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 63/128 (49%), Gaps = 10/128 (7%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEA------LELARQHKPDVIIMDIQ 55
           L +VM+V+DN    ++ +  +E  G       +G EA      L+ + Q  P ++++D +
Sbjct: 794 LSQVMVVDDNNSAREVLKASVEALGLSCHTCSSGHEAIQYIASLKASSQPYP-LMLIDWK 852

Query: 56  LQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGC--EAYISKPISLSIFM 113
           + E+ G++  K I  ++   + P+  +   A + D+ R    G    AY++KP++ S   
Sbjct: 853 MPELDGIDTCKAILAETR-DDTPLTIIMVTAHRQDDARKAGYGLPISAYLTKPVTTSSLF 911

Query: 114 ETIKKYIG 121
           + I +  G
Sbjct: 912 DQIIQLCG 919


>gi|312960833|ref|ZP_07775338.1| sensor histidine kinase/response regulator [Pseudomonas fluorescens
            WH6]
 gi|311284491|gb|EFQ63067.1| sensor histidine kinase/response regulator [Pseudomonas fluorescens
            WH6]
          Length = 1165

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            +K+++V+D+  N+      +E  G +    RNG EA+E L      D+++MD+ + E+ G
Sbjct: 1041 RKILLVDDDVRNIFALTSALEHKGAVVAIGRNGREAIERLNEIDDIDLVLMDVMMPEMDG 1100

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T  I++D   +++P+IAVTA AMK D+ER    G   Y++KPI L      I+ ++
Sbjct: 1101 YEATALIRQDPRWKKLPIIAVTAKAMKDDQERCLAAGSNDYLAKPIDLDRLFSLIRVWL 1159



 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED     ++  DL    GY  L      E   LA ++ PD I++D++L + SGL +
Sbjct: 775 ILVVEDEPNFARILFDLAHELGYQCLVAHGADEGYSLAEEYIPDAILLDMRLPDHSGLTV 834

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108
            +++KE +  + IPV  ++       E+R+      G   Y  KP +
Sbjct: 835 LQRLKEHANTRHIPVHVISV------EDRVEAAMHMGAIGYAVKPTT 875



 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED++L       LI              EAL+L R +  D +I+D++L ++ G
Sbjct: 894 VKRVLLVEDDDLQRDSIARLIGDDDIEITAVGFAQEALDLLRNNVYDCMIIDLKLPDMLG 953

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ K++  +      PVI  T   +  DEE
Sbjct: 954 NELLKRMATEDICSFPPVIVYTGRNLTRDEE 984


>gi|261210923|ref|ZP_05925213.1| hypothetical protein VCJ_001178 [Vibrio sp. RC341]
 gi|260839898|gb|EEX66498.1| hypothetical protein VCJ_001178 [Vibrio sp. RC341]
          Length = 1324

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 72/118 (61%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L++ +G   +   NG EAL+   +   D+++MD+Q+  + G+
Sbjct: 992  QTLLLVEDNEVNQEVALGLLQETGLSVIVANNGQEALQRLAEKSFDLVLMDMQMPVMDGI 1051

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              TK+I+ D   + +P++A+TA AM  D E   + G   ++SKPI +  F   +K+++
Sbjct: 1052 TATKKIRADERWKTLPIVAMTANAMATDIEHCTQAGMNDHLSKPIDVDKFYHVLKQFL 1109



 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 55/114 (48%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+V++V+DN+    +   L+    +  +   NG EAL   +Q   D++ +D  +  ++G+
Sbjct: 852 KRVLVVDDNDSARNILDSLLTAMRFNVVTVSNGFEALSEIQQKPFDMLFVDWNMPGMNGI 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           E+  ++K     ++     VTA+      +       ++ I KP++ S  ++ I
Sbjct: 912 ELLTRVKSLGLREQTKCFLVTAYGRDIHLDSENSKLVDSLIVKPVNPSNLLDAI 965


>gi|255534918|ref|YP_003095289.1| PAS/PAC domain protein [Flavobacteriaceae bacterium 3519-10]
 gi|255341114|gb|ACU07227.1| PAS/PAC domain protein [Flavobacteriaceae bacterium 3519-10]
          Length = 915

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           K++I EDN +N+ L +  +       + +  ++G EA+E  R+  PD+I+MDIQ+  ++G
Sbjct: 788 KILIAEDNAINLLLTKTYLSDILPHALIIDAKDGNEAIEQYRKESPDLILMDIQMPNLNG 847

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E TK+I+   +  EIP+IA+TA ++ G++E+  + G   +++KP+      + I+K+ G
Sbjct: 848 IEATKKIRTIEKDIEIPIIALTAGSLPGEKEKCLQAGMSDFLTKPLLKQTLSDMIRKWFG 907

Query: 122 E 122
           +
Sbjct: 908 K 908



 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-ARQHKPDVIIMDIQLQEIS 60
           +K+V+IV+DNE N K+ + ++E      ++  +G++AL L   + + DVIIMD  +  + 
Sbjct: 643 IKRVLIVDDNENNRKILKRMLERKNIEVVECDSGLKALLLIMDKSEFDVIIMDYHMPIMD 702

Query: 61  GLEITKQIKE 70
           G+E  +++K+
Sbjct: 703 GIETIRKMKD 712


>gi|254787382|ref|YP_003074811.1| signal transduction histidine kinase [Teredinibacter turnerae T7901]
 gi|237686080|gb|ACR13344.1| signal transduction histidine kinase [Teredinibacter turnerae T7901]
          Length = 1547

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 74/124 (59%), Gaps = 7/124 (5%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP----DVIIMDIQLQEI 59
            +V++VEDN +N  + R +++  G +     NG+EAL+  +  +      +++MD Q+ E+
Sbjct: 1263 RVLLVEDNPVNQDVARMMLDDVGVVVTTAGNGVEALDALQSAQQWDLYSLVLMDCQMPEM 1322

Query: 60   SGLEITKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             G E T+ I   K     ++IP+IA+TA AMKGD+ER    G + YISKPI   +  + +
Sbjct: 1323 DGYETTRSIRAGKAGEIYKKIPIIAMTANAMKGDKERCFAAGMDDYISKPIDPQVLEDRL 1382

Query: 117  KKYI 120
            +K++
Sbjct: 1383 RKWL 1386



 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 64/120 (53%), Gaps = 6/120 (5%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHK-----PDVIIMDIQLQ 57
            K V+++EDN+   +L    +++ G       +G + L   +  K     PDV+++D  L 
Sbjct: 1109 KSVLLIEDNKSVRELVYRWLDSWGANVFAAEDGAQGLARCQDLKALNNLPDVVLIDQYLP 1168

Query: 58   EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            + +G ++ KQ+       ++PV+ ++  A +G+ ++    G   Y++KP++ +  +E++K
Sbjct: 1169 DQTGCDLAKQMLGIEGCADLPVLILSRIA-EGELQKFCDAGARGYVAKPLTRAGLVESVK 1227


>gi|27366537|ref|NP_762064.1| response regulator [Vibrio vulnificus CMCP6]
 gi|27358103|gb|AAO07054.1|AE016808_74 Response regulator [Vibrio vulnificus CMCP6]
          Length = 378

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+DN  N  L   L+ +S Y  L   NGM+A+   + H PD++++DI + E+ G E+
Sbjct: 8   VLVVDDNSENRSLLNGLL-SSTYRVLIATNGMQAISACQSHLPDIVLLDIMMPEMDGYEV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             Q+K D     IP+I +TA +   DE++    G   YI KPIS  I M  ++ ++
Sbjct: 67  CLQLKADPRTAHIPIIFLTAKSQIEDEQKGFDVGAVDYILKPISPPILMSRVRNHL 122


>gi|256424548|ref|YP_003125201.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM 2588]
 gi|256039456|gb|ACU63000.1| multi-sensor hybrid histidine kinase [Chitinophaga pinensis DSM 2588]
          Length = 1203

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIA--LQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            +++I EDN +NM L   +I      +  ++ +NG EA+E   QH PD+I MDIQ+  ++G
Sbjct: 1078 RILIAEDNPINMLLATTIIRKIAPASQIVEAKNGREAVESCEQHLPDMIFMDIQMPIVNG 1137

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T +I+E S    IP+IA+TA  +KG+ ++    G + +++KP   S  +   +K++
Sbjct: 1138 YEATGRIRELSPHVHIPIIALTAGNVKGERDKCLAAGMDDFVTKPFVESNLVAVFEKWL 1196



 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 66/116 (56%), Gaps = 10/116 (8%)

Query: 1    MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE--LARQHKPDVIIMDIQLQE 58
            +++ V+IV+DN  N  + + +++       +  NG+EAL+  + +QH  DVI+MD  +  
Sbjct: 932  LVRDVLIVDDNINNRTILKTMLQLKNIRFDEAANGIEALQFLMTKQHY-DVILMDYHMPV 990

Query: 59   ISGLEITKQIKED-SELQEIPVIAVTAFAMKGDEERIRKGGCEAYIS----KPISL 109
            + G+E  ++I+E+ SEL + P  A+       D+E++ K   E ++S    KPI +
Sbjct: 991  MDGIETIRKIRENFSELDKDP--AIILLHSSADDEKLIKACEELHVSQRLLKPIKI 1044


>gi|254415056|ref|ZP_05028819.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196178203|gb|EDX73204.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 2724

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 72/119 (60%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +K++IV+D   N  + R ++E  G+   +  NG E LE AR+ +PD+I++DI +  + G 
Sbjct: 2519 RKILIVDDRWENCAVLRSVLEPIGFEIQEAENGQEGLENAREWQPDLILVDIVMPVMDGH 2578

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            ++T+++++ SE    P+IA++A A   +     + GC  +I+KPI+    ++ ++ Y+ 
Sbjct: 2579 QMTQELRQISEFNTTPIIAISANAFATNRVESLEAGCTDFITKPIATEELLQKVQVYLN 2637


>gi|117618541|ref|YP_856712.1| PAS [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559948|gb|ABK36896.1| PAS [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 1323

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/117 (31%), Positives = 70/117 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN +N ++  +L+  SG +     NG EALE   QH  D+I+MDIQ+  + G  
Sbjct: 964  RVLLVEDNAINREVVLELLNNSGLVIETAVNGQEALERVSQHAFDLILMDIQMPLMDGYS 1023

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+     +++P++A+TA A + D +     G   +I+KP++ +   E +++++
Sbjct: 1024 ATRAIRALPGWEQVPILALTASAFEEDRKACESAGMNDFIAKPVTPAKLFEALQQWL 1080


>gi|312887628|ref|ZP_07747221.1| PAS/PAC sensor hybrid histidine kinase [Mucilaginibacter paludis
           DSM 18603]
 gi|311299894|gb|EFQ76970.1| PAS/PAC sensor hybrid histidine kinase [Mucilaginibacter paludis
           DSM 18603]
          Length = 822

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++I EDN++N KL R  +E  G ++    NG+E L    Q   D+I+MD+Q+ E+ G E
Sbjct: 697 NILIAEDNDINQKLVRRALEKLGLLSDLVFNGLEVLHAVEQKNYDLILMDVQMPEMDGYE 756

Query: 64  ITKQIKEDSELQEI-PV-IAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ +++  E   + PV IA+TA A+ GD+ER    G + YISKP  +    E I ++ 
Sbjct: 757 ATRLVRKKYESASMRPVIIAMTANALTGDKERAMSEGMDDYISKPFKIHDLKEKIDQWF 815



 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 4/118 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK +I++DN  N+K+ +   E     A    +  +A +  R    D+ I+D+ + E  G+
Sbjct: 555 KKALILDDNLTNLKILKKQFEYWEMDASIFNHHEQAFQAMRNEHFDLAIIDMFMPEKDGI 614

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           ++ + IK     Q IP+I  ++         +      A ++KP+      E IKK I
Sbjct: 615 DVARLIKSTFPGQNIPLILFSSAGYITMHNTLDHQLFAAILNKPVK----YEHIKKTI 668


>gi|215433455|gb|ACJ66693.1| sensor histidine kinase/response regulator [Myxococcus fulvus HW-1]
          Length = 2476

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            KKV++V+D+  N+     ++E  G   +   NG  A+E+  QH+  D+++MD+ + E+ G
Sbjct: 2356 KKVLVVDDDMRNIFALTSVLENHGMQVVFAENGRAAIEMLEQHRDVDIVLMDVMMPEMDG 2415

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E  + I++D +   +P+IAVTA A+K D E+    G   Y+ KP+     +E I+ ++
Sbjct: 2416 YETMRAIRKDLKYSSLPIIAVTAKALKDDREKCMAAGASDYLPKPVDTDKLLELIRLWV 2474



 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++++ED+    ++   +    G+ AL    G   L +A + +P  I +DIQL  + G  +
Sbjct: 2089 LLLIEDDVKFARIMVQMAREKGFKALVATRGDTGLSMANEFQPHAITLDIQLPVVDGWSV 2148

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
              ++K     + IPV  ++      D+ +    G   Y++KP+S
Sbjct: 2149 LDRLKRSPRTRHIPVHVISVM----DKHQGNSQGAFGYLTKPVS 2188


>gi|218245995|ref|YP_002371366.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8801]
 gi|218166473|gb|ACK65210.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8801]
          Length = 1193

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 71/114 (62%), Gaps = 1/114 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++V+D   N +L       + +  LQ ++G+EA+  A+ + PDVI+MD+++  + GLE 
Sbjct: 972  ILVVDDVISNRELIEGYFANTHHRILQAKDGIEAINQAQFYHPDVILMDLRMPRMDGLES 1031

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            +K +KED   Q+IP++ +TA + K DEE++ K  C   + KPIS S   ET+K 
Sbjct: 1032 SKILKEDPLTQDIPIVIITA-SSKKDEEQLLKTFCVTCLYKPISRSELFETLKN 1084


>gi|257059046|ref|YP_003136934.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8802]
 gi|256589212|gb|ACV00099.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8802]
          Length = 1193

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 71/114 (62%), Gaps = 1/114 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++V+D   N +L       + +  LQ ++G+EA+  A+ + PDVI+MD+++  + GLE 
Sbjct: 972  ILVVDDVISNRELIEGYFANTHHRILQAKDGIEAINQAQFYHPDVILMDLRMPRMDGLES 1031

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            +K +KED   Q+IP++ +TA + K DEE++ K  C   + KPIS S   ET+K 
Sbjct: 1032 SKILKEDPLTQDIPIVIITA-SSKKDEEQLLKTFCVTCLYKPISRSELFETLKN 1084


>gi|330501096|ref|YP_004377965.1| multi-sensor hybrid histidine kinase [Pseudomonas mendocina NK-01]
 gi|328915382|gb|AEB56213.1| multi-sensor hybrid histidine kinase [Pseudomonas mendocina NK-01]
          Length = 1160

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            +++++V+D+  N+      +E  G      RNG EAL   R+H   D+++MD+ + E+ G
Sbjct: 1036 RRLLLVDDDVRNIFALSSALEQKGASVEVARNGHEALAKLREHDDIDLVLMDVMMPEMDG 1095

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T+QI+ +   + +P+IAVTA AMK D+ER R+ G   Y++KPI L      I+ ++
Sbjct: 1096 YEATRQIRLEERWKNLPIIAVTAKAMKDDQERCRQVGANDYLAKPIDLDRLFSLIRVWM 1154



 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 3/116 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++V++VED     ++  DL    GY  L      E LELARQ++PD I++D++L + SGL
Sbjct: 768 RRVLVVEDEVRFARILFDLAHELGYACLVATCADEGLELARQYRPDAILLDMRLPDGSGL 827

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            + +++K+D++ + IPV  V+   ++   E     G   Y  KP S     E   K
Sbjct: 828 SVLQRLKDDAQTRHIPVHVVS---VEDQSEAALHLGAVGYALKPTSRDQLKEVFGK 880



 Score = 37.0 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 44/91 (48%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++VED+ L       LI              EALE  R    D +I+D++L ++ G
Sbjct: 889 VKRVLLVEDDPLQRDSVARLIGDEDIEITAVALAGEALEKLRTTVFDCMIIDLKLPDMQG 948

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEE 92
            E+ +++ E+      PVI  T   +  DEE
Sbjct: 949 NELLRRMAEEDICSFPPVIVYTGRNLTRDEE 979


>gi|197116475|ref|YP_002136902.1| PilZ domain-containing response regulator [Geobacter bemidjiensis
           Bem]
 gi|197085835|gb|ACH37106.1| response regulator, PilZ domain-containing protein [Geobacter
           bemidjiensis Bem]
          Length = 227

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 70/120 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D ++ +++ +D  + +    L  R+G+EALE+ +  KPD+I MD+Q+  + 
Sbjct: 1   MNPTILLVDDLQMFLEIEKDFFKYAQVNLLTARDGIEALEVVKNRKPDLIFMDLQMPRMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G +  + I+ D EL   PV+ +++ +   D+E     GC  ++SKP     F+E  +++I
Sbjct: 61  GAQCCRAIRSDPELASTPVVLISSSSDAKDKEMSLAAGCNYFLSKPAGRDRFLEIAREFI 120


>gi|78223839|ref|YP_385586.1| GAF sensor hybrid histidine kinase [Geobacter metallireducens GS-15]
 gi|78195094|gb|ABB32861.1| GAF sensor hybrid histidine kinase [Geobacter metallireducens GS-15]
          Length = 1216

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
            KKV+IV+D+  N+     ++     I L+  NG EALE L  +   DV++MDI + E+ G
Sbjct: 1095 KKVLIVDDDMRNIFSLSSVLAEKKMIVLEAENGREALERLNGEPGIDVVLMDIMMPEMDG 1154

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
               T+ I++D     +P+IA+TA AMKGD +   K G   YI KP+     +  ++ ++
Sbjct: 1155 FAATRAIRKDPRFARLPIIALTAKAMKGDRDECLKAGASDYIQKPVDADKLLSLLRVWL 1213



 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++I+ED+     +  D++   G+ A+   +G   + LA  + P  I++D+ L  I G 
Sbjct: 827 RSILIIEDDLSFAAILMDMVRDRGFPAMVAGDGESGIALADHYLPSAIVLDVMLPHIDGW 886

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            + K +K+    + IPV  +T      D ++    G   +++KP++
Sbjct: 887 GVMKCLKDSLRTRHIPVHFLTCLE---DRQKALTMGAIGFVTKPVN 929



 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            ++K++IVED+    K    L+         T  G EA+ L      D I++D+ L ++SG
Sbjct: 948  VRKLLIVEDDRNEAKSMEALLGVRDVAITVTATGSEAMGLLAVEPFDCIVLDLGLSDMSG 1007

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAM-KGDEERIRK 96
             E+ ++I+   E + IPVI  +   + + DE+R+R 
Sbjct: 1008 FEVLEKIQSLDESRRIPVIIHSGRDLSREDEQRLRN 1043


>gi|313681453|ref|YP_004059191.1| integral membrane sensor hybrid histidine kinase [Sulfuricurvum
           kujiense DSM 16994]
 gi|313154313|gb|ADR32991.1| integral membrane sensor hybrid histidine kinase [Sulfuricurvum
           kujiense DSM 16994]
          Length = 1088

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++ EDN +N KL R  +E  G       NG+EA E  +    D+I MDIQ+  + G+E 
Sbjct: 787 ALVAEDNIINQKLIRRTLEDLGLEITIANNGLEAFEKRKNGSFDIIFMDIQMPVLDGIEA 846

Query: 65  TKQI---KEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           T++I   +ED     IP+IA+TA A+KGD ER    G + Y +KP+  S  +  +  ++ 
Sbjct: 847 TQEILDFEEDYGQNHIPIIALTANALKGDRERFMSAGMDEYTTKPLVRSEIISLLNNFLS 906

Query: 122 E 122
            
Sbjct: 907 H 907


>gi|119490652|ref|ZP_01623057.1| hybrid sensory kinase [Lyngbya sp. PCC 8106]
 gi|119453817|gb|EAW34974.1| hybrid sensory kinase [Lyngbya sp. PCC 8106]
          Length = 1064

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 69/118 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+DN +N KL   L+   G+   +  NG EA+E+ +  +P +I MD+++  + G  
Sbjct: 860 KLLIVDDNLINRKLLIQLLNPFGFELKEATNGKEAIEIWQDWEPHLIWMDMRMPVMDGYA 919

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T QIK  ++ Q   +IA+TA  ++ D   I   GC+ ++ KP   SI  E ++K++G
Sbjct: 920 ATTQIKTTTKGQATAIIAITASVLEEDRNIILSAGCDDFVRKPFQESIIFEMLEKHLG 977


>gi|239905424|ref|YP_002952163.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795288|dbj|BAH74277.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
           RS-1]
          Length = 904

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 75/123 (60%), Gaps = 9/123 (7%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP------DVIIMDIQLQE 58
           V++VED+++N    + ++   G+      NG EAL+      P      D+I+MDIQ+  
Sbjct: 769 VLVVEDDDMNRMAAQRMLVKLGFTVHTACNGQEALDFLAGQTPQAQPSVDLILMDIQMPV 828

Query: 59  ISGLEITKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMET 115
           + GLE T++I+E+++ +     P+IA+TA+AM GD ER  + G + +++KP+ ++  ++ 
Sbjct: 829 MDGLEATRRIRENADGRFDPLTPIIALTAYAMAGDRERFLQAGLDDHLAKPVKVAEMLDA 888

Query: 116 IKK 118
           +K+
Sbjct: 889 MKR 891


>gi|86610175|ref|YP_478937.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558717|gb|ABD03674.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 124

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 69/117 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VED     +L  D + + GY  +   N  EAL+  R  KPDV++ D+ ++ +SGLE
Sbjct: 3   KVLVVEDVASERQLISDYLRSEGYQVVAVANAQEALQQIRNDKPDVVLTDLVMEGMSGLE 62

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + +QIK++ E Q++PV+A T+   + D+    K G + Y++KP +    +  +K  +
Sbjct: 63  LCRQIKKNPETQKLPVVACTSKNQELDKLWGMKQGIDLYLTKPFTREDILRAVKSVV 119


>gi|330972643|gb|EGH72709.1| response regulator receiver [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 121

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 67/115 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D +   IPVI +T    + D+   ++ G   Y++KP+     M+T+
Sbjct: 61  FQATRQLTKDPDTTNIPVIMITTKDQETDKVWGKRQGARDYLTKPVDEETLMKTL 115


>gi|239905516|ref|YP_002952255.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
 gi|239795380|dbj|BAH74369.1| two-component hybrid sensor and regulator [Desulfovibrio magneticus
            RS-1]
          Length = 1265

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 73/121 (60%), Gaps = 3/121 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            KV++VED ++N+   + L++  GY  +   +G +A+E+    + D+++MDI++  + G++
Sbjct: 1143 KVLLVEDEDINVVTVKALLKKHGYAVIVATDGQQAIEVLSGKEIDLVLMDIRMPIMDGVQ 1202

Query: 64   ITKQIKEDSELQE---IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T  I+     Q+   +P+IA+TA+AM GD E+    G   YI+KP+ +    E IK+ +
Sbjct: 1203 ATLAIRSGKAGQDKKDVPIIAMTAYAMTGDREKFLAAGMNDYIAKPVDIQDLKEVIKRVL 1262

Query: 121  G 121
            G
Sbjct: 1263 G 1263


>gi|328873441|gb|EGG21808.1| histidine kinase [Dictyostelium fasciculatum]
          Length = 1361

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 74/125 (59%), Gaps = 2/125 (1%)

Query: 1    MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
            M  ++++ EDN +N +L   L+E  G+      NG++A+  +     D+I+MD+Q+  +S
Sbjct: 1127 MAAEILLAEDNIVNQRLAVRLLERFGHRVTLAENGLQAVAASETKDFDLILMDVQMPHMS 1186

Query: 61   GLEITK--QIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            G E T   +I+E +  +  P+IA+TA A++ D E+  + G + Y+SKPI+       I+K
Sbjct: 1187 GFEATNTIRIREKALNKHTPIIAMTAHALQKDREKCLEAGMDDYLSKPINADQLRSQIEK 1246

Query: 119  YIGEA 123
            ++G A
Sbjct: 1247 FLGAA 1251



 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 7/112 (6%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR-----QHKPDVIIMDIQLQ 57
            +  +I++DN+   K+   ++   G  A    +   A  L R     +H  + I MD QL 
Sbjct: 981  RNTLIIDDNKTTRKVLLQMLGEYGISADSADSAETAFRLLRAASLRKHPYECIFMDAQLN 1040

Query: 58   EISGLEITKQIKEDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPIS 108
               G  + + IK+D+ + +  + + +     +GD E  R      Y++KPIS
Sbjct: 1041 GRDGFLVAEAIKQDTTIGDASIFMMICGSGQRGDPEN-RSSVISGYLTKPIS 1091


>gi|326424323|ref|NP_762902.2| CheY-like receiver [Vibrio vulnificus CMCP6]
 gi|319999709|gb|AAO07892.2| FOG: CheY-like receiver [Vibrio vulnificus CMCP6]
          Length = 1328

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 72/121 (59%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L+  +    +   NG  A+E    H  D+++MD+Q+  + G+
Sbjct: 991  QTLLLVEDNEVNQEVAIGLLNGTNLNIITADNGKLAIEALEHHPIDLVLMDMQMPVMDGI 1050

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              TK I+E +E   +P++A+TA AM+ D ER  + G   +++KPI++    + + +Y+  
Sbjct: 1051 TATKAIRERAEWATLPIVAMTANAMQSDVERCHEAGMNDHVAKPINVHNLYQVLSQYLSA 1110

Query: 123  A 123
            +
Sbjct: 1111 S 1111



 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ +IV+DN+    +   L+    + A    NG EAL+  RQ   D++ +D  +  ++GL
Sbjct: 852 KRALIVDDNDSARNILMTLLSAMQFDAKAVSNGFEALDELRQGAFDMVFVDWNMPGMNGL 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +   ++  L E     VTA+  +   +       ++ I KP++ S  ++ I    G
Sbjct: 912 ELLQTAHQERLLAETKNFLVTAYGREISMDENSSKLVDSLIVKPVNPSNLLDAIMDSYG 970


>gi|78186193|ref|YP_374236.1| PAS/PAC sensor hybrid histidine kinase [Chlorobium luteolum DSM
           273]
 gi|78166095|gb|ABB23193.1| PAS/PAC sensor hybrid histidine kinase [Chlorobium luteolum DSM
           273]
          Length = 967

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED+ +N  +   +++  GY       G  ALE  R+   D++ MD Q+ E+ G E 
Sbjct: 712 VLVVEDSMVNRNVAVSMLKKLGYSPDVAVCGTAALEAMRRKAYDLVFMDCQMPEMDGYEA 771

Query: 65  TKQIKEDSELQ---EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           T+ I+ED +L+    +PV+A+TA AMKGD E+    G + YI+KP+  S F   + +Y
Sbjct: 772 TRHIREDEDLKGSRSVPVVAMTANAMKGDREKCINAGMDDYIAKPLRKSDFKTIMDRY 829


>gi|332993627|gb|AEF03682.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase with PAS/PAC sensor(s)
           [Alteromonas sp. SN2]
          Length = 701

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 71/118 (60%), Gaps = 1/118 (0%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +KV+IV+D  +N+ +    + +   + + T N +EAL L + HKPD+II+DI + + SG 
Sbjct: 6   QKVLIVDDEPVNIVIIESAVSSLANV-ISTSNSLEALHLVQIHKPDLIILDISMPKRSGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +I + IK D  L+EIP++ VT+F    +E +    G   +I+KPI + I    +K ++
Sbjct: 65  DICRAIKADLGLREIPILFVTSFTDSENERKALALGAIDFIAKPIDIEICRMRVKNHL 122


>gi|157369035|ref|YP_001477024.1| hybrid sensory histidine kinase BarA [Serratia proteamaculans 568]
 gi|157320799|gb|ABV39896.1| multi-sensor hybrid histidine kinase [Serratia proteamaculans 568]
          Length = 906

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       L   +G EAL+LAR +  D+I+MDIQ+  I G+  
Sbjct: 666 VMAVDDNPANLKLIGTLLAEQVEKTLLCESGEEALQLARDNVLDLILMDIQMPNIDGIRT 725

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           ++ I++       P++AVTA A+ G+ E + + G + Y++KPI  ++    + +Y
Sbjct: 726 SELIRQLPHHNSTPIVAVTAHAVSGEREHLLQAGMDDYLAKPIDEAMLTRVLARY 780


>gi|83648468|ref|YP_436903.1| response regulator [Hahella chejuensis KCTC 2396]
 gi|83636511|gb|ABC32478.1| Response regulator containing a CheY-like receiver domain and a
           GGDEF domain [Hahella chejuensis KCTC 2396]
          Length = 120

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IV+D+E ++K    ++  + Y  +  R+G EA+  AR+ KP +I+MDI + ++ 
Sbjct: 1   MNKKVLIVDDSETDLKHLEQIVSGAAYQTVTARSGEEAISKARKEKPSLILMDIIMGDMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           G    ++I +D EL +IPV+ V++   K D     K G +A +SKP
Sbjct: 61  GFSTCREIAQDPELSKIPVVFVSSKNQKVDHIWAAKQGAKALVSKP 106


>gi|87308947|ref|ZP_01091085.1| Response regulator receiver:ATP-binding
           region,ATPase-like:Histidine kinase A, N-terminal:Hpt
           [Blastopirellula marina DSM 3645]
 gi|87288290|gb|EAQ80186.1| Response regulator receiver:ATP-binding
           region,ATPase-like:Histidine kinase A, N-terminal:Hpt
           [Blastopirellula marina DSM 3645]
          Length = 837

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++ EDN +N KL   L+E  G++     +G +A+E  ++   D+++MD+Q+  + G+
Sbjct: 564 RRILLAEDNLVNQKLAVLLLEKRGHLVTVASDGKQAVEAWKEGGFDLVLMDVQMPILDGM 623

Query: 63  EITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T +I+  E      IP+IA+TA AMKGD ER  + G + Y++KPI+     + I + +
Sbjct: 624 AATTEIRRHETRTALRIPIIAMTAHAMKGDRERCLEAGMDGYVTKPINAQALYDAIDEAL 683


>gi|330446946|ref|ZP_08310597.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491137|dbj|GAA05094.1| hybrid sensory histidine kinase, in two-component regulatory system
           with UvrY [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 931

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 66/117 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       +    G +A+E A+    D+I MDIQ+ E+ G+  
Sbjct: 670 VMAVDDNPANLKLISALLGERVETVITATGGKKAVEYAQSKAFDLIFMDIQMPEMDGVTA 729

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            ++I E +  +  PVIAVTA AM G+ ER+   G + Y++KP+   I  + + K+I 
Sbjct: 730 CQKIHETALNKNTPVIAVTAHAMAGERERLINAGMDDYLTKPLEEHILQQILAKWIA 786


>gi|284050985|ref|ZP_06381195.1| two component transcriptional regulator, LuxR family protein
           [Arthrospira platensis str. Paraca]
          Length = 222

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 5/108 (4%)

Query: 5   VMIVEDNELNMKL-FRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++V D++L  +L   D +E SGY  +   NG EAL+L  +H+P +I+ DI + E+ G E
Sbjct: 4   TLLVVDDDLGTRLSISDYLEMSGYFVISATNGQEALQLVEKHQPHLIVTDIAMPEMDGFE 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKPISL 109
           + K+++     + +PVI +TA      EERIR  + GC+ Y+ KP  L
Sbjct: 64  LVKRVRSQPGFRLLPVIFLTAHT--STEERIRGYQLGCDNYLPKPFEL 109


>gi|186684087|ref|YP_001867283.1| response regulator receiver protein [Nostoc punctiforme PCC 73102]
 gi|186466539|gb|ACC82340.1| response regulator receiver protein [Nostoc punctiforme PCC 73102]
          Length = 140

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++++++VED+ LN  L  D +   GY       G        + KPD++++D++L +I G
Sbjct: 17  VRRILLVEDHYLNRLLLSDYLSYCGYDVQSLSEGSTFFSTIDKFKPDLMLLDLKLPDIDG 76

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             + KQ+++  +L +IP+I V+AFA K D+E     G   Y  KP+ L   + TI
Sbjct: 77  YSLLKQVQQKPDLSKIPIIVVSAFAFKADQELAMSLGARRYFVKPLKLKDLILTI 131


>gi|117925683|ref|YP_866300.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609439|gb|ABK44894.1| multi-sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1788

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 67/118 (56%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VED+ +N  L R+++  +    +   +G  AL+L ++   D+I MDIQ+  + G  
Sbjct: 1331 RVLLVEDHPINQALAREMLSLAKLQVITADHGQHALDLLQEASVDLIFMDIQMPVMDGFS 1390

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             T+ I+ D   Q IP+IA+TA AM  D ++   GG   ++ KPI   +    I +++G
Sbjct: 1391 ATQAIRADPRWQHIPIIAMTAHAMADDRQKCLDGGMNDHLGKPIDPPLLFAKITQWLG 1448



 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 63/113 (55%), Gaps = 8/113 (7%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGY---IALQTRNGMEALELA-RQHKP-DVIIMDIQLQE 58
            +V++V+DN+   ++ + ++++ GY   +A +   G+  +E A +Q +P D+I+MD  + +
Sbjct: 1182 RVLVVDDNQTVREVLQRMLKSFGYWVDLAAEGPTGVALVESALQQGQPYDLILMDWHMPQ 1241

Query: 59   ISGLEITKQIK--EDSELQEIPV-IAVTAFAMKGDEERIRKGGCEAYISKPIS 108
            + GL+ ++QI+  +    Q  PV I   A+  +     + + G   ++ KP +
Sbjct: 1242 MDGLQASEQIRHLQGVRAQRTPVMIMAAAYGQEDSHTAVSEPGFAGFLEKPTT 1294


>gi|331213871|ref|XP_003319617.1| protein-histidine kinase [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
 gi|309298607|gb|EFP75198.1| protein-histidine kinase [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
          Length = 1640

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++ EDN +N K+   L++  G+      NG  A+E A ++  D+++MD+ +  + GLE
Sbjct: 1476 KILLAEDNHVNQKVATKLLDMGGHKVEVVDNGELAVEAATKNTYDLVLMDVSMPTMGGLE 1535

Query: 64   ITKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
             T  I+   +D+ L+ +P+IA+TA AM GD ER    G + Y++KP+
Sbjct: 1536 ATSLIRKHEQDNHLERVPIIALTAHAMLGDRERCIDAGMDDYVTKPL 1582


>gi|78356986|ref|YP_388435.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78219391|gb|ABB38740.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 647

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 68/116 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VEDN++N ++ ++L+E  G       +G+EAL L   +  D+I MDIQ+  + GLE 
Sbjct: 294 VLVVEDNKINRQIAKELLEGVGVRVTLAGDGLEALALVENYDFDLIFMDIQMPRMDGLEA 353

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            ++I++    ++ PV+A+TA A+ GD E   + G   +I+KPI        +  +I
Sbjct: 354 CRRIRQLQHKKQPPVVAMTAHALAGDRETSLRAGMNDHITKPIDPDELYAALANWI 409


>gi|288939999|ref|YP_003442239.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
 gi|288895371|gb|ADC61207.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
          Length = 1023

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 71/117 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDNE+N ++   L++ +G       NG EALE    +  D+++MD+Q+  + GLE
Sbjct: 670 RILVAEDNEINQEVILQLLQATGARVTLAENGREALEQVCANAYDLVLMDVQMPVMDGLE 729

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+  +E +E+P++A+TA A + D  +  + G   +++KPI      ET+ +++
Sbjct: 730 ATRAIRARAEYRELPILAMTANAFESDRRQCIEAGMNDHLAKPIEPERLTETLARWL 786


>gi|156743020|ref|YP_001433149.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
 gi|156234348|gb|ABU59131.1| response regulator receiver protein [Roseiflexus castenholzii DSM
           13941]
          Length = 124

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++I ED+ +N  +    +   G+      +G EAL LAR   PD+I++D+ L + +G E
Sbjct: 2   RLLIAEDDAMNRDMIARRMRWEGFAITLANDGAEALHLARTEMPDLILLDMGLPKQNGWE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           + +Q+K D   + IP+IA+TA+ +  D  +    GC+AY  KPI     ++ I 
Sbjct: 62  VARQLKSDDATRHIPIIALTAYVLPEDRIKGLASGCDAYELKPIDFERLIQRIH 115


>gi|255034075|ref|YP_003084696.1| PAS/PAC sensor hybrid histidine kinase [Dyadobacter fermentans DSM
            18053]
 gi|254946831|gb|ACT91531.1| PAS/PAC sensor hybrid histidine kinase [Dyadobacter fermentans DSM
            18053]
          Length = 1287

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 73/119 (61%), Gaps = 2/119 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            KV+I ED+++NM L + ++         ++  NG EA+E  R ++PD++ MDIQ+ E++G
Sbjct: 1166 KVLIAEDHKINMLLVKSMLAKILVNSELIEAANGREAIEAFRANRPDIVFMDIQMPEMNG 1225

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E T++I+       +P+IA+TA  + G+ E+  + G + Y++KP+       +I+K++
Sbjct: 1226 YEATREIRRAEGRSRVPIIALTAGTVVGEREKCIEAGMDDYLTKPVLKDTLEASIRKWL 1284



 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 63/118 (53%), Gaps = 18/118 (15%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL-ARQHKPDVIIMDIQLQEIS 60
            ++K++IV+DN    ++ +D++      +    +G EA  L +   K DV+++D Q+    
Sbjct: 1017 IEKILIVDDNAHAGQILKDMLGNKRIASDYIPSGEEAYALLSSGKKYDVVLIDGQMPGWD 1076

Query: 61   GLEITKQIKEDSELQEIPVI---------AVTAFAMKGDEERIRKGGCEAYISKPISL 109
            G+E T++I++ S+  + P+I         A+TAF   G+E  IR      ++ KP+ +
Sbjct: 1077 GIETTRKIRKLSQGNKQPIILLNDSFDDEALTAF---GNELNIRH-----FLVKPVKI 1126


>gi|254461523|ref|ZP_05074939.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodobacterales bacterium HTCC2083]
 gi|206678112|gb|EDZ42599.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 227

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 69/113 (61%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED     ++    +E  GY  LQ  +G E L LAR++ PD+I++D  L E+SG+E+
Sbjct: 6   ILVVEDEAAQREVLSYNLEAEGYRVLQGESGDEGLLLARENVPDLIVLDWMLPEMSGIEV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            +Q+K D+  + IP+I ++A +   D+ R  + G + Y++KP S+   M  +K
Sbjct: 66  CRQVKSDTTTKAIPIIMLSARSEDVDKVRGLETGADDYVAKPYSVKELMARVK 118


>gi|148262999|ref|YP_001229705.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter uraniireducens Rf4]
 gi|146396499|gb|ABQ25132.1| response regulator receiver modulated PilZ sensor protein
           [Geobacter uraniireducens Rf4]
          Length = 233

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 70/119 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D  + ++L +  ++ S    L   +G+EAL++ R  +P +I MD+ +  ++G E
Sbjct: 4   KILLVDDVNMFVELQKGFLKQSSVTILTAGDGVEALKVCRAERPALIFMDLHMPNMNGAE 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
               IK D  L+ IPVI +T+   + D+    K GC+ +++KP+   +++E  + Y+ E
Sbjct: 64  CCAAIKADPTLKSIPVIMMTSAGKEDDKSLCIKAGCDNFLTKPLDRQLYLELARSYLPE 122


>gi|310823304|ref|YP_003955662.1| sensor protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396376|gb|ADO73835.1| Sensor protein [Stigmatella aurantiaca DW4/3-1]
          Length = 1062

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 71/118 (60%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VEDN LN ++    +  +G       +G EA+E   Q   + ++MD Q+  + G E
Sbjct: 791 RILLVEDNRLNQEVALHFLRRAGLKVDVAAHGAEAIERLEQGAYEAVLMDCQMPVMDGYE 850

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T++I+  ++  ++P+IA+TA A++GD ER  K G   ++SKPI ++   +T+ ++I 
Sbjct: 851 ATRRIRSKAQFAQLPIIAMTANALEGDRERSLKSGMNDHLSKPIDVNHLYQTLGRWIA 908



 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 70/127 (55%), Gaps = 13/127 (10%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LAR--QHKP-DVIIMDIQLQEI 59
           +V++V+DN     +   +  + G++A    +G +ALE LAR    +P  ++++D  +  +
Sbjct: 641 RVLVVDDNASARHILSAMFASFGFVAHAVADGRQALEELARGMDGQPYHLMLIDYHMPGL 700

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERI-----RKGGCEAYISKPISLSIFME 114
            G+E ++++ +  E   +P + + +     DE  I     ++ G +AY++KP++ S  ++
Sbjct: 701 DGIETSRRLLQRKESVPLPTVIMASM----DERPIVVQQAQEAGIQAYVNKPVTASTLLD 756

Query: 115 TIKKYIG 121
            +++ +G
Sbjct: 757 AVQRALG 763


>gi|269960026|ref|ZP_06174403.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835325|gb|EEZ89407.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 1187

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 70/118 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VED+ +N +L RD++   G +     +G EALEL  +H  D ++MD Q+  + G 
Sbjct: 863 KRILVVEDHRINQELVRDVLVNVGCVVQIANHGKEALELLVKHSFDAVLMDCQMPIMDGY 922

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + T+ I++  +L E+P+IA+TA  +  DE++    G    + KPI + +   T+ K +
Sbjct: 923 QATQNIRQKLKLIELPIIALTANTLAEDEKKALDAGMNCVLHKPIDIPLLKSTLAKLL 980


>gi|261415659|ref|YP_003249342.1| histidine kinase [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261372115|gb|ACX74860.1| histidine kinase [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302326073|gb|ADL25274.1| sensory box histidine kinase/response regulator [Fibrobacter
            succinogenes subsp. succinogenes S85]
          Length = 1260

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 67/112 (59%), Gaps = 5/112 (4%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP---DVIIMDIQLQEI 59
            KKV++VEDNE+N ++  DL+E +G+      NG EA+EL RQ  P   D+++MD+Q+  +
Sbjct: 1136 KKVLLVEDNEMNRQIACDLLEDNGFEVFTAENGEEAVELVRQSVPGQYDIVLMDVQMPVM 1195

Query: 60   SGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             G   T+ I+         IP+IA+TA A + D +     G + +ISKPI+ 
Sbjct: 1196 DGYAATRAIRVLPAGYQSRIPIIAMTANAFEEDRKAALDAGMDEHISKPINF 1247


>gi|218440091|ref|YP_002378420.1| response regulator receiver protein [Cyanothece sp. PCC 7424]
 gi|218172819|gb|ACK71552.1| response regulator receiver protein [Cyanothece sp. PCC 7424]
          Length = 152

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 63/104 (60%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
             ++ ++D+E N+ +   ++   GY  +    G E L +A+ ++P +I++DI L  ++G 
Sbjct: 18  SSILAIDDDEDNLIIISYVLSAMGYPFMTATRGDEGLLIAQNYQPSLILLDILLPGMNGF 77

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKP 106
           E+   +K++   + IP+IAVT  A   D++RI + GCE Y+SKP
Sbjct: 78  EVITHLKQNPSAKNIPIIAVTGLAFPEDKKRILEAGCEDYLSKP 121


>gi|168701006|ref|ZP_02733283.1| multi-sensor hybrid histidine kinase [Gemmata obscuriglobus UQM
           2246]
          Length = 741

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 65/108 (60%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++V++V+DN    +    L+E  G       +G+EA+ELA + +PD+I MD+ +  ++GL
Sbjct: 622 RRVLVVDDNRDAAESLAMLLELLGNEVHIGHDGLEAVELAERLRPDIIFMDVGMPRLNGL 681

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS 110
           E T QI+       + +IA+T +  + D ER R+ GC A++ KP+ L+
Sbjct: 682 EATTQIRTRPWAAPVVIIALTGWGQESDRERTRQAGCSAHLVKPVQLA 729


>gi|71735539|ref|YP_272783.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483602|ref|ZP_05637643.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289624691|ref|ZP_06457645.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298484997|ref|ZP_07003094.1| twitching motility protein PilH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556092|gb|AAZ35303.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298160407|gb|EFI01431.1| twitching motility protein PilH [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320321971|gb|EFW78067.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330924|gb|EFW86898.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330865807|gb|EGH00516.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330872149|gb|EGH06298.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330886267|gb|EGH20168.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330984645|gb|EGH82748.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009677|gb|EGH89733.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D++   IPVI +T    + D+   ++ G   Y++KP+     M+T+
Sbjct: 61  FQATRQLTKDADTNMIPVIMITTKDQETDKVWGKRQGARDYLTKPVDEETLMKTL 115


>gi|37677132|ref|NP_937528.1| sensory box sensor histidine kinase/response regulator [Vibrio
            vulnificus YJ016]
 gi|37201677|dbj|BAC97498.1| sensory box sensor histidine kinase/response regulator [Vibrio
            vulnificus YJ016]
          Length = 1328

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 72/121 (59%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L+  +    +   NG  A+E    H  D+++MD+Q+  + G+
Sbjct: 991  QTLLLVEDNEVNQEVAIGLLNGTNLNIITADNGKLAIEALENHPIDLVLMDMQMPVMDGI 1050

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              TK I+E +E   +P++A+TA AM+ D ER  + G   +++KPI++    + + +Y+  
Sbjct: 1051 TATKAIRERAEWATLPIVAMTANAMQSDVERCHEAGMNDHVAKPINVHNLYQVLSQYLSA 1110

Query: 123  A 123
            +
Sbjct: 1111 S 1111



 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ +IV+DN+    +   L+    + A    NG EAL+  RQ   D++ +D  +  ++GL
Sbjct: 852 KRALIVDDNDSARNILMTLLSAMQFDAKAVSNGFEALDELRQSTFDMVFVDWNMPGMNGL 911

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +   ++  L E     VTA+  +   +       ++ I KP++ S  ++ I    G
Sbjct: 912 ELLQTAHQERLLAETKNFLVTAYGREISMDENSSKLVDSLIVKPVNPSNLLDAIMDSYG 970


>gi|294637606|ref|ZP_06715886.1| sensor protein GacS [Edwardsiella tarda ATCC 23685]
 gi|291089236|gb|EFE21797.1| sensor protein GacS [Edwardsiella tarda ATCC 23685]
          Length = 934

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 67/115 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L+       L   +G EAL  AR    D+I+MDIQ+ E+ G+  
Sbjct: 665 VMAVDDNPANLKLIGALLGEQVQHTLLCHSGEEALAAARDRPLDIILMDIQMPEMDGIRT 724

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           T+++++       P+IAVTA A+ G+ ER+ + G + Y++KPI  +   + + +Y
Sbjct: 725 TERLRQQPIHAHTPIIAVTAHALNGERERLLRAGMDDYLAKPIDENRLRQLLTRY 779


>gi|253700345|ref|YP_003021534.1| histidine kinase [Geobacter sp. M21]
 gi|251775195|gb|ACT17776.1| histidine kinase [Geobacter sp. M21]
          Length = 1361

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 68/117 (58%), Gaps = 1/117 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN  N+   R ++  S  + ++  +G   L LAR   P +I++D+ L  + GL +
Sbjct: 1238 VLVVEDNPDNLVTLRAVLGGSCRL-VEATDGESGLLLARTGSPSLILLDMHLPGMDGLAV 1296

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + +K+D+    IPV+A+TA AM GD E + K GC AY+SKP       E + K++ 
Sbjct: 1297 LRHLKQDNATALIPVVALTASAMAGDREMLMKAGCVAYVSKPYQPEELQELVIKFVA 1353



 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V++V+D+   + L    +  +G+  L   NG +AL LAR  KP  I +DI + ++ G 
Sbjct: 836 RSVLVVDDDPEAVSLIASHLSQAGFETLTALNGADALRLARAKKPFAITLDIMMPDMDGW 895

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +++K+  E  +IPV+ V+   +  D       G    I+KP+S    MET  K  G
Sbjct: 896 EVMRELKDQRETADIPVVIVS---LSDDRATGIALGAVGVIAKPVSREQLMETFTKLAG 951



 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++IVED+E      R  +E++G+       G  AL   + H PD II+D+ + E+ G +
Sbjct: 1090 RILIVEDSEAATIQLRFALESAGFCVDAVSGGRHALSYLQTHVPDGIILDLMMPEVDGFD 1149

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMK-GDEERIR 95
            + K ++     +++PV+ +TA  +  G+ +R+R
Sbjct: 1150 VLKAVRVSRLTEKVPVMVMTAKTLSPGEHDRLR 1182



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 51/101 (50%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++V+D+E +      L +  G   L   +G +ALELA   +PD+I +D+ +  + G  +
Sbjct: 957  VLVVDDSEHDRFFIASLFKEMGMDVLLAEDGAQALELAAADQPDLITLDLLMPRMDGAAV 1016

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISK 105
              +++ +     IPV+ +T+  +   E      G  A +SK
Sbjct: 1017 LDKLRSNQSTAAIPVVVITSKDLSSTELERLSCGVSAILSK 1057


>gi|163853612|ref|YP_001641655.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|218532472|ref|YP_002423288.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240141034|ref|YP_002965514.1| putative response regulator receiver [Methylobacterium extorquens
           AM1]
 gi|254563548|ref|YP_003070643.1| response regulator receiver [Methylobacterium extorquens DM4]
 gi|163665217|gb|ABY32584.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|218524775|gb|ACK85360.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240011011|gb|ACS42237.1| putative response regulator receiver [Methylobacterium extorquens
           AM1]
 gi|254270826|emb|CAX26831.1| putative response regulator receiver [Methylobacterium extorquens
           DM4]
          Length = 124

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++VED+E         ++  GY  +   +G   ++ AR  +PDVI++D+ L  + 
Sbjct: 1   MSGKILLVEDHEEIWDFLSRRLKRRGYEVVLAHDGEAGVQQARAAQPDVILLDMNLPILD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    + +K  ++ + IP+IA+TA AM GD ++  + GC+ Y  KPI     +  I   I
Sbjct: 61  GWSTARALKAATDTRAIPIIALTAHAMSGDRDKAIQAGCDDYHPKPIDFPKLLTQIGTAI 120

Query: 121 G 121
           G
Sbjct: 121 G 121


>gi|320159220|ref|YP_004191598.1| CheY-like receiver [Vibrio vulnificus MO6-24/O]
 gi|319934532|gb|ADV89395.1| CheY-like receiver [Vibrio vulnificus MO6-24/O]
          Length = 1320

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 72/121 (59%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            + +++VEDNE+N ++   L+  +    +   NG  A+E    H  D+++MD+Q+  + G+
Sbjct: 983  QTLLLVEDNEVNQEVAIGLLNGTNLNIITADNGKLAIEALENHPIDLVLMDMQMPVMDGI 1042

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              TK I+E +E   +P++A+TA AM+ D ER  + G   +++KPI++    + + +Y+  
Sbjct: 1043 TATKAIRERAEWATLPIVAMTANAMQSDVERCHEAGMNDHVAKPINVHNLYQVLSQYLSA 1102

Query: 123  A 123
            +
Sbjct: 1103 S 1103



 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K+ +IV+DN+    +   L+    + A    NG EAL+  RQ   D++ +D  +  ++GL
Sbjct: 844 KRALIVDDNDSARNILMTLLSAMQFDAKAVSNGFEALDELRQSTFDMVFVDWNMPGMNGL 903

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +   ++  L E     VTA+  +   +       ++ I KP++ S  ++ I    G
Sbjct: 904 ELLQTAHQERLLAETKNFLVTAYGREISMDENSSKLVDSLIVKPVNPSNLLDAIMDSYG 962


>gi|313157128|gb|EFR56558.1| putative polar-differentiation response regulator DivK [Alistipes
           sp. HGB5]
          Length = 127

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 67/118 (56%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++I ED E N KL  ++I    Y  L  +NG EA++ A +HKPD I+MDI++  + G+E 
Sbjct: 13  ILIAEDVESNYKLL-EIILKKEYDLLWAKNGREAVDFAMEHKPDAILMDIKMPVMDGIEA 71

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            K+I+  +   E+PVI  TA+A   D     + GC  +I+KP+        + KY+ +
Sbjct: 72  LKEIRRHT--AELPVIMQTAYAFDTDRRTAEEAGCNGFITKPVMPRELKMYLDKYLNK 127


>gi|66043756|ref|YP_233597.1| response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254463|gb|AAY35559.1| Response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 66/116 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            + T+Q+ +D +   IPVI +T      D+   ++ G   Y++KP+     M+T+ 
Sbjct: 61  FQATRQLTKDPDTTNIPVIMITTKDQDTDKVWGKRQGARDYLTKPVDEETLMKTLN 116


>gi|72384217|ref|YP_293571.1| response regulator receiver:ATP-binding region,
           ATPase-like:histidine kinase A, N-terminal [Ralstonia
           eutropha JMP134]
 gi|72123560|gb|AAZ65714.1| Response regulator receiver:ATP-binding region,
           ATPase-like:Histidine kinase A, N-terminal [Ralstonia
           eutropha JMP134]
          Length = 404

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTR-NGMEALELARQHKPDVIIMDIQLQEIS 60
           +  ++ VEDN  N+KL   LI     + L T   G   +ELAR   PD+I+MDI L +I+
Sbjct: 274 MHTLLYVEDNPANLKLVEQLIARRPDVRLLTAVTGTLGVELARTSLPDLILMDIHLPDIN 333

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           G+E  + ++ED +   IPVIA++A AM  D E+  K G   Y++KPI L+ F++ +
Sbjct: 334 GIEALRLLREDPKTARIPVIALSANAMPRDIEKGIKAGFFRYLTKPIKLNEFIDAL 389


>gi|332994626|gb|AEF04681.1| putative signal transduction histidine kinase two-component system
           protein [Alteromonas sp. SN2]
          Length = 936

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 73/116 (62%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++ EDN++N  +  D++ + G    + +NGMEA+E A++H  DVI+MD Q+  + GL 
Sbjct: 816 RVLLAEDNDVNADIVMDMLGSVGVKRFRAKNGMEAIEAAKRHAFDVILMDYQMPVMDGLT 875

Query: 64  ITKQIKEDSELQE-IPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            +K I++ ++ ++ + +IA+TA A   D+      G  A++SKPI   + +++I +
Sbjct: 876 ASKHIRQQAKNKDKVIIIALTANAYADDKAACLAAGMNAHLSKPIRKQVLIDSIAR 931


>gi|108763375|ref|YP_634852.1| sensor histidine kinase/response regulator [Myxococcus xanthus DK
            1622]
 gi|108467255|gb|ABF92440.1| sensor histidine kinase/response regulator [Myxococcus xanthus DK
            1622]
          Length = 2478

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 69/119 (57%), Gaps = 1/119 (0%)

Query: 3    KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKP-DVIIMDIQLQEISG 61
            KKV++V+D+  N+     ++E  G   +   NG  A+E+  QH+  D+++MD+ + E+ G
Sbjct: 2358 KKVLVVDDDMRNIFALTSVLENHGMQVVFAENGRAAIEMLEQHRDVDIVLMDVMMPEMDG 2417

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             E  + I++D +   +P+IAVTA A+K D E+    G   Y+ KP+     +E I+ ++
Sbjct: 2418 YETMRAIRKDLKYSSLPIIAVTAKALKDDREKCMAAGASDYLPKPVDTDKLLELIRLWV 2476



 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            ++++ED+    ++   +    G+ AL    G   L +A + +P  I +DIQL  + G  +
Sbjct: 2091 LLLIEDDVKFARIMVQMAREKGFKALVATRGDTGLSMANEFQPHAITLDIQLPVVDGWSV 2150

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108
              ++K +   + IPV  ++      D+ +    G   Y++KP+S
Sbjct: 2151 LDRLKRNPRTRHIPVHVISVM----DKNQGNSQGAFGYLTKPVS 2190


>gi|309389129|gb|ADO77009.1| Hpt sensor hybrid histidine kinase [Halanaerobium praevalens DSM
           2228]
          Length = 1043

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 76/116 (65%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDN++N ++  +L+           NG +A+   ++ K D+++MD+Q+ E+ G + 
Sbjct: 703 ILVVEDNKINQQVAVELLRKVKAQVEIADNGKKAIAKIKKQKFDLVLMDVQMPEMDGYQA 762

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           TK+I++D  L ++P+IA+TA A+KG +E+    G + YI+KP+ L  F  T+KK++
Sbjct: 763 TKKIRQDLNLNKLPIIAMTANAIKGHKEKALAMGMDDYITKPLDLDQFFSTLKKWL 818



 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 64/122 (52%), Gaps = 6/122 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61
           KKV+IV+D ++N      +I+  G         + A+E + ++   D+I MD ++ ++ G
Sbjct: 561 KKVLIVDDIKMNRDFLIGVIDQFGLEVEAASGALLAIEKIKKESDYDLIFMDWKMPDLDG 620

Query: 62  LEITKQIKEDSELQEIP-VIAVTAFAMKGDE-ERIRKGGCEAYISKPISLSIFMETIKKY 119
           ++    IKE+  L+ +P +I +TAF   G E E  ++   +  + KPI+ SI    +   
Sbjct: 621 IKAATIIKEELNLELVPKIILITAF---GKELENSQQKNIDKILFKPITQSILFNALLNS 677

Query: 120 IG 121
           +G
Sbjct: 678 LG 679


>gi|254480146|ref|ZP_05093394.1| response regulator receiver domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039708|gb|EEB80367.1| response regulator receiver domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 676

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 69/117 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ +DNE N+ L   +IE+ G       NG EA+  A     D+++MDI + +  GLE
Sbjct: 422 KILLADDNETNLILGAMIIESLGIEVATAHNGTEAVAAALNDHYDLVLMDIHMPDFDGLE 481

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T++I+E   ++ +P++A+TA A + ++ER   GG   Y++KPI     M  + K++
Sbjct: 482 ATRRIREMKAIEVLPIVALTALAYEKEKERCIGGGMNGYLTKPIVKQELMNELGKWL 538


>gi|260223390|emb|CBA33909.1| DNA-binding response regulator mtrA [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 135

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++ VED     +L R  +E  G+  L+  +G E L + R+H+PD+++MDI++  IS
Sbjct: 1   MKKTILSVEDGVGLRRLIRMTLEYMGFHVLEAADGEEGLSMVREHRPDLVLMDIRMPGIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL  +  ++ D EL  IP++ +TA     D       G +AY+ KP      +E + + I
Sbjct: 61  GLTASAVMRSDPELSSIPIVMLTAAGATSDIAAGMASGAKAYLVKPFQPVELIEVVTRLI 120

Query: 121 GEA 123
            EA
Sbjct: 121 EEA 123


>gi|144900266|emb|CAM77130.1| Response regulator receiver [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 124

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 71/123 (57%), Gaps = 1/123 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+IVEDN +NMKL    +  +GY  +++ +G   +EL       V++MDIQL + S
Sbjct: 1   MSGTVVIVEDNAMNMKLLDQALTIAGYRTVKSPDGENLVELTADGA-QVVLMDIQLPKRS 59

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IPV+AVTAFA           G    I+KPIS+   ++ +++Y 
Sbjct: 60  GVDLLKELRDDPRTRAIPVLAVTAFADPESVSGFLSEGFNQVITKPISVRKLLDEVERYC 119

Query: 121 GEA 123
            E 
Sbjct: 120 SET 122


>gi|289676341|ref|ZP_06497231.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           syringae FF5]
 gi|302189830|ref|ZP_07266503.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           syringae 642]
 gi|330899363|gb|EGH30782.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330941631|gb|EGH44411.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330951387|gb|EGH51647.1| type IV pilus response regulator PilH [Pseudomonas syringae Cit 7]
 gi|330977055|gb|EGH77015.1| type IV pilus response regulator PilH [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+   M     ++E  G+  L+  NG + + LARQ KPD ++MDI +  ++G
Sbjct: 1   MARILIVDDSPTEMYKLTGMLEKHGHEVLKAENGADGVALARQEKPDAVLMDIVMPGLNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            + T+Q+ +D++   IPVI +T    + D+   ++ G   Y++KP+     M+T+
Sbjct: 61  FQATRQLTKDADTSMIPVIMITTKDQETDKVWGKRQGARDYLTKPVDEETLMKTL 115


>gi|238791234|ref|ZP_04634873.1| Signal transduction histidine-protein kinase barA [Yersinia
           intermedia ATCC 29909]
 gi|238729367|gb|EEQ20882.1| Signal transduction histidine-protein kinase barA [Yersinia
           intermedia ATCC 29909]
          Length = 911

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 72/116 (62%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KVM V+DN  N+KL   L+E      +   +G +A+  AR++  D+I+MDIQ+ EI G+ 
Sbjct: 660 KVMAVDDNPANLKLIGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQMPEIDGIR 719

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            ++ I + S   + P+IAVTA A++G +E++ K G   Y++KPI  +  ++ + ++
Sbjct: 720 ASEVIHQMSHHLDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDETRLIQALSRF 775


>gi|171059161|ref|YP_001791510.1| PAS/PAC sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
 gi|170776606|gb|ACB34745.1| PAS/PAC sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
          Length = 846

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 64/103 (62%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D  +N ++  +++E +G+      NGMEALE  ++H  D++IMDIQ+  + GL  
Sbjct: 729 VLLVDDEPINREVAAEILEDAGFDVTLASNGMEALERLQRHPVDLVIMDIQMPGMDGLTT 788

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           T++I++  +   +P+IA+TA A   DE      G  A+I KPI
Sbjct: 789 TRRIRQMPDRAHLPIIAMTANAFAEDETECLNAGMNAFIPKPI 831


>gi|256829197|ref|YP_003157925.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578373|gb|ACU89509.1| PAS/PAC sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 918

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ ED+E        L+E SG+      NG EALE+   +  D+I+MD+ +  + G+ 
Sbjct: 795 QILLAEDDETTGFSISRLLEKSGHSVTLAHNGQEALEMHEANNFDLILMDVSMPVMDGIA 854

Query: 64  ITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             ++I+   +S  +++P+IA+TA+AM GD+E+    G   Y++KP+++   M+ + + + 
Sbjct: 855 ACRRIRGSRNSHKRDVPIIALTAYAMAGDKEKFLAAGMSGYVAKPVTMETLMQMMVETLS 914

Query: 122 E 122
           E
Sbjct: 915 E 915


>gi|119900234|ref|YP_935447.1| putative hybrid sensor and regulator protein [Azoarcus sp. BH72]
 gi|119672647|emb|CAL96561.1| putative hybrid sensor and regulator protein [Azoarcus sp. BH72]
          Length = 1064

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ EDN  N K+ R ++E  G+      +G EAL    Q   D+++MD ++ E+ G  
Sbjct: 803 RILLAEDNATNQKIARTMLERQGHRVHVAGDGAEALAALVQGDYDLVLMDCRMPEVDGFA 862

Query: 64  ITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I++    +    IP++A+TA AM+GD ER+   G + Y++KPI  +    T++ ++
Sbjct: 863 ATRAIRDGLGGARHAAIPIVAMTADAMEGDRERVLAAGMDDYLTKPIDAARLEATVRHWL 922

Query: 121 G 121
           G
Sbjct: 923 G 923



 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 42/70 (60%)

Query: 48  DVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
           D  I+D+++  + G  + ++IK D  L  +P++ +T  AM+ D ER+R GG  AY++KP+
Sbjct: 707 DGAILDLRMPGMDGEALGRRIKADPALAHLPLLLLTPVAMRPDAERLRAGGFAAYLAKPV 766

Query: 108 SLSIFMETIK 117
              +    ++
Sbjct: 767 RADLLERALR 776


>gi|328469859|gb|EGF40770.1| putative two-component sensor [Vibrio parahaemolyticus 10329]
          Length = 632

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVED E+N ++ R ++E  G       +G EAL+L R+H  D+I MD Q+  + G   
Sbjct: 505 VLIVEDTEVNQRVVRIILEQLGLKVSVASHGEEALQLCREHAFDLIFMDCQMPVMDGFIA 564

Query: 65  TKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           T+QI++ +E    +P+IA+TA  +K D++R  + G   +++KP++ +   +  ++Y+ +A
Sbjct: 565 TEQIRDMNEWGAHVPIIALTANVVKEDQQRCFEAGMNEFVAKPVTKARLQQIFEQYLPKA 624


>gi|78355580|ref|YP_387029.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78217985|gb|ABB37334.1| histidine kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 244

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 64/121 (52%), Gaps = 1/121 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VEDN LN +     ++  GY      NG  ALE   +   D ++MD+Q+  ++GLE
Sbjct: 118 HILLVEDNTLNQEFISLFLQEGGYTVTAADNGTGALENLEKRSFDAVLMDVQMPGMNGLE 177

Query: 64  ITKQIKEDSE-LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            TK+I+        IPVIA+TA  M GD E     G   Y+ KP++ +     I++ + E
Sbjct: 178 TTKRIRNSGRAWARIPVIALTANNMAGDREYYLASGMNGYVEKPVNKAQLFGEIERCLTE 237

Query: 123 A 123
           A
Sbjct: 238 A 238


>gi|288942043|ref|YP_003444283.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
 gi|288897415|gb|ADC63251.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
          Length = 1450

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 1/120 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGLE 63
            V++VEDNELN +L  +L+ ++G       NG EAL+ LA + + D ++MD Q+  + G  
Sbjct: 1101 VLLVEDNELNQELALELLVSNGLSVEIAANGQEALDRLAGESRFDGVLMDCQMPVMDGYT 1160

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             T+ I+   EL  +PVIA+TA  M GD E+    G   +I KPI++     T+ K+I  A
Sbjct: 1161 ATRAIRRRPELAGLPVIAMTANVMSGDREKALAAGMNDHIGKPINVRDMFTTMAKWIRPA 1220



 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR----QHKPDVIIMDIQLQEI 59
            +V++V+DN     +   +++  G+ A    +G EA+   R    Q   D++++D ++  +
Sbjct: 951  RVLVVDDNASARAILTHMLQQLGFGAEAVSSGAEAIARLRAVETQAPFDLMLLDWKMPGL 1010

Query: 60   SGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             G++  + ++ ++ + ++P +I +TA+  +G  +     G   +++KP++ S  + T+  
Sbjct: 1011 DGVQTIRALRAEAAVSQVPALIMITAYGREGVRQASADLGVAGFLTKPVAPSALLNTLMH 1070

Query: 119  YIG 121
             IG
Sbjct: 1071 AIG 1073


>gi|212543487|ref|XP_002151898.1| two-component osmosensing histidine kinase (Bos1), putative
            [Penicillium marneffei ATCC 18224]
 gi|210066805|gb|EEA20898.1| two-component osmosensing histidine kinase (Bos1), putative
            [Penicillium marneffei ATCC 18224]
          Length = 1313

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N KL   ++E   +      NG EAL+  +  + D+I+MD+Q+  + G E 
Sbjct: 1129 ILLAEDNEVNQKLAVKILEKCNHGVTVVGNGQEALDAVKNRRFDIILMDVQMPIMGGFEA 1188

Query: 65   TKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            T +I+E   ++ L   P+IA+TA AM GD E+  +   + Y+SKP+  +  ++TI K
Sbjct: 1189 TAKIREYERENNLSRTPIIALTAHAMLGDREKCIQAQMDEYLSKPLKQNQMIQTILK 1245


>gi|307152390|ref|YP_003887774.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306982618|gb|ADN14499.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 999

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 70/118 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IVED E N +L  +L+   G+      NG+EA+ L +Q  P +I+MD+ +  ++G +
Sbjct: 784 RILIVEDVEDNRRLLFELLAQVGFEVRTADNGVEAISLWQQWHPHLILMDMLMPVMNGSQ 843

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T+QIK   E ++  +IA+TA A   D+    K GC+ +I+KP    I  E I +++G
Sbjct: 844 ATRQIKATQEGEKTVIIAITANAFSDDQLAAIKVGCDDFITKPFREQILFEKIAQHLG 901


>gi|311746666|ref|ZP_07720451.1| PAS/PAC domain-containing protein [Algoriphagus sp. PR1]
 gi|126578338|gb|EAZ82502.1| PAS/PAC domain-containing protein [Algoriphagus sp. PR1]
          Length = 1436

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query: 5    VMIVEDNELNMKLFRDLIE--TSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            V+I EDN +NM L   +I+        +Q +NG+EA E  ++  PD+I MD+Q+ E++G 
Sbjct: 1191 VLIAEDNLVNMLLAETIIKKIVKNLNLIQAKNGLEAYEFCQKQAPDIIFMDVQMPEMNGY 1250

Query: 63   EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E TK I+       +P+IA+TA  +KG+ E+    G + ++ KP+      E  K ++
Sbjct: 1251 EATKNIRLLKSCAHVPIIALTAGNVKGEREKCLSVGMDDFVVKPVVEETISEVFKNWV 1308



 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 69/124 (55%), Gaps = 10/124 (8%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEIS 60
            +K+V+IV+DN+ N  + R+++      A +  NG EAL+ L ++ K DVI+MD  +  + 
Sbjct: 1046 IKRVLIVDDNDNNRLIVREMLLLKNIHATEATNGFEALQILTKEEKFDVILMDYHMPFMD 1105

Query: 61   GLEITKQIKE--DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYIS----KPISLSIFME 114
            G+E  ++I+E     ++++P++ + +     D+++I +   E  +     KP+ L  F  
Sbjct: 1106 GIETIRKIREIFKDNIEDLPILLLHS---SSDDQKIIQACKELDVKHRLIKPLKLHDFYH 1162

Query: 115  TIKK 118
             + +
Sbjct: 1163 ALSR 1166


>gi|153838245|ref|ZP_01990912.1| signal transduction histidine kinase [Vibrio parahaemolyticus
           AQ3810]
 gi|149748377|gb|EDM59236.1| signal transduction histidine kinase [Vibrio parahaemolyticus
           AQ3810]
          Length = 364

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVED E+N ++ R ++E  G       +G EAL+L R+H  D+I MD Q+  + G   
Sbjct: 237 VLIVEDTEVNQRVVRIMLEQLGLKVSVASHGEEALQLCREHAFDLIFMDCQMPVMDGFIA 296

Query: 65  TKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           T+QI++ +E    +P+IA+TA  +K D++R  + G   +++KP++ +   +  ++Y+ +A
Sbjct: 297 TEQIRDMNEWGAHVPIIALTANVVKEDQQRCFEAGMNEFVAKPVTKARLQQIFEQYLPKA 356


>gi|302339427|ref|YP_003804633.1| response regulator receiver protein [Spirochaeta smaragdinae DSM
           11293]
 gi|301636612|gb|ADK82039.1| response regulator receiver protein [Spirochaeta smaragdinae DSM
           11293]
          Length = 515

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 69/117 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           +L  V++V+D  +N  L    ++  GY+  +  NG +ALE   Q  PD+I++D+ + +++
Sbjct: 6   VLPHVLVVDDEAINRLLLVTALKKRGYLPEEAANGKDALEKVEQKPPDLILLDVMMPDLT 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           G  + + +KE  E  +IPVI VTA   + D E   K G + +ISKP++++  M  ++
Sbjct: 66  GFGVCRSLKERKETADIPVILVTALHSREDIEEGIKAGADEFISKPVNINELMVRVR 122


>gi|114330247|ref|YP_746469.1| multi-sensor hybrid histidine kinase [Nitrosomonas eutropha C91]
 gi|114307261|gb|ABI58504.1| multi-sensor hybrid histidine kinase [Nitrosomonas eutropha C91]
          Length = 1221

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 72/117 (61%), Gaps = 1/117 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N K+ R  +   G+ A    NG EAL+  +  +  +I+ D+ + E+ G ++
Sbjct: 969  ILVAEDNEINQKVIRQQLTLLGFAADIVVNGREALQKWKSGEYALILTDLHMPEMDGYQL 1028

Query: 65   TKQIK-EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+ E +   +IP+IA+TA A+KG+ ER R  G + Y+SKP+ L      ++K++
Sbjct: 1029 TQSIRAEKTGRYQIPIIALTANALKGEAERCRALGMDDYLSKPVQLEQLKSVLEKWL 1085


>gi|145299082|ref|YP_001141923.1| two-component system hybrid sensor histidine kinase/response
            regulator [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851854|gb|ABO90175.1| two-component system hybrid sensor histidine kinase/response
            regulator [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 1319

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 70/117 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN +N ++  +L+  SG I     NG EALE   QH  D+I+MDIQ+  + G  
Sbjct: 964  RVLLVEDNAINREVVLELLNNSGLIIETAVNGQEALERVSQHPFDLILMDIQMPLMDGYT 1023

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+     ++ P++A+TA A + D +  +  G   +I+KP++ +   E +++++
Sbjct: 1024 ATRAIRTLPGWEQTPILALTASAFEEDRKACKAAGMNDFIAKPVTPAKLFEALQQWL 1080


>gi|164657947|ref|XP_001730099.1| hypothetical protein MGL_2481 [Malassezia globosa CBS 7966]
 gi|159103994|gb|EDP42885.1| hypothetical protein MGL_2481 [Malassezia globosa CBS 7966]
          Length = 1333

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDN +N KL   +++  G+      NG +A++   Q K DVI+MD+ +  + G+E 
Sbjct: 1170 ILLAEDNLVNQKLACKILQNQGHKVDVVDNGEQAVQATEQCKYDVILMDVSMPVMGGIEA 1229

Query: 65   TKQI--KEDSE-LQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            T  I  +EDS+ L+ IP++A+TA AM GD+E+  + G  AY+SKPI     + T+ + + 
Sbjct: 1230 TMAIRDREDSQNLEHIPIVALTAHAMLGDKEKCLQAGMNAYVSKPIRRVELVSTLNQILS 1289

Query: 122  E 122
            +
Sbjct: 1290 Q 1290


>gi|50084002|ref|YP_045512.1| twitching motility protein [Acinetobacter sp. ADP1]
 gi|49529978|emb|CAG67690.1| twitching motility protein [Acinetobacter sp. ADP1]
          Length = 123

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 69/119 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+      FRD++   GY  L+  NG + + LA+  +PD+++MD+ +  ++G
Sbjct: 1   MARILIVDDSPTETYRFRDILTRHGYQVLEATNGADGVTLAQAEQPDLVLMDVVMPGVNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            + T+QI    + + IPV+ V+      D    ++ G   Y++KPI  +  +E I++YI
Sbjct: 61  FQATRQICRGEQTKHIPVVIVSTKDQATDRIWGKRQGAREYLTKPIDENQLIEVIQQYI 119


>gi|311696699|gb|ADP99572.1| multi-sensor hybrid histidine kinase [marine bacterium HP15]
          Length = 1166

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 67/117 (57%), Gaps = 2/117 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++  EDNE+N +L   L+  +G   +   NG EALELA +   D+I+MDIQ+  ++G +
Sbjct: 814 RILCAEDNEVNRRLVSLLVSRTGAELVHVSNGAEALELAIREPFDLILMDIQMPVMNGRD 873

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T  ++E       PVIA+TA  M  D    R  GC  +++KPI    F ET+ +Y+
Sbjct: 874 ATAALREAG--VNTPVIALTANVMSEDIADYRLAGCNEHLAKPIDKQRFYETLGRYL 928



 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 9/121 (7%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            KV++ EDN  N +L   ++   G   +    G +A+  A      +++MD  +  + G++
Sbjct: 945  KVLVAEDNTENRQLVERMLRREGLDVVAVTGGEDAVRTALSDTVHLVLMDRHMPGMDGVD 1004

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEER---IRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ +++    +  PVIA TA    GD++    + + GC+  ++KPI  S     + + +
Sbjct: 1005 ATRLLRQAGFRR--PVIAFTA----GDQQETDALLEAGCDGVLNKPIDQSHLTALLDRLL 1058

Query: 121  G 121
            G
Sbjct: 1059 G 1059


>gi|289662757|ref|ZP_06484338.1| two-component system sensor protein [Xanthomonas campestris pv.
            vasculorum NCPPB702]
          Length = 1057

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 64/105 (60%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++ ED+  N+     ++E  G      RNG EALE   +H+ D+++MDI + E+ G+  
Sbjct: 939  VLLAEDDVRNIFALSSVLEPLGVTLQIARNGREALEHLAKHEVDLVLMDIMMPEMDGITA 998

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             +QI+ + + Q++P+IA+TA AM  D ER  + G   YI+KPI +
Sbjct: 999  MRQIRANRQWQDLPIIALTAKAMADDRERCLEAGANDYIAKPIDV 1043



 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 3/114 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++ VED+    +   DL     +  +   N  EAL LA + +P  I++DI L + SGL +
Sbjct: 671 ILAVEDDTRFAQALVDLAHELDFDCVVAPNAEEALRLAAELRPSGILLDIGLPDASGLSV 730

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
            +++K D   + +PV  V+A         +   G   Y+ KP +  +    I++
Sbjct: 731 LERLKRDPATRHVPVHVVSALERSQIALEL---GAVGYLIKPATRDLLAGAIRQ 781


>gi|330821703|ref|YP_004350565.1| Multi-sensor hybrid histidine kinase [Burkholderia gladioli BSR3]
 gi|327373698|gb|AEA65053.1| Multi-sensor hybrid histidine kinase [Burkholderia gladioli BSR3]
          Length = 1172

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEISGLE 63
            +++ ED+  N+     +IE  G      RNG EALEL  Q HK D+I+MD+ + E+ GL 
Sbjct: 1053 ILLAEDDARNIFALSHVIEPLGAKLFIARNGREALELLEQGHKIDLILMDVMMPEMDGLA 1112

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
             T  I++D+    +P+IA+TA AM+ D  R  + G + YISKPI +
Sbjct: 1113 ATAAIRKDARFMRLPIIALTAKAMEHDRIRCIEAGADDYISKPIDI 1158



 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 9/120 (7%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++ +ED+ +   + RDL+    +  +   +G   + L R  +P  +++D+ L + SGL +
Sbjct: 785 ILAIEDDLVFAGILRDLVHELDFDFVHAADGSSGVALVRDMQPTAVLLDVGLPDRSGLTV 844

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIKKYIG 121
            + +K D   + IP+  V A       + I K    G   Y  KP + +   + I++  G
Sbjct: 845 LEWLKSDPLTRHIPIHIVAA------TDHIAKALHLGAAGYTLKPAARATLEDAIRRLEG 898



 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 7/99 (7%)

Query: 2   LKKVMIVEDNELNMKLFRDLI--ETSGYIALQT-RNGMEALELARQHKPDVIIMDIQLQE 58
           LK+V+++ED+    +  RDL+  ET+  +A+ T  + +E L+L      D ++ D+ L +
Sbjct: 904 LKRVLVIEDDTAMREGIRDLLTNETTEIVAVDTLASALENLDLV---DFDCVVTDLALPD 960

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEE-RIRK 96
            +G ++ + +  D     +PVI  T  A+  DEE R+R+
Sbjct: 961 GTGYDLLETLAADPARALLPVIVYTGRALSADEEHRLRR 999


>gi|262189758|ref|ZP_06048112.1| BarA sensory histidine kinase [Vibrio cholerae CT 5369-93]
 gi|262034363|gb|EEY52749.1| BarA sensory histidine kinase [Vibrio cholerae CT 5369-93]
          Length = 384

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/112 (37%), Positives = 67/112 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           VM V+DN  N+KL   L++      +   +G EA+E A+  + D+I+MDIQ+  + G+  
Sbjct: 124 VMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQIRQFDIILMDIQMPHMDGVTA 183

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
            K IK+    ++ PVIAVTA AM G+ +R+ K G + Y++KPI   I  + +
Sbjct: 184 CKAIKQLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVL 235


>gi|298528945|ref|ZP_07016348.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
 gi|298510381|gb|EFI34284.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
            thiodismutans ASO3-1]
          Length = 1209

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 72/122 (59%), Gaps = 3/122 (2%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++ EDNE+N  L   ++   G+      +G EA++   +   D+++MD+Q+  + GLE
Sbjct: 955  KILLAEDNEVNQLLAVRILSQEGHQVRGVHDGREAVDALARENFDLVLMDVQMPVMDGLE 1014

Query: 64   ITKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             T+ I+   ++  L   PVIA+TA A+KGD E+  + G ++Y+ KPI  +   + IK  +
Sbjct: 1015 ATRLIRAREQEEGLLRTPVIAITAHALKGDREKCLEAGMDSYVQKPIRKADLFKEIKAVL 1074

Query: 121  GE 122
            GE
Sbjct: 1075 GE 1076



 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 68/122 (55%), Gaps = 13/122 (10%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQ---TRNGMEALEL----ARQHKP-DVIIMDIQ 55
           KV+IV+DN  N  +   L E+  Y  +Q    ++G + L++    A  + P  V+++D+ 
Sbjct: 808 KVLIVDDNANNAGI---LEESLRYWWMQPAIAQSGGQGLKMLEHAASANDPFQVMLLDMH 864

Query: 56  LQEISGLEITKQIKEDSELQEIPVIAV-TAFAMKGDEERIRKGGCEAYISKPISLSIFME 114
           + E++GL++ + + +D +    PVI V T+ A  GD  ++R  G +AY+ KP+  S  + 
Sbjct: 865 MPEMNGLDVLEAM-QDMDPSVKPVILVLTSGAQLGDSRKLRTYGVKAYLFKPVKQSKLLG 923

Query: 115 TI 116
            I
Sbjct: 924 AI 925


>gi|212543489|ref|XP_002151899.1| two-component osmosensing histidine kinase (Bos1), putative
            [Penicillium marneffei ATCC 18224]
 gi|210066806|gb|EEA20899.1| two-component osmosensing histidine kinase (Bos1), putative
            [Penicillium marneffei ATCC 18224]
          Length = 1319

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++ EDNE+N KL   ++E   +      NG EAL+  +  + D+I+MD+Q+  + G E 
Sbjct: 1129 ILLAEDNEVNQKLAVKILEKCNHGVTVVGNGQEALDAVKNRRFDIILMDVQMPIMGGFEA 1188

Query: 65   TKQIKE---DSELQE