PSIBLAST alignment of GI: 254780476 and protein with PDB id: 1w25

>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459
>gi|56966619|pdb|1W25|B Chain B, Response Regulator Pled In Complex With C-Digmp Length = 459
>gi|158430933|pdb|2V0N|A Chain A, Activated Response Regulator Pled In Complex With C-Digmp And Gtp-Alpha-S Length = 459
 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 62/120 (51%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
             ++++V+D E N++L    +    Y      +G  AL +A +  PD+I++D+ +  + G
Sbjct: 1   SARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + +++K+D   + IPV+ +TA   +GD  +  + G   +++KPI   +    ++    
Sbjct: 61  FTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTR 120