PSIBLAST alignment of GI: 254780476 and protein with PDB id: 1w25

>gi|56966618|pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-Digmp Length = 459
>gi|56966619|pdb|1W25|B Chain B, Response Regulator Pled In Complex With C-Digmp Length = 459
>gi|158430933|pdb|2V0N|A Chain A, Activated Response Regulator Pled In Complex With C-Digmp And Gtp-Alpha-S Length = 459
 Score = 75.2 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+IV+DNE   +     +    +  +   +  +A +++     D++I++   +   GL 
Sbjct: 154 RVLIVDDNERQAQRVAAELGVE-HRPVIESDPEKA-KISAGGPVDLVIVNAAAKNFDGLR 211

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T  ++ +   +++PV+A+     +G   +  + G    +S+PI        +K  I  
Sbjct: 212 FTAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQR 270