PSIBLAST alignment of GI: 254780476 and protein with PDB id: 3f6p

>gi|290560102|pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120
 Score =  161 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L    
Sbjct: 1   MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119