BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780476|ref|YP_003064889.1| two component response
regulator [Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|302389531|ref|YP_003825352.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200159|gb|ADL07729.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
          Length = 232

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 71/124 (57%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K+++V+D    ++L R  +E SG+  +   +G +AL+L ++ +PD++I+DI L  I
Sbjct: 1   MAKEKILVVDDEPNIVELVRFNLENSGFKVITASDGQQALDLVQKEQPDLVILDIMLPGI 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ +  +     ++IPVI +TA   + D+    + G + YI+KP S    +  +K  
Sbjct: 61  DGLEVCRIFRRQRATRDIPVILLTAKTEEIDKVLGLEMGADDYITKPFSPRELVARVKAV 120

Query: 120 IGEA 123
           +  A
Sbjct: 121 LRRA 124


>gi|110801119|ref|YP_695076.1| DNA-binding response regulator [Clostridium perfringens ATCC 13124]
 gi|110675766|gb|ABG84753.1| DNA-binding response regulator [Clostridium perfringens ATCC 13124]
          Length = 231

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL+L R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKLIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|317154759|ref|YP_004122807.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
 gi|316945010|gb|ADU64061.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
          Length = 228

 Score =  184 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M   K+++VED++   +L +  +  +G+      +G   L LA   KPD++++D+ +  +
Sbjct: 1   MSAHKILVVEDHKDTRELLKYNLTAAGFDVAAAEDGASGLALAEAFKPDIVLLDLMMPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ +QIK +S L  IPVI +TA   + D+    + G + YI KP S    +  IK  
Sbjct: 61  DGLEVCRQIKGNSSLSRIPVIMLTAKGEEIDKIVGLELGADDYIVKPFSPRELVLRIKAV 120

Query: 120 IGEA 123
           +  A
Sbjct: 121 LRRA 124


>gi|168206757|ref|ZP_02632762.1| DNA-binding response regulator [Clostridium perfringens E str.
           JGS1987]
 gi|168211944|ref|ZP_02637569.1| DNA-binding response regulator [Clostridium perfringens B str. ATCC
           3626]
 gi|182625729|ref|ZP_02953497.1| DNA-binding response regulator [Clostridium perfringens D str.
           JGS1721]
 gi|170661839|gb|EDT14522.1| DNA-binding response regulator [Clostridium perfringens E str.
           JGS1987]
 gi|170710113|gb|EDT22295.1| DNA-binding response regulator [Clostridium perfringens B str. ATCC
           3626]
 gi|177908991|gb|EDT71473.1| DNA-binding response regulator [Clostridium perfringens D str.
           JGS1721]
          Length = 231

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL++ R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKIIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|169344709|ref|ZP_02630248.2| DNA-binding response regulator [Clostridium perfringens C str.
           JGS1495]
 gi|169297144|gb|EDS79259.1| DNA-binding response regulator [Clostridium perfringens C str.
           JGS1495]
          Length = 231

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL++ R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKIIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|28210824|ref|NP_781768.1| transcriptional regulatory protein [Clostridium tetani E88]
 gi|28203262|gb|AAO35705.1| transcriptional regulatory protein [Clostridium tetani E88]
          Length = 232

 Score =  183 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M + K++IV+D E   +L R  +E  GY      NG EALE+A++ KP +I++D+ L ++
Sbjct: 1   MSQDKILIVDDEEHIRELLRYNLEKEGYKIFCAENGKEALEIAKEKKPTLILLDVMLPQM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++ K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  IK  
Sbjct: 61  DGYDVCKEIRKDNSISTTPIIMITAKGEELDKVLGLELGADDYITKPFSIRELIARIKAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|168214874|ref|ZP_02640499.1| DNA-binding response regulator [Clostridium perfringens CPE str.
           F4969]
 gi|170713701|gb|EDT25883.1| DNA-binding response regulator [Clostridium perfringens CPE str.
           F4969]
          Length = 231

 Score =  183 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL++ R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKIIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|298246544|ref|ZP_06970350.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297554025|gb|EFH87890.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 244

 Score =  183 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 68/123 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D  +  +     +E +GY  +   +G  AL+ AR  +PD+I++DI L  + 
Sbjct: 1   MARKILVVDDEAVLAETIAYNLEQAGYHVITAADGNSALDAARSERPDLIVLDIMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +Q++ +++    P++ +TA   + D+    + G + Y++KP      +  ++  I
Sbjct: 61  GLEVCRQLRRENKTATTPILMLTARGDEIDKVVGLEVGADDYVTKPFGRRELLARVRALI 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|18309624|ref|NP_561558.1| DNA-binding response regulator [Clostridium perfringens str. 13]
 gi|18144301|dbj|BAB80348.1| two-component response regulator [Clostridium perfringens str. 13]
          Length = 231

 Score =  183 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL++ R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKVIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|332968094|gb|EGK07181.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 237

 Score =  183 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 69/122 (56%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D    +KL +  +E  G+      +G  ALE   +H PD+I++D+ L ++ 
Sbjct: 2   MSKKVLVVDDEPSIVKLVQFNLEKEGFSVEVASDGQTALEKVNEHPPDLIVLDLMLPKMD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ KQI++++    +P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 62  GLEVCKQIRKEN--SHLPILMLTAKNEEFDKVLGLELGADDYMTKPFSPRELVARVKAIL 119

Query: 121 GE 122
             
Sbjct: 120 RR 121


>gi|168218156|ref|ZP_02643781.1| DNA-binding response regulator [Clostridium perfringens NCTC 8239]
 gi|182379830|gb|EDT77309.1| DNA-binding response regulator [Clostridium perfringens NCTC 8239]
          Length = 231

 Score =  183 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 71/121 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL + R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALNIIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|163846454|ref|YP_001634498.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222524229|ref|YP_002568700.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163667743|gb|ABY34109.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222448108|gb|ACM52374.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 233

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 69/123 (56%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + +++V+D    +K+ RD +E +G+  +   +G  AL LARQ  P ++++D+ L  + 
Sbjct: 1   MSRTILVVDDEPGIVKIARDYLERAGFQVISAGDGPTALRLARQEHPALMVLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ +++D     +P+I +TA   + D     + G + YI+KP S    +  ++  +
Sbjct: 61  GLDVTRALRQDPLTARLPIIMLTARVEETDRLIGLELGADDYITKPFSPRELVARVRAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|110801877|ref|YP_697936.1| DNA-binding response regulator [Clostridium perfringens SM101]
 gi|110682378|gb|ABG85748.1| DNA-binding response regulator [Clostridium perfringens SM101]
          Length = 231

 Score =  182 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 71/121 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+IV+D E   +L +  ++  GY      NG EAL + R+ K D+I++D+ L EI GL
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDIEVAVNGTEALNIIREIKFDLILLDLMLPEIDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E  +IPV+ +TA   + D+    + G + YI+KP S+   M  +K  +  
Sbjct: 64  EVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|168182605|ref|ZP_02617269.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Bf]
 gi|170761342|ref|YP_001787844.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A3 str. Loch Maree]
 gi|237795967|ref|YP_002863519.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Ba4 str. 657]
 gi|169408331|gb|ACA56742.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A3 str. Loch Maree]
 gi|182674265|gb|EDT86226.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Bf]
 gi|229260789|gb|ACQ51822.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Ba4 str. 657]
          Length = 232

 Score =  182 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 73/121 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E +GY  +   NG+EAL +A++ KPD+I++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIAKEEKPDLILLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++D+     P+I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YEVCKEIRKDNNTATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|323702131|ref|ZP_08113798.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532818|gb|EGB22690.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 231

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +   +L +  +E  G+  L   +G   L++AR   PD+II+DI L  + G
Sbjct: 1   MPKILVVDDEQPIRELVKYNLEREGFEVLLAGDGNTGLDMARTEAPDLIILDIMLPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + + + ++   + IP+I ++A   + D+    + G + YI+KP S    +  +K  + 
Sbjct: 61  LSVCRTLHQEPATRAIPIIMLSARGEEVDKVLGLELGADDYITKPFSPRELIARVKARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|147678166|ref|YP_001212381.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146274263|dbj|BAF60012.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 239

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 71/121 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +  ++L R  +E  GY  L   +G + LELAR  +PD+I++D+ L  ++G
Sbjct: 1   MPKILVVDDEKNILELVRFNLEREGYQVLTALDGPQGLELARAERPDLIVLDVMLPGMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++  D+  + IPVI ++A A + D     + G + YI+KP S    +  IK  + 
Sbjct: 61  LEVCREMHRDAATKNIPVIMLSARAEELDRVLGLEMGADDYITKPFSPRELVARIKARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|85859021|ref|YP_461223.1| response regulator [Syntrophus aciditrophicus SB]
 gi|85722112|gb|ABC77055.1| response regulator with a winged-helix DNA-binding domain
           [Syntrophus aciditrophicus SB]
          Length = 245

 Score =  181 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++V+D +  ++L    +E  G+   Q  +G EAL+  R +KPD++I+D+ L  +SGL
Sbjct: 15  KRILVVDDEKDIVELLTFNLEKEGFAVTQAFDGEEALKTIRTNKPDLVILDLMLPGVSGL 74

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +I +Q++ + E + +PVI +TA     D+    + G + YI+KP ++   +  ++  +  
Sbjct: 75  DICRQVRRNEETETLPVIMLTAKGEPLDKVVGLEIGADDYITKPFNVRELVARVRAVLRR 134

Query: 123 A 123
           +
Sbjct: 135 S 135


>gi|229065726|ref|ZP_04200950.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH603]
 gi|228715544|gb|EEL67345.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH603]
          Length = 237

 Score =  181 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E   ++ +  +E  GY      NGME  ++  Q++PD+II+D+ + +  
Sbjct: 1   MKKRILIVEDEENIREVCKRYLEREGYEVYTAMNGMEGWDVFHQYQPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYVTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|127513677|ref|YP_001094874.1| two component transcriptional regulator [Shewanella loihica PV-4]
 gi|126638972|gb|ABO24615.1| two component transcriptional regulator, winged helix family
           [Shewanella loihica PV-4]
          Length = 241

 Score =  181 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   AL++  +  PD++++D      S
Sbjct: 13  MTARILIVEDELAIREMLAFVLEQHGFTTTTAEDFDSALDMLSEPYPDLVLLDWMFPGGS 72

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IPVI +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 73  GIQLAKKLRQDEFTRHIPVIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVM 132

Query: 121 GEA 123
             A
Sbjct: 133 RRA 135


>gi|153940311|ref|YP_001391825.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. Langeland]
 gi|152936207|gb|ABS41705.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. Langeland]
 gi|295319851|gb|ADG00229.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. 230613]
          Length = 232

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 74/121 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E +GY  +   NG+EAL +A++ KPD+I++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIAKEEKPDLILLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|168180586|ref|ZP_02615250.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum NCTC 2916]
 gi|226949883|ref|YP_002804974.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A2 str. Kyoto]
 gi|182668498|gb|EDT80477.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum NCTC 2916]
 gi|226840760|gb|ACO83426.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A2 str. Kyoto]
          Length = 232

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 74/121 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E +GY  +   NG+EAL +A++ KPD+I++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIAKEEKPDLILLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|170756077|ref|YP_001782072.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum B1 str. Okra]
 gi|169121289|gb|ACA45125.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum B1 str. Okra]
          Length = 232

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 74/121 (61%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E +GY  +   NG+EAL +A++ KPD+I++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIAKEEKPDLILLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMIARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|297616303|ref|YP_003701462.1| two component transcriptional regulator, winged helix family
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297144140|gb|ADI00897.1| two component transcriptional regulator, winged helix family
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 228

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 59/122 (48%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED EL  +L R  +E  GY      +G EAL   R + PD++I+DI L +  
Sbjct: 1   MASTILVVEDEELVQELLRLYLEKEGYAVEAAWDGEEALSKFRSNNPDLVILDIMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++I+  S     P+I +TA   + D       G + Y+ KP S    +  +K  +
Sbjct: 61  GWTVCREIRAMS---NAPIIMLTAKGEESDRVLGLDLGADDYVCKPFSPIELVARVKAVL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|300113425|ref|YP_003760000.1| winged helix family two component transcriptional regulator
           [Nitrosococcus watsonii C-113]
 gi|299539362|gb|ADJ27679.1| two component transcriptional regulator, winged helix family
           [Nitrosococcus watsonii C-113]
          Length = 231

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IV+D     ++    +   GY      +G +A +   + +PD+I++D  L  IS
Sbjct: 3   MAATILIVDDEAAIREMLGFALTQEGYHYQVAADGEQAWQQINEFRPDLILLDWMLPGIS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ +++K +   +E+PVI +TA   + D+ R    G + YI+KP S    +  IK  +
Sbjct: 63  GVDLARRLKREPSTRELPVIMLTARDEEEDKVRGLNVGADDYITKPFSPMELIARIKAVL 122

Query: 121 GEA 123
             +
Sbjct: 123 RRS 125


>gi|242281151|ref|YP_002993280.1| transcriptional regulator [Desulfovibrio salexigens DSM 2638]
 gi|242124045|gb|ACS81741.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio salexigens DSM 2638]
          Length = 230

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 70/120 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED+   ++L +  + +SGY  +   +G +AL+ AR+  PD+I++D+ L  I GLE
Sbjct: 5   KILVVEDHNDTIELLKYNLTSSGYEVVTAMDGHKALDQARKENPDLILLDLMLPGIDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +++K++   Q IPVI +TA   + D     + G + YI KP S    +  +K  +  +
Sbjct: 65  VCRRLKQEVATQHIPVIMLTAKGEEVDRVVGLELGVDDYIVKPFSPRELVLRVKAVLRRS 124


>gi|163751022|ref|ZP_02158253.1| phosphate regulon response regulator PhoB [Shewanella benthica
           KT99]
 gi|161329183|gb|EDQ00182.1| phosphate regulon response regulator PhoB [Shewanella benthica
           KT99]
          Length = 229

 Score =  180 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IVED     ++ + ++E  G+      +   AL +  +  PD+I++D      S
Sbjct: 1   MTAKILIVEDELAIREMLKFVLEQHGFTTTSAEDFDSALNMISEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IP+I +TA   + D+ R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRRIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|167630147|ref|YP_001680646.1| transcriptional regulatory protein [Heliobacterium modesticaldum
           Ice1]
 gi|167592887|gb|ABZ84635.1| transcriptional regulatory protein [Heliobacterium modesticaldum
           Ice1]
          Length = 232

 Score =  180 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 67/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED++  ++L R  +E  G+      +G  AL   ++  PD+II+D+ L  + G
Sbjct: 1   MAKILVVEDDQHILELVRFNLEKEGHTVQVAVDGEAALACLQEELPDLIILDLMLPRLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++++  +    +P++ +TA   + D+    + G + Y++KP S    +  IK  + 
Sbjct: 61  LELCRRVRSRNHSAHLPILMLTAKGEEVDKVIGLEMGADDYMTKPFSPRELVARIKALLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|304317190|ref|YP_003852335.1| transcriptional regulator [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778692|gb|ADL69251.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 235

 Score =  180 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 72/123 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++ED    ++L R  +E  GY  + T NG E LE  R+  PD++++D+ L +I 
Sbjct: 1   MTHTILVIEDEAHILELLRYNLEAQGYNVILTDNGKEGLEKCRELSPDLVLLDLMLPDID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K+IK D  L+ IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GIDVCKKIKSDEHLKNIPIIMLTAKSEEFDKILGLELGADDYITKPFSIRELLARIKVVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|260892897|ref|YP_003238994.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260865038|gb|ACX52144.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 231

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 66/118 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D E   KL    +   G+  L   +G +ALE+ARQH+PDVII+D+ L  + G  +
Sbjct: 4   VLVVDDEEHIQKLLHFTLSKEGFQVLVAADGPQALEMARQHRPDVIILDLMLPALDGFTV 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + ++ D  L+EIPVI ++A   + D+ R    G + Y++KP S       +K  +  
Sbjct: 64  CELLRRDPSLKEIPVIVLSARGTEEDKVRGLDIGADDYVTKPFSPRELAARVKAQLRR 121


>gi|77165864|ref|YP_344389.1| phosphate regulon transcriptional regulatory protein phoB
           [Nitrosococcus oceani ATCC 19707]
 gi|254434533|ref|ZP_05048041.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus oceani AFC27]
 gi|76884178|gb|ABA58859.1| two component transcriptional regulator, winged helix family
           [Nitrosococcus oceani ATCC 19707]
 gi|207090866|gb|EDZ68137.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus oceani AFC27]
          Length = 229

 Score =  179 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+  +++V+D     ++    +   GY      +G +A +   +  PD+I++D  L  IS
Sbjct: 1   MVATILVVDDEAAIREMLGFALTQEGYYYQAAADGEQAWQRINESHPDLILLDWMLPGIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ +++K +   +E+PVI +TA   + D+ R    G + YI+KP S +  +  IK  +
Sbjct: 61  GVDLARRLKREPSTRELPVIMLTARDEEEDKVRGLNVGADDYITKPFSPTELIARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|328948860|ref|YP_004366197.1| transcriptional regulator [Treponema succinifaciens DSM 2489]
 gi|328449184|gb|AEB14900.1| two component transcriptional regulator, winged helix family
           [Treponema succinifaciens DSM 2489]
          Length = 231

 Score =  179 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 67/119 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D E   +L +  +E   Y      NG +ALEL R   PD++I+D+ L ++SGL+
Sbjct: 2   KILIVDDEEPIRELIKYNVEKQKYETFTAENGQQALELCRNKNPDLVILDLMLPDMSGLD 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           I + I+ DS ++ IP+I VTA     D     + G + Y++KP S  + +  I+  +  
Sbjct: 62  ICRIIRNDSSIKNIPIIMVTAKTEDSDIVTGLELGADDYVTKPFSPKVLLARIQSVLRR 120


>gi|83310469|ref|YP_420733.1| response regulator [Magnetospirillum magneticum AMB-1]
 gi|82945310|dbj|BAE50174.1| Response regulator [Magnetospirillum magneticum AMB-1]
          Length = 240

 Score =  179 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 67/119 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED      + R  +E  GY   +  +G EAL +  + KPD++++D  L  +SG+EI
Sbjct: 14  VLVVEDEAALATMLRYNLEKEGYRVAEAADGEEALTVLAERKPDLVLLDWMLPSLSGIEI 73

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +QI+     +E+P+I +TA   +GD+ R    G + Y++KP SL   M  ++  +  A
Sbjct: 74  CRQIRRKPATRELPIIMLTARGEEGDKIRGLNTGADDYLTKPFSLPELMARVRALLRRA 132


>gi|296132738|ref|YP_003639985.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296031316|gb|ADG82084.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 230

 Score =  179 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++ +D+   ++L +  ++  GY      NG EA++ A   KPD+I++D+ + EI G
Sbjct: 1   MSKILVADDDPNVIELLKIYLQKEGYEVFFAENGREAVDKANSTKPDLIVLDLMMPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +QI+  S    +P+I +TA     D+    + G + YI+KP +    +  IK  + 
Sbjct: 61  LEVCRQIRMHSR---VPIIMLTAKDEDMDKILGLEMGADDYITKPFNPREVVARIKAVLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|167037240|ref|YP_001664818.1| two component transcriptional regulator [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256751995|ref|ZP_05492864.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|320115659|ref|YP_004185818.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166856074|gb|ABY94482.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749105|gb|EEU62140.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|319928750|gb|ADV79435.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 234

 Score =  179 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+++ED    ++L R  +E +GY  + + NG E L+ A + KPD++I+D+ L ++ 
Sbjct: 1   MAHTVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKAFEGKPDLVILDLMLPDVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEI K +K++ E + IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GLEICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|289578661|ref|YP_003477288.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|297544881|ref|YP_003677183.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289528374|gb|ADD02726.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|296842656|gb|ADH61172.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 234

 Score =  179 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 74/122 (60%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +V+++ED    ++L R  +E +GY  + + NG E L+ A + KPD++I+D+ L ++ 
Sbjct: 1   MAHRVLVIEDEVHILELLRYNLEAAGYKVITSENGKEGLDKALEEKPDLVILDLMLPDVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEI K +K++ E + IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GLEICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|219849580|ref|YP_002464013.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219543839|gb|ACL25577.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 236

 Score =  179 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + +++V+D    +K+ RD +E +G+  +   +G  AL LARQ  P +I++D+ L  + 
Sbjct: 1   MKRTILVVDDEPGIVKIARDYLERAGFHVISAGDGPSALRLARQEHPSLIVLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++T+ +++D     +P+I +TA   + D     + G + YI+KP S    +  ++  +
Sbjct: 61  GLDVTRALRQDPLTAGVPIIMLTARVEETDRLIGLELGADDYITKPFSPRELVARVRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|83591942|ref|YP_425694.1| two component transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83574856|gb|ABC21407.1| two component transcriptional regulator, winged helix family
           [Rhodospirillum rubrum ATCC 11170]
          Length = 233

 Score =  179 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+IVED    + L R  +E  GY   +  +G EA+ L  + +PDV+I+D  L  +S
Sbjct: 1   MKSHVLIVEDEVSLVTLLRYNLEKEGYRVSEAMDGEEAMTLVAEDQPDVVILDWMLPSLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +Q++     +++P++ +TA   + D  R    G + Y+SKP S+   +  +K  +
Sbjct: 61  GIEVCRQLRRKPRTRDLPILMLTARGEESDRIRGLNTGADDYMSKPFSMPELLARVKALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|229012417|ref|ZP_04169592.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides DSM 2048]
 gi|229170815|ref|ZP_04298429.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH621]
 gi|228612653|gb|EEK69862.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH621]
 gi|228748776|gb|EEL98626.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides DSM 2048]
          Length = 237

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E   ++ +  +E   Y      NG E  +L   H+PD+II+D+ + +  
Sbjct: 1   MKKRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTHQPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|167040620|ref|YP_001663605.1| two component transcriptional regulator [Thermoanaerobacter sp.
           X514]
 gi|300914661|ref|ZP_07131977.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307724105|ref|YP_003903856.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter sp. X513]
 gi|166854860|gb|ABY93269.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X514]
 gi|300889596|gb|EFK84742.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307581166|gb|ADN54565.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X513]
          Length = 234

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+++ED    ++L R  +E +GY  + + NG E L+ A + KPD++I+D+ L ++ 
Sbjct: 1   MAHTVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKALEGKPDLVILDLMLPDVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEI K +K++ E + IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GLEICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|94972307|ref|YP_594347.1| two component transcriptional regulator [Deinococcus geothermalis
           DSM 11300]
 gi|94554358|gb|ABF44273.1| two component transcriptional regulator, winged helix family
           [Deinococcus geothermalis DSM 11300]
          Length = 248

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K V+IVEDN     + R+ +E  GY      NG E L  AR H+PD++++D+ +  + G
Sbjct: 22  MKTVLIVEDNAGVRDMIREYLEEHGYRVRVASNGQEGLLEARHHRPDLVLLDVMMPGMDG 81

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE  ++ +     +++PVI +TA   + D+    + G + Y++KP S++  +  ++  + 
Sbjct: 82  LEFLRRFRA---TEQVPVIFLTARDTELDKVLGLELGADDYVTKPFSMAELLARVRANLR 138

Query: 122 EA 123
            +
Sbjct: 139 RS 140


>gi|307267065|ref|ZP_07548578.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326391596|ref|ZP_08213126.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
 gi|306917896|gb|EFN48157.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325992378|gb|EGD50840.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 234

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+++ED    ++L R  +E +GY  + + NG E L+ A + KPD++I+D+ L ++ 
Sbjct: 1   MAHTVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKALEGKPDLVILDLMLPDVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEI K +K++ E + IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GLEICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|288956869|ref|YP_003447210.1| two-component response regulator [Azospirillum sp. B510]
 gi|288909177|dbj|BAI70666.1| two-component response regulator [Azospirillum sp. B510]
          Length = 248

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 67/119 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IVED    + L +  +E  G+      +G EAL  A +  P ++++D  L  +SGLE+
Sbjct: 23  VLIVEDEADILTLLKYNLEKEGFRVATASDGEEALLAAGEQTPHIVLLDWMLPLMSGLEV 82

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q++ +++ ++IP+I +TA   +GD  R    G + YI+KP S +  +  ++  +  A
Sbjct: 83  CRQLRRNAKTRDIPIIMLTARGEEGDRVRGLNSGADDYITKPFSPTELVARMRAVLRRA 141


>gi|95929117|ref|ZP_01311862.1| two component transcriptional regulator, winged helix family
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135018|gb|EAT16672.1| two component transcriptional regulator, winged helix family
           [Desulfuromonas acetoxidans DSM 684]
          Length = 231

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++IVED E  + L    +   G+       G + +E AR+  PD++I+D+ L  + 
Sbjct: 1   MNKNILIVEDEEDILALVHYNLSRDGFEVTTATTGEDGVEQARKEHPDLMILDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ + +K+D EL++IP++ +TA   + D  +  + G   Y++KP S  + +  +K  +
Sbjct: 61  GLEVCETLKKDRELRDIPIVMLTAKGEESDIVKGLEMGAADYVTKPFSPKVLLARVKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|220930753|ref|YP_002507662.1| transcriptional regulator [Clostridium cellulolyticum H10]
 gi|220001081|gb|ACL77682.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulolyticum H10]
          Length = 230

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++IV+D +  + + +  ++  GY  ++  +G EA+ LA    PD+I++DI L ++ 
Sbjct: 1   MSKKILIVDDEKNIVDILKFNLKKEGYDTIEAYDGEEAVNLALSQSPDLILLDIMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + +++++       P++ +TA   + D+    + G + YI+KP S    M  +K  +
Sbjct: 61  GFTVCRKLRQSI---STPILMLTAKEEEVDKVLGLELGADDYITKPFSPRELMARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|206968679|ref|ZP_03229634.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus cereus AH1134]
 gi|229096888|ref|ZP_04227857.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-29]
 gi|229115876|ref|ZP_04245274.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|229173099|ref|ZP_04300650.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
 gi|229182148|ref|ZP_04309435.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus 172560W]
 gi|206735720|gb|EDZ52878.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus cereus AH1134]
 gi|228601322|gb|EEK58856.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus 172560W]
 gi|228610432|gb|EEK67703.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
 gi|228667619|gb|EEL23063.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|228686498|gb|EEL40407.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-29]
          Length = 237

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E   ++ +  +E   Y      NG E  +L   H+PD+II+D+ + +  
Sbjct: 1   MKKRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTHQPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|229133940|ref|ZP_04262762.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus BDRD-ST196]
 gi|228649500|gb|EEL05513.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus BDRD-ST196]
          Length = 237

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E   ++ +  +E   Y      NG E  +L   H+PD+II+D+ + +  
Sbjct: 1   MKKRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTHQPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|147676580|ref|YP_001210795.1| hypothetical protein PTH_0245 [Pelotomaculum thermopropionicum SI]
 gi|146272677|dbj|BAF58426.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 357

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++ R  +E  G+   +  +G EAL L    K D++I+D+ +  + G  
Sbjct: 128 KILVVDDERKIREVVRMYLENEGFAVGEATDGREALNLLTGGKWDLLILDLMMPGVDGWS 187

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +++++      +P+I +TA   + D     + G + Y+ KP S    +  +K  +  +
Sbjct: 188 VCREVRK---TTALPIIMLTARDAEVDRIVGLELGADDYVVKPFSPRELVARVKAVLRRS 244


>gi|301059336|ref|ZP_07200263.1| putative Sensory transduction protein regX3 [delta proteobacterium
           NaphS2]
 gi|300446565|gb|EFK10403.1| putative Sensory transduction protein regX3 [delta proteobacterium
           NaphS2]
          Length = 235

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+  +++ ED+   +    D +E+ GY  +   +G EAL+L + +  D++++DI +   S
Sbjct: 1   MMAHILVAEDDRHILSGLVDTLESEGYQVMPASDGEEALDLFKNNPFDLVLLDIMMPGKS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ ++I+   E  +IP+I +TA   + D+    + G + YI+KP  +   +  I   +
Sbjct: 61  GYDVCREIRSTDE--DIPIIMLTAKGEEIDKVVGLQLGADDYITKPFGVHELLARIAAVL 118

Query: 121 GEA 123
             A
Sbjct: 119 RRA 121


>gi|157376435|ref|YP_001475035.1| two component transcriptional regulator [Shewanella sediminis
           HAW-EB3]
 gi|157318809|gb|ABV37907.1| two component transcriptional regulator, winged helix family
           [Shewanella sediminis HAW-EB3]
          Length = 229

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   ALE+  +  PD+I++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVLEQHGFTTTAAEDFDSALEMLSEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   ++IP+I +TA   + D+ R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|209966526|ref|YP_002299441.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodospirillum centenum SW]
 gi|209959992|gb|ACJ00629.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodospirillum centenum SW]
          Length = 234

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 67/119 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED    + L +  +E  G+  +   +G EAL LA +  P ++++D  L  +SGLE+
Sbjct: 9   ILIVEDEADLVTLLKYNLEKEGFRVISASDGEEALLLANEQAPHLVLLDWMLPLMSGLEV 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q++ + + ++ PVI +TA   + D+ R    G + YI+KP S +  +  ++  +  A
Sbjct: 69  CRQLRRNPKTRDTPVIMLTARGEEADKVRGLNSGADDYIAKPFSPTELVARMRAVLRRA 127


>gi|329937264|ref|ZP_08286863.1| response regulator [Streptomyces griseoaurantiacus M045]
 gi|329303545|gb|EGG47431.1| response regulator [Streptomyces griseoaurantiacus M045]
          Length = 277

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 68/120 (56%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D+    ++    ++ +GY+  +  +G  AL+ A  H+PD++++D+ L  + GLE
Sbjct: 21  RILVVDDDPTVAEVVSGYLDRAGYVVDRAEDGPAALDRAAAHRPDLVVLDLMLPGMDGLE 80

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++E+     +PV+ +TA   + D     + G + Y++KP S    +  ++  +  A
Sbjct: 81  VCRRLRENGP---VPVVMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVQSVLRRA 137


>gi|212634120|ref|YP_002310645.1| transcriptional regulatory protein [Shewanella piezotolerans WP3]
 gi|212555604|gb|ACJ28058.1| Response regulator receiver:Transcriptional regulatory protein
           [Shewanella piezotolerans WP3]
          Length = 229

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   AL++  +  PD++++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVLEQHGFTTTAAEDYDSALDMLTEPYPDLVLLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IP+I +TA   + D+ R  + G + +I+KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFITKPFSPKELVARIKAVM 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|229102995|ref|ZP_04233684.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-28]
 gi|228680410|gb|EEL34598.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-28]
          Length = 237

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E   ++ +  +E   Y      NG E  +L   H+PD+II+D+ + +  
Sbjct: 1   MKKRILIVEDEENIREVCKRYLEREEYEVYTAVNGREGWDLFLTHRPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|312862953|ref|ZP_07723193.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus vestibularis F0396]
 gi|322516692|ref|ZP_08069601.1| response regulator [Streptococcus vestibularis ATCC 49124]
 gi|311101813|gb|EFQ60016.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus vestibularis F0396]
 gi|322124725|gb|EFX96163.1| response regulator [Streptococcus vestibularis ATCC 49124]
          Length = 235

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAEKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|228477430|ref|ZP_04062066.1| transcriptional regulatory protein [Streptococcus salivarius SK126]
 gi|228250865|gb|EEK10053.1| transcriptional regulatory protein [Streptococcus salivarius SK126]
          Length = 235

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAEKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|225174148|ref|ZP_03728147.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169933|gb|EEG78728.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 231

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IV+D E   +L R  +E  G+      +G EA++ A+   P +II+D+ L ++ G ++
Sbjct: 6   ILIVDDEEHIRELVRLYLEKEGFTVALAADGEEAVQKAKSTTPQLIILDLMLPKLDGWDV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +++++     E+P+I +TA   + D+    + G + Y++KP S    +  +K  +  A
Sbjct: 66  CREVRK---FSEVPIIMLTAKGEEFDKVLGLELGADDYLTKPFSPRELVARVKAILRRA 121


>gi|294084770|ref|YP_003551528.1| winged helix family two component transcriptional regulator
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664343|gb|ADE39444.1| two component transcriptional regulator, winged helix family
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 235

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++I +D    ++L    +  +G+   +  +G +A+ +    +PD+II+D  +  +S
Sbjct: 2   MNAKILIADDEPNQLELLSFNLRQAGFTVFEAADGRQAVNMVEDLQPDLIILDWMMPHMS 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +  +  +E +++PVI ++A   +GD       G + YI+KP S    +  +K  +
Sbjct: 62  GIEVCRLFRSRTETKDLPVIILSARGEEGDRTLGLDTGADDYITKPFSPRELVSRVKALL 121

Query: 121 GEA 123
             A
Sbjct: 122 RRA 124


>gi|109897378|ref|YP_660633.1| two component transcriptional regulator [Pseudoalteromonas
           atlantica T6c]
 gi|332307706|ref|YP_004435557.1| two component transcriptional regulator PhoB, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|109699659|gb|ABG39579.1| two component transcriptional regulator, winged helix family
           [Pseudoalteromonas atlantica T6c]
 gi|332175035|gb|AEE24289.1| two component transcriptional regulator PhoB, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 229

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+V++VED     ++ + ++E SGY  ++  +   ALE   +  PD+I++D  L   S
Sbjct: 1   MAKRVLLVEDEAPIREMLKFVLEQSGYETIEAEDFDVALEKVVEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+    ++IP+I VTA   + D+ R    G + Y++KP S    +  IK  I
Sbjct: 61  GVQLAKRLKQHEFTRDIPIIMVTARGEEEDKVRGLDSGADDYVTKPFSPKELVARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|148380484|ref|YP_001255025.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 3502]
 gi|153932630|ref|YP_001384708.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 19397]
 gi|153937638|ref|YP_001388229.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. Hall]
 gi|148289968|emb|CAL84081.1| two-component response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|152928674|gb|ABS34174.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 19397]
 gi|152933552|gb|ABS39051.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. Hall]
 gi|322806798|emb|CBZ04367.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Clostridium botulinum H04402 065]
          Length = 232

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 73/121 (60%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E + Y  +   NG+EAL +A++ KPD+I++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNSYNCICALNGIEALNIAKEEKPDLILLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|116627886|ref|YP_820505.1| DNA-binding response regulator [Streptococcus thermophilus LMD-9]
 gi|116101163|gb|ABJ66309.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Streptococcus thermophilus LMD-9]
 gi|312278467|gb|ADQ63124.1| Alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus thermophilus ND03]
          Length = 235

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|269791708|ref|YP_003316612.1| two component transcriptional regulator, winged helix family
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099343|gb|ACZ18330.1| two component transcriptional regulator, winged helix family
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 228

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 69/120 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED E   ++  +     GY  +   +G +A++LA    PD+II+D+ L ++ G E
Sbjct: 4   RILVVEDEEGIREILSEAFRRQGYTVMCAADGDQAVDLALTAVPDLIILDLMLPKMDGWE 63

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I+E+ EL+ +PVI +TA   + D     + G + Y+ KP S+   M  ++ ++  +
Sbjct: 64  VCRRIREEQELRHVPVIMLTARRDERDAVAGLEAGADDYVRKPFSIPELMARVRAHLRRS 123


>gi|295101234|emb|CBK98779.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii L2-6]
          Length = 232

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +   GY      +G E LE   Q KPD++++D+ +  + GLE
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTTANDGEEGLEKFNQLKPDMVLLDVMMPRMDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   L   PV+ +TA     D+    + G + Y+ KP      +  IK  +  
Sbjct: 65  VCRRIRK---LGNTPVMMLTAKGETFDKVLGLELGADDYMVKPFDTKEVVARIKAVLRR 120


>gi|326202264|ref|ZP_08192133.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
 gi|325987382|gb|EGD48209.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
          Length = 232

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++IV+D +  + + +  ++  GY  ++  +G EA+ LA    PD+I++DI L ++ 
Sbjct: 1   MSKKILIVDDEKNIVDILKFNLKKEGYDTIEAYDGEEAVNLALSQNPDLILLDIMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + +++++       P++ +TA   + D+    + G + YI+KP S    M  +K  +
Sbjct: 61  GFTVCRKLRQSI---STPILMLTAKEEEVDKVLGLELGADDYITKPFSPRELMARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|225181123|ref|ZP_03734569.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225168092|gb|EEG76897.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 229

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V++V+D +  +K  +  +E  GY  L   +G EAL +  +  PD+I++D+ L ++ G
Sbjct: 1   MPRVLVVDDEKTIVKGLKFNLEKEGYEVLVAFDGEEALRVFNEESPDLIVLDLMLPKLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ + I++     ++P++ +TA     D+    + G + Y++KP +       +K  + 
Sbjct: 61  FEVCRNIRK---TSDVPIVMLTARGEDIDKILGLELGADDYVTKPFNPRELAARVKAIMR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|163814591|ref|ZP_02205980.1| hypothetical protein COPEUT_00742 [Coprococcus eutactus ATCC 27759]
 gi|158450226|gb|EDP27221.1| hypothetical protein COPEUT_00742 [Coprococcus eutactus ATCC 27759]
          Length = 245

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  ++IV+D+E   +L    +    Y      +G EAL+L  ++ PD++++D+ L  +
Sbjct: 1   MSKNNILIVDDDENIAELISLYLNKECYETEIAASGTEALQLFEEYSPDLVLLDVMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++  +I++       P+I ++A     D+    K G + YI KP   +  +  +   
Sbjct: 61  DGYQVCTEIRK---TSNTPIIMLSAKGEVFDKVLGLKIGADDYIVKPFDSNELVARVGAL 117

Query: 120 IGEA 123
           +  +
Sbjct: 118 LRRS 121


>gi|322372853|ref|ZP_08047389.1| DNA-binding response regulator VicR [Streptococcus sp. C150]
 gi|321277895|gb|EFX54964.1| DNA-binding response regulator VicR [Streptococcus sp. C150]
          Length = 236

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE      PD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAENPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|169831576|ref|YP_001717558.1| two component transcriptional regulator [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638420|gb|ACA59926.1| two component transcriptional regulator, winged helix family
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 231

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 68/121 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VED +  ++L R  +E  G+  ++  +G  ALE+    + D++++DI L  + G
Sbjct: 1   MARILVVEDEKHIVELMRYGLEKEGFQVVEANDGDRALEMVHTGRIDLVVLDIMLPGLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + + ++++   ++IPVI ++A   + D     + G + YI+KP S+   +  +K  + 
Sbjct: 61  LTVCRLLRQNERTRDIPVIILSARGQELDRVLGLELGADDYITKPFSVRELVARVKARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|55821169|ref|YP_139611.1| response regulator [Streptococcus thermophilus LMG 18311]
 gi|55737154|gb|AAV60796.1| response regulator (homolog to RR02/MicA Spn & RR02 Sth &VicR Spy)
           [Streptococcus thermophilus LMG 18311]
          Length = 235

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|114327579|ref|YP_744736.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315753|gb|ABI61813.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
          Length = 249

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 62/120 (51%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V+IVED      + R  +E  G+   +  +G EAL    + +PD++++D  L  +SG+E
Sbjct: 23  TVLIVEDEAALATMLRYNLEKQGFRVEEASDGQEALHRLSEVQPDLVLLDWMLPGLSGIE 82

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI+     +++P+I VTA     D  R    G + YI+KP ++      I+  +  A
Sbjct: 83  VCRQIRRKPGTRDLPIIMVTARVEDQDAVRALNTGADDYITKPFNMQALQARIRALLRRA 142


>gi|323701350|ref|ZP_08113024.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533609|gb|EGB23474.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 235

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D    ++L +  +E   +  +   +G E L LA+Q  PD+II+D+ L ++ G
Sbjct: 1   MAKILVVDDETNILELIKYNLEKDNHRVITALDGEEGLRLAQQEPPDLIILDVMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + ++       +P++ V+A     D     + G + YI+KP S       +K  + 
Sbjct: 61  LEVCRCLRSHPSTSRLPILMVSARRETVDHVVGLEMGADDYITKPFSPRELAARVKANLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|134298575|ref|YP_001112071.1| two component transcriptional regulator [Desulfotomaculum reducens
           MI-1]
 gi|134051275|gb|ABO49246.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum reducens MI-1]
          Length = 232

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 67/121 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED +   +L +  +E  G+  +Q  NG  AL++A+   PD+I++DI L    G
Sbjct: 1   MPKILVVEDEQPIRELIKYNLEREGFQVIQAANGDIALDMAKSEVPDIILLDIMLPGQDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + + + +D+  + IP+I ++A   + D+    + G + YI+KP S    +  IK  + 
Sbjct: 61  LSVCRYLHQDAATRSIPIIMLSARGEELDKVLGLEMGADDYITKPFSPRELIARIKARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|148654922|ref|YP_001275127.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148567032|gb|ABQ89177.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 229

 Score =  176 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IV+D      L R  +E  G+  L+  +G + L++ R+  PD++I+D+ + E+ G 
Sbjct: 7   RRILIVDDEPGLRDLVRINLEHEGFSVLEAESGAQGLQMVREQHPDLMILDVMMPEMDGW 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++E     +IPV+ +TA     D     + G + Y++KP ++      I+  +  
Sbjct: 67  EVCRRLRE---FSQIPVLMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLRR 123


>gi|157962787|ref|YP_001502821.1| two component transcriptional regulator [Shewanella pealeana ATCC
           700345]
 gi|157847787|gb|ABV88286.1| two component transcriptional regulator, winged helix family
           [Shewanella pealeana ATCC 700345]
          Length = 229

 Score =  176 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  GY  +   +   AL++  +  PD++++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVLEQHGYTTVAAEDYDSALDMLTEPYPDLVLLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IP+I +TA   + D+ R  + G + +++KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFMTKPFSPKELVARIKAVM 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|323706108|ref|ZP_08117677.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534552|gb|EGB24334.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 235

 Score =  176 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 71/123 (57%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++ED    ++L R  +E  GY  + T NG   LE  ++  PD++++D+ L +I 
Sbjct: 1   MAHTILVIEDEAHILELLRYNLEAQGYNVVLTDNGKGGLEKCKETNPDLVLLDLMLPDID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K D  L+ IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GIDVCKKLKSDEHLKNIPIIMLTAKSEEVDKILGLELGADDYITKPFSIRELLARIKVVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|20808060|ref|NP_623231.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|254478788|ref|ZP_05092156.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20516641|gb|AAM24835.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
 gi|214035300|gb|EEB76006.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 240

 Score =  176 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 73/122 (59%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V+++ED    ++L R  +E +GY  + + NG E LE A + KPD++I+D+ L ++ 
Sbjct: 1   MPYTVLVIEDEIHILELLRYNLEAAGYKVMASENGKEGLEKALEEKPDLLILDLMLPDMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLEI K +K++ + + IP+I +TA + + D+    + G + YI+KP S+   +  IK  +
Sbjct: 61  GLEICKVLKKNEDTKNIPIIMLTARSEEFDKVLGLELGADDYITKPFSVRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|320161338|ref|YP_004174562.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319995191|dbj|BAJ63962.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 239

 Score =  176 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV+IV+D+   ++  +D +    +  L   NG EAL+LA Q  PD++++D+ +  + 
Sbjct: 1   MKPKVLIVDDDPTLLRFLQDFLRAEAFEVLAANNGHEALKLAYQEHPDLVVLDVMMPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+  ++    EL +IP+I +TA   + D+ R  + G + Y++KP S +     I+  +
Sbjct: 61  GWEVCSRL---HELSDIPIILLTAKTSEQDKLRGFQLGVDDYLTKPFSFAELAARIRAIL 117

Query: 121 GEA 123
             A
Sbjct: 118 ARA 120


>gi|119485204|ref|ZP_01619589.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119457432|gb|EAW38557.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 237

 Score =  176 bits (448), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 63/120 (52%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IVED+    +L +  +E  G+     R+G  ALE  +  +PD+I++D+ L  + GLE
Sbjct: 2   KILIVEDDGEIAQLIQQTLENEGFSCETARDGWGALEWFQTQQPDLIVLDLMLPGLDGLE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  +I++   +++  ++ +TA   + D       G + Y+ KP S    +  I+  +  +
Sbjct: 62  VCARIRQQPGVKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPRELVARIRALLRRS 121


>gi|296133628|ref|YP_003640875.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296032206|gb|ADG82974.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 236

 Score =  176 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 69/123 (56%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K+++V+D +  ++L R  +E  GY  +   +G  ALE   + KPD+I++DI L  +
Sbjct: 1   MSKPKILVVDDEQYIVELIRFNLEKEGYTVITAGDGKIALEQTFREKPDLIVLDIMLPGV 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ + ++ D E Q IP+I +TA   + D+    + G + Y++KP S    +  IK  
Sbjct: 61  DGLEVCRTLQRDKETQLIPIIMLTAKGEEIDKVLGLELGADDYMTKPFSPRELVARIKAR 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|288554581|ref|YP_003426516.1| two-component response regulator yycF [Bacillus pseudofirmus OF4]
 gi|288545741|gb|ADC49624.1| two-component response regulator yycF [Bacillus pseudofirmus OF4]
          Length = 236

 Score =  176 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  +E  G+      +G EA+E  ++ +PD+I++DI L    
Sbjct: 1   MDKRILVVDDEKPIADILKFNLEKEGFEVFCAYDGNEAVEQVKKEEPDLILLDIMLPHKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     +IP+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKS---YDIPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|219667295|ref|YP_002457730.1| transcriptional regulator [Desulfitobacterium hafniense DCB-2]
 gi|219537555|gb|ACL19294.1| two component transcriptional regulator, winged helix family
           [Desulfitobacterium hafniense DCB-2]
          Length = 234

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 68/121 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED+ +  +L    +E  GY  +    G +ALEL  + KPD++++D+ L E+ G
Sbjct: 1   MVKILLVEDDAVIQELVTYNLEREGYTVMIAEEGNKALELLNKEKPDLVLLDVMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++ K+I+ + E   IP+I ++A     D     + G + YI+KP S    +  IK  + 
Sbjct: 61  LDVCKKIRGNQETANIPLIMLSARDEVADRVIGLELGADDYITKPFSPRELLARIKARLR 120

Query: 122 E 122
           E
Sbjct: 121 E 121


>gi|320160793|ref|YP_004174017.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319994646|dbj|BAJ63417.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 239

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M    +++V+D      L R  +E +GY+     NG EALEL    +PD++I+D+ +  +
Sbjct: 1   MAATHILVVDDEPRYQHLLRVNLEAAGYLVSTASNGEEALELISSRQPDLVILDVMMPHL 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G    ++I++      +P+I +TA   + D  +    G + Y+ KP S +  +  ++  
Sbjct: 61  DGFSTCERIRQ---FSSVPIIMLTAKGEEQDRVKGLNVGADDYVVKPFSATELIARVRAV 117

Query: 120 IGEA 123
           +  A
Sbjct: 118 LRRA 121


>gi|259047884|ref|ZP_05738285.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
 gi|259035561|gb|EEW36816.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
          Length = 238

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   G+  +   +G E L    +  PD++I+D+ L +I G
Sbjct: 1   MKKILVVDDEKPISDIVKFSLSKEGFEVITAFDGEEGLAAFHEKNPDLVILDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I++      +P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVCREIRK---TSHVPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|295104470|emb|CBL02014.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii SL3/3]
          Length = 232

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +   GY      +G E LE     KPD++++D+ +  + GLE
Sbjct: 5   KILVVDDDANICELLRLYLTKEGYQVTVANDGEEGLEKFNAVKPDMVLLDVMMPRMDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++       PV+ +TA     D+    + G + Y+ KP      +  IK  +  
Sbjct: 65  VCRRIRKAG---NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|13324642|gb|AAK18824.1|AF327739_1 response regulator Rr1 [Streptococcus thermophilus]
          Length = 235

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LEI K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEIVKEIRK---TSHTPIIMLSAKDSEFDKVVGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|313112960|ref|ZP_07798604.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624725|gb|EFQ08036.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 232

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +   GY      +G E LE   Q KPD++++D+ + ++ GLE
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTVANDGEEGLEKFNQVKPDMVLLDVMMPKMDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++       PV+ +TA     D+    + G + Y+ KP      +  IK  +  
Sbjct: 65  VCRRIRKAG---NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|220903843|ref|YP_002479155.1| winged helix family two component transcriptional regulator
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868142|gb|ACL48477.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 225

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++IVED     +L R  +E  G+  L+  +G EAL LARQH PD++++D+ +    
Sbjct: 1   MSQQILIVEDEADIRELLRFNLEREGFSVLEAADGNEALRLARQHLPDLMLLDVMMPGPD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G EI + +   +E   IPV+ +TA   + D       G + Y+ KP S+   M  I+  +
Sbjct: 61  GFEICRLLGAQAETAHIPVLMLTARGEEMDRVVGLSLGADDYVVKPFSVRELMLRIRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|330684068|gb|EGG95823.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis VCU121]
          Length = 236

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EAL+     +PD+I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALQKVESSQPDLIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|308050509|ref|YP_003914075.1| two component transcriptional regulator, winged helix family
           [Ferrimonas balearica DSM 9799]
 gi|307632699|gb|ADN77001.1| two component transcriptional regulator, winged helix family
           [Ferrimonas balearica DSM 9799]
          Length = 229

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 62/123 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IVED     ++   +++  G+      +  + L    +  PD++++D  L   S
Sbjct: 1   MTANILIVEDESAIREMLTFVLDQHGFRTTSAADYDQGLNAISEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +++D   ++IP+I +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKALRQDEHTRQIPIIMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|55823082|ref|YP_141523.1| response regulator [Streptococcus thermophilus CNRZ1066]
 gi|55739067|gb|AAV62708.1| response regulator (homolog to RR02/MicA Spn & RR02 Sth &VicR Spy)
           [Streptococcus thermophilus CNRZ1066]
          Length = 235

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D      + +  +   GY  +   +G EALE     KPD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LEI K+I++       P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEIVKEIRK---TSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|295094559|emb|CBK83650.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Coprococcus sp.
           ART55/1]
          Length = 244

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 4/124 (3%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  ++IV+D+E   +L    +    Y      +G EAL+L  ++ PD++++D+ L  +
Sbjct: 1   MSKNNILIVDDDENIAELISLYLNKECYETEIAASGTEALQLFEEYSPDLVLLDVMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++  +I++       P+I ++A     D+    K G + YI KP   +  +  +   
Sbjct: 61  DGYQVCTEIRK---TSNTPIIMLSAKGEVFDKVLGLKIGADDYIVKPFDSNELVARVGAL 117

Query: 120 IGEA 123
           +  +
Sbjct: 118 LRRS 121


>gi|323699409|ref|ZP_08111321.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio sp. ND132]
 gi|323459341|gb|EGB15206.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio desulfuricans ND132]
          Length = 228

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 1/123 (0%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M  +K+++VED+    +L +  +  +G+      +G   L LA   KPD+I++D+ +   
Sbjct: 1   MSAQKILVVEDHRDTRELLKYNLTAAGFDVAAAEDGQLGLNLAHAFKPDIILLDLMMPGT 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ +Q+K D     IPVI +TA   + D+    + G + Y+ KP S    +  IK  
Sbjct: 61  DGLEVCRQLKGDPATARIPVIMLTAKGEEVDKIVGLELGADDYVVKPFSPRELVLRIKAI 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|291547005|emb|CBL20113.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus sp. SR1/5]
          Length = 229

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +L +K  R  +E  G       +G EALE A+  + D+I++D+ L ++ 
Sbjct: 1   MSRKVLVVDDEKLIVKGLRFSLEQDGMEVDCAYDGEEALEKAKAGEYDIILLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E      +P+I +TA     D+    + G + Y++KP ++      IK  I
Sbjct: 61  GLEVCQQIRE---FSNVPIIMLTAKGEDMDKILGLEYGADDYVTKPFNILEVKARIKAII 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|311069407|ref|YP_003974330.1| two-component response regulator [Bacillus atrophaeus 1942]
 gi|310869924|gb|ADP33399.1| two-component response regulator [Bacillus atrophaeus 1942]
          Length = 240

 Score =  175 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MSKKILVVDDEESIVTLLQYNLERSGYEVVTASDGEEALKQAETEKPDLIVLDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|229099893|ref|ZP_04230816.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
 gi|229106054|ref|ZP_04236673.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|229118956|ref|ZP_04248301.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228664481|gb|EEL19977.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228677373|gb|EEL31631.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|228683508|gb|EEL37463.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
          Length = 234

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I+++SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKNSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|255525674|ref|ZP_05392607.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296185432|ref|ZP_06853842.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
 gi|255510660|gb|EET86967.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296050266|gb|EFG89690.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
          Length = 231

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 71/119 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D E   +L +  +E SGY  +   NG++A++ A++  P++I++DI L  + G +
Sbjct: 5   KILIVDDEEHITELIKFNLENSGYKTICADNGLDAIKKAKRDTPNLILLDIMLPGMDGYD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+I++D+ +   P+I +TA   + D+    + G + YI+KP S+   +  +K  +  
Sbjct: 65  VCKEIRKDNSISSTPIIMITAKGEEFDKVLGLELGADDYITKPFSIRELLARVKAILRR 123


>gi|224476783|ref|YP_002634389.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222421390|emb|CAL28204.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 238

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +  + L +  +ET+GYI     +G EAL+     +PD++++D+ L ++ 
Sbjct: 1   MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALQKLDAVQPDLVVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|292492323|ref|YP_003527762.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus halophilus Nc4]
 gi|291580918|gb|ADE15375.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus halophilus Nc4]
          Length = 229

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 63/123 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D     ++   ++   GY      +  +A +   +  PD+I++D  L  IS
Sbjct: 1   MPATILVVDDETAIREMLGFVLTQEGYNYQAAADAEQAWQRLNESHPDLILLDWMLPGIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ +++K +   + +P+I +TA   + D+ R    G + YI+KP S +  +  +K  +
Sbjct: 61  GVDLARRLKREPNTRSLPLIMLTARDDEEDKVRGLNVGADDYITKPFSPTELIARVKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|15894977|ref|NP_348326.1| response regulator [Clostridium acetobutylicum ATCC 824]
 gi|15024664|gb|AAK79666.1|AE007679_12 Response regulator (CheY-like receiver domain and DNA-binding HTH
           domain) [Clostridium acetobutylicum ATCC 824]
 gi|325509114|gb|ADZ20750.1| Response regulator (CheY-like receiver domain and DNA-binding HTH
           domain) [Clostridium acetobutylicum EA 2018]
          Length = 232

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 68/119 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D E  +KL +  +E +GY  +   +G EALE A+   P ++++D+ L  + G +
Sbjct: 5   KILVVDDEEHIVKLIKFNLENNGYKVITAADGGEALEKAKGEVPQLVLLDLMLPVMDGYD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I+ D  +  +PVI +TA   + D+    + G + YI+KP S+   +  +K  +  
Sbjct: 65  VCREIRRDQSISNMPVIMITAKGEELDKILGLELGADDYITKPFSVRELVARVKAVLRR 123


>gi|119774211|ref|YP_926951.1| response regulator receiver protein [Shewanella amazonensis SB2B]
 gi|119766711|gb|ABL99281.1| two component transcriptional regulator, winged helix family
           [Shewanella amazonensis SB2B]
          Length = 229

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   AL   ++  PD+I++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVMEQHGFTTSVAEDFDSALGQLQEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IPVI +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDEFTRQIPVIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|160942672|ref|ZP_02089915.1| hypothetical protein FAEPRAM212_00144 [Faecalibacterium prausnitzii
           M21/2]
 gi|158446027|gb|EDP23030.1| hypothetical protein FAEPRAM212_00144 [Faecalibacterium prausnitzii
           M21/2]
          Length = 232

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +   GY      +G E LE     KPD++++D+ +  + GLE
Sbjct: 5   KILVVDDDANICELLRLYLTKEGYQVTVANDGEEGLEKFNAVKPDMVLLDVMMPRMDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++       PV+ +TA     D+    + G + Y+ KP      +  IK  +  
Sbjct: 65  VCRRIRKAG---NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|199597665|ref|ZP_03211093.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|258509808|ref|YP_003172559.1| two-component response regulator [Lactobacillus rhamnosus GG]
 gi|258540993|ref|YP_003175492.1| two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|199591472|gb|EDY99550.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|257149735|emb|CAR88708.1| Two-component response regulator [Lactobacillus rhamnosus GG]
 gi|257152669|emb|CAR91641.1| Two-component response regulator [Lactobacillus rhamnosus Lc 705]
          Length = 237

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 1   MAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVESESPDLILLDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+++    + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVARQIRKE---HDTPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|117619543|ref|YP_855794.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560950|gb|ABK37898.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 229

 Score =  175 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E  GY  ++  +  + L   R+  P++I++D  +   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQKGYETVEAEDFADGLAKVREPYPELIVLDWMMPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  KQ+K+D   ++IPV+ +TA   + D+ R  + G + YI+KP S       +   +
Sbjct: 61  GIQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|228905410|ref|ZP_04069365.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
 gi|228968616|ref|ZP_04129601.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228791108|gb|EEM38725.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228854230|gb|EEM98933.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
          Length = 234

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|78044728|ref|YP_360866.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996843|gb|ABB15742.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 231

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 69/119 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D    ++L +  +E  GY  L+  +G+ ALE+ ++  PD++I+DI L  +SGLE
Sbjct: 2   KILVVDDEAPIVELIKFNLEREGYKVLEAYDGIRALEIVKKELPDLVILDIMLPGMSGLE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I+ + +  EIP+I ++A   + D+    + G + Y+ KP S    +  +K  +  
Sbjct: 62  VCKNIRNNEKTAEIPIIMLSARGEEVDKILGLELGADDYMVKPFSPRELVARVKARLRR 120


>gi|260892544|ref|YP_003238641.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260864685|gb|ACX51791.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 236

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
             V++VED+    +L    +E  G+  L+  +G EALE+ +    D++++D+ L  I G 
Sbjct: 8   ATVLVVEDDRNIAELVSLYLEKHGFKVLKAASGAEALEILKNETVDLVVLDLMLPGIDGW 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +QI+ +S+L   PVI +TA     D+ +  + G + Y+ KP      +  +K  +  
Sbjct: 68  EVCRQIRSNSQL---PVIMLTAKGELQDKLQGFELGADDYVVKPFDPQELIARVKAVLRR 124

Query: 123 A 123
           A
Sbjct: 125 A 125


>gi|313890279|ref|ZP_07823913.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121384|gb|EFR44489.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pseudoporcinus SPIN 20026]
          Length = 236

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+    + KPD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIMTAFDGREAIAAFEEGKPDLVILDLMLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|74316234|ref|YP_313974.1| two component transcriptional regulator [Thiobacillus denitrificans
           ATCC 25259]
 gi|74055729|gb|AAZ96169.1| Two component Transcriptional regulator, Winged helix family
           [Thiobacillus denitrificans ATCC 25259]
          Length = 230

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L +  +  +G+      +   AL+  +   PDVI++D  L  +S
Sbjct: 1   MAANILLVEDEPGIQELLKFNLTQAGHQVTAAGDAEHALKFLKTTLPDVILLDWMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ ++++ D+  Q +P+I +TA   + D+      G + YI+KP S    +  IK  +
Sbjct: 61  GIDLCRRLRGDARYQPVPIIMLTARGEERDKVLGLDTGADDYITKPFSPRELVSRIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|24373128|ref|NP_717171.1| phosphate regulon response regulator PhoB [Shewanella oneidensis
           MR-1]
 gi|24347327|gb|AAN54615.1|AE015602_1 phosphate regulon response regulator PhoB [Shewanella oneidensis
           MR-1]
          Length = 239

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   A+ L ++  PD+I++D      S
Sbjct: 11  MTARILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALLKEPYPDLILLDWMFPGGS 70

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 71  GIQLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 130

Query: 121 GEA 123
             +
Sbjct: 131 RRS 133


>gi|315158433|gb|EFU02450.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0312]
          Length = 234

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 69/121 (57%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +  +++ +  +   GY      +G EALE   + +PD+II+D+ L ++ G
Sbjct: 1   MKKILVVDDEKPILEIVKYNLVKEGYEVFTAYDGEEALEKVEEVEPDLIILDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|89896867|ref|YP_520354.1| hypothetical protein DSY4121 [Desulfitobacterium hafniense Y51]
 gi|89336315|dbj|BAE85910.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 238

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 67/121 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++VED+ +  +L    ++  GY  +    G  AL+L  + KPD++++D+ L E+ G
Sbjct: 5   MVKILLVEDDVIIQELVNYNLQREGYTVIIAEEGNSALQLLDKEKPDLVLLDVMLPELDG 64

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I+ + E   +P+I ++A     D     + G + Y++KP S    +  IK  + 
Sbjct: 65  LEVCKKIRGNQETASLPIIMLSARDEVADRVIGLELGADDYVTKPFSPRELLARIKARLR 124

Query: 122 E 122
           E
Sbjct: 125 E 125


>gi|187479560|ref|YP_787585.1| phosphate regulon two-component response regulator [Bordetella
           avium 197N]
 gi|115424147|emb|CAJ50700.1| phosphate regulon two-component response regulator [Bordetella
           avium 197N]
          Length = 232

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L  +S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + +++++D   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLSLARKLRDDERTRNVPVIMLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|170727789|ref|YP_001761815.1| two component transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169813136|gb|ACA87720.1| two component transcriptional regulator, winged helix family
           [Shewanella woodyi ATCC 51908]
          Length = 229

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G++     +   AL+L  +  PD++++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVLEQHGFVTSAAEDFDSALDLLTEPYPDLVLLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   ++IP+I +TA   + D+ R  + G + Y++KP S    +  IK  I
Sbjct: 61  GIQLAKRMRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYMTKPFSPKELVARIKAVI 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|288553693|ref|YP_003425628.1| two-component response regulator [Bacillus pseudofirmus OF4]
 gi|288544853|gb|ADC48736.1| two-component response regulator involved in phosphate regulation
           [Bacillus pseudofirmus OF4]
          Length = 241

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D E    L +  +E SG+      +G E L LA+    D++I+D+ L +I 
Sbjct: 1   MAQRILVVDDEESIATLLQFNLEQSGFEVTVASDGEEGLALAKDEPFDLLILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+I KQ++++ ++   P++ +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GLDICKQLRQNKKM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVRAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|228911305|ref|ZP_04075109.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
 gi|228848323|gb|EEM93173.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
          Length = 234

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|229065125|ref|ZP_04200418.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
 gi|228716154|gb|EEL67873.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
          Length = 234

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|3236110|emb|CAA04532.1| arcA [Lactococcus lactis]
          Length = 233

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   G+      +G EALE  ++ +PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQPDLILLDLMLPKLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++ ++I++     + P+I V+A   + D+    + G + Y++KP S    +  IK  + 
Sbjct: 61  LDVAREIRK---TSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|163943242|ref|YP_001642472.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|163865439|gb|ABY46497.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
          Length = 236

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IVED E   ++ +  +E   Y      NG E  ++   H+PD+II+D+ + +  G
Sbjct: 1   MKKILIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDVFLTHQPDLIILDLMMPKKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+  +I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  + 
Sbjct: 61  WELCGEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIILR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|226948317|ref|YP_002803408.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|226841453|gb|ACO84119.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|322805369|emb|CBZ02933.1| two-component response regulator [Clostridium botulinum H04402 065]
          Length = 233

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 68/125 (54%), Gaps = 6/125 (4%)

Query: 2   LK---KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           +K   K+++V+D E  + + +  +E  GY  +   +G EA++L ++    ++I+D+ L +
Sbjct: 1   MKEFFKILVVDDEERILDVVKAYLEKEGYEVITAMDGEEAIKLFKEISFHLVILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           ISG E+  +I+E      +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 61  ISGEEVCSKIRE---FSNVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|229119190|ref|ZP_04248509.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|228664279|gb|EEL19801.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
          Length = 256

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++V+IVED E   ++ +  +E   Y      NG E  +L   H+PD+II+D+ + +  
Sbjct: 20  MKRRVLIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDLFLTHQPDLIILDLMMPKKD 79

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 80  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTMGADDYVTKPFSPRELVLRVQIIL 136

Query: 121 GE 122
             
Sbjct: 137 RR 138


>gi|218900607|ref|YP_002449018.1| DNA-binding response regulator YycF [Bacillus cereus G9842]
 gi|218545115|gb|ACK97509.1| DNA-binding response regulator YycF [Bacillus cereus G9842]
          Length = 235

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|167624972|ref|YP_001675266.1| two component transcriptional regulator [Shewanella halifaxensis
           HAW-EB4]
 gi|167354994|gb|ABZ77607.1| two component transcriptional regulator, winged helix family
           [Shewanella halifaxensis HAW-EB4]
          Length = 229

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   AL +  +  PD++++D      +
Sbjct: 1   MTARILIVEDELAIREMLTFVLEQHGFTTAAAEDYDSALAMLTEPYPDLVLLDWMFPGGN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   + IP+I +TA   + D+ R  + G + +++KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFMTKPFSPKELVARIKAVM 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|296133811|ref|YP_003641058.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296032389|gb|ADG83157.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 235

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 70/121 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IV+D    ++L R +++  G+     ++G+ A++    ++PD+I++D+ L  I G
Sbjct: 1   MAKILIVDDEHHIIELVRFVLQKEGFDVKVAQDGLTAIKETENYRPDLILLDLMLPGIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + +++  E  +IPVI VTA + + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVCRTLRKKPETADIPVIMVTAKSDEMDKIIGLELGADDYVTKPFSPRELVARVKARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|229014632|ref|ZP_04171746.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
 gi|229136291|ref|ZP_04265038.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|229170168|ref|ZP_04297855.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|228613313|gb|EEK70451.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|228647163|gb|EEL03251.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|228746643|gb|EEL96532.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
          Length = 234

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|228924210|ref|ZP_04087481.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
 gi|228942615|ref|ZP_04105147.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228955717|ref|ZP_04117712.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228975545|ref|ZP_04136097.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228982181|ref|ZP_04142470.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|229035124|ref|ZP_04189070.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
 gi|229051135|ref|ZP_04194679.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|229072931|ref|ZP_04206127.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|229082674|ref|ZP_04215131.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|229112879|ref|ZP_04242410.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|229130712|ref|ZP_04259665.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|229148016|ref|ZP_04276355.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|229164416|ref|ZP_04292345.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
 gi|229193717|ref|ZP_04320658.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|228589742|gb|EEK47620.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|228619066|gb|EEK75963.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
 gi|228635441|gb|EEK91932.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|228652729|gb|EEL08614.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|228670558|gb|EEL25871.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|228700635|gb|EEL53164.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|228710177|gb|EEL62155.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|228722198|gb|EEL73599.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|228728190|gb|EEL79220.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
 gi|228777533|gb|EEM25811.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|228784155|gb|EEM32182.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228803945|gb|EEM50569.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228817041|gb|EEM63134.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228835428|gb|EEM80798.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
          Length = 234

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|116496230|ref|YP_807964.1| DNA-binding response regulator [Lactobacillus casei ATCC 334]
 gi|191639755|ref|YP_001988921.1| Putative response regulator [Lactobacillus casei BL23]
 gi|239630681|ref|ZP_04673712.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301067832|ref|YP_003789855.1| OmpR family DNA-binding response regulator [Lactobacillus casei
           str. Zhang]
 gi|116106380|gb|ABJ71522.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei ATCC 334]
 gi|190714057|emb|CAQ68063.1| Putative response regulator [Lactobacillus casei BL23]
 gi|239526964|gb|EEQ65965.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300440239|gb|ADK20005.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei str. Zhang]
          Length = 237

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 1   MAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVEAESPDLILLDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+++    + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVARQIRKE---HDTPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|229176141|ref|ZP_04303634.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
 gi|228607376|gb|EEK64705.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
          Length = 234

 Score =  174 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|257440065|ref|ZP_05615820.1| DNA-binding response regulator SrrA [Faecalibacterium prausnitzii
           A2-165]
 gi|257197417|gb|EEU95701.1| DNA-binding response regulator SrrA [Faecalibacterium prausnitzii
           A2-165]
          Length = 232

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +   GY      +G E L+   Q KPD++++D+ + ++ GLE
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTTANDGEEGLDKFNQVKPDMVLLDVMMPKMDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   L   PV+ +TA     D+    + G + Y+ KP      +  IK  +  
Sbjct: 65  VCRRIRK---LGNTPVMMLTAKGETFDKVLGLELGADDYMVKPFDTKEVVARIKAVLRR 120


>gi|225728859|ref|YP_002735123.1| response regulator protein [Streptococcus uberis 0140J]
 gi|222113533|emb|CAR41322.1| response regulator protein [Streptococcus uberis 0140J]
          Length = 236

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+    + KPD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGKEAVLAFEEEKPDLVILDLMLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|156744350|ref|YP_001434479.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156235678|gb|ABU60461.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 229

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IV+D      L R  +E  G+  ++  +G + L++ R   PD++I+D+ + E+ G 
Sbjct: 7   RRILIVDDEPGLRDLLRINLEHEGFSVIEAESGAQGLQMVRDQHPDLMILDVMMPEMDGW 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++E     ++PV+ +TA     D     + G + Y++KP ++      I+  +  
Sbjct: 67  EVCRRLRE---FSQMPVLMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLRR 123


>gi|313905040|ref|ZP_07838410.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
 gi|313470110|gb|EFR65442.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
          Length = 229

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +V++V+D +L +K  R  +E  GY      +G EAL +A+++  D+I++D+ L +++
Sbjct: 1   MANRVLVVDDEKLIVKGIRFSLEQDGYEVSCAYDGEEALNMAKENTYDIILLDLMLPKMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ +QI+E      +P+I +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GLDVCQQIRE---FSSVPIIMLTAKGEDMDKIMGLEYGADDYITKPFNILEVKARIKAIL 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|172056682|ref|YP_001813142.1| two component transcriptional regulator [Exiguobacterium sibiricum
           255-15]
 gi|171989203|gb|ACB60125.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sibiricum 255-15]
          Length = 228

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D      L    ++   Y      NG EAL+L ++    ++++D+ + E+ GL 
Sbjct: 7   KILVVDDEAQMRDLLVSNLQKENYQTTTASNGQEALDLMQRDAFHLVLLDVMMPEMDGLT 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
              +I+E      +P+I +TA + + D     K G + YI+KP S    +  I+  +  +
Sbjct: 67  ACMRIRE---FSNVPIIMLTARSDELDRIHGLKIGADDYITKPFSPRELLARIEATLRRS 123


>gi|113478264|ref|YP_724325.1| two component transcriptional regulator [Trichodesmium erythraeum
           IMS101]
 gi|110169312|gb|ABG53852.1| two component transcriptional regulator, winged helix family
           [Trichodesmium erythraeum IMS101]
          Length = 257

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q  PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAIAELVAVNLEMAGYEVSQAEDGIKGQALALQLLPDLIVLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IPV+ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTADIPVLMLTALGQTQDKVEGFNAGADDYLTKPFEIEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|330830656|ref|YP_004393608.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas veronii B565]
 gi|328805792|gb|AEB50991.1| Phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas veronii B565]
          Length = 229

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E  GY  ++  +  + L   R+  P++I++D  +   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQKGYETIEAEDYADGLAKVREPYPELIVLDWMMPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  KQ+K+D   ++IPV+ +TA   + D+ R  + G + YI+KP S       +   +
Sbjct: 61  GIQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|229551249|ref|ZP_04439974.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|229315412|gb|EEN81385.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|259651071|dbj|BAI43233.1| two-component response regulator [Lactobacillus rhamnosus GG]
          Length = 238

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 2   MAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVESESPDLILLDLMLPKID 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+++    + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 62  GLEVARQIRKE---HDTPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|147679020|ref|YP_001213235.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146275117|dbj|BAF60866.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 228

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D EL   L R  +E  G+     R+G EAL       PD++I+DI L ++ G  
Sbjct: 5   TILVVDDEELVQDLIRLYLEKEGFRVEVARDGEEALAKLGFANPDLVILDIMLPKMDGWA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I++       P+I +TA   + D     + G + Y+ KP S    +  IK  +  A
Sbjct: 65  VCREIRK---TMATPIIMLTAKGEEFDRVLGLELGADDYVCKPFSPIELVARIKAVLRRA 121


>gi|332286633|ref|YP_004418544.1| phosphate regulon two-component response regulator [Pusillimonas
           sp. T7-7]
 gi|330430586|gb|AEC21920.1| phosphate regulon two-component response regulator [Pusillimonas
           sp. T7-7]
          Length = 233

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 60/122 (49%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSTTILVVEDEPAIQELISVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGAS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + + ++ D   + +PVI +TA   + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GITLARTLRSDERTRHVPVIMLTAKGAEHDKVEGLEAGADDYITKPFSPKELIARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|320547235|ref|ZP_08041528.1| DNA-binding response regulator [Streptococcus equinus ATCC 9812]
 gi|320448123|gb|EFW88873.1| DNA-binding response regulator [Streptococcus equinus ATCC 9812]
          Length = 236

 Score =  174 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+E   +  PD+II+D+ L  + G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAIEKFEEENPDLIILDLMLPGLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K++++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|333025498|ref|ZP_08453562.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332745350|gb|EGJ75791.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 264

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+D     +  R  +   GY      +G EAL+ A    PD++++DIQ+  + GL
Sbjct: 33  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALQKAAATPPDLVVLDIQMPGMDGL 92

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 93  TAARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 150

Query: 123 A 123
           +
Sbjct: 151 S 151


>gi|154496344|ref|ZP_02035040.1| hypothetical protein BACCAP_00632 [Bacteroides capillosus ATCC
           29799]
 gi|150274427|gb|EDN01504.1| hypothetical protein BACCAP_00632 [Bacteroides capillosus ATCC
           29799]
          Length = 230

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV+IVED     +L    +E  GY      +G + +EL R   PD++++DI L  + 
Sbjct: 1   MAQKVLIVEDEANIAELLHLYLEKEGYETAVAPDGGKGVELFRSFHPDLVLLDIMLPVMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + K+I+E  +    PVI +TA     D+    +GG + YI KP  +   +  I   +
Sbjct: 61  GWSVLKKIRESDKT---PVIMLTAKGETEDKVHGLEGGADDYIVKPFEMKEVLARIHAVL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|225868178|ref|YP_002744126.1| response regulator protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701454|emb|CAW98586.1| response regulator protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 236

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDTVTAFDGKEAVAVFEEEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|152977665|ref|YP_001377182.1| two component transcriptional regulator [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152026417|gb|ABS24187.1| two component transcriptional regulator, winged helix family
           [Bacillus cytotoxicus NVH 391-98]
          Length = 235

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|323701174|ref|ZP_08112849.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533776|gb|EGB23640.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 230

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 61/122 (50%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++I +D E   +L R  +E  G+   +  +G + L++ +    D++++D+ +  + G
Sbjct: 1   MKTILIADDEERIRQLVRLYLEAEGFTVCEAEDGQQVLDIVKSQPIDLVLLDLMMPVLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + K ++ +   ++IP++ +TA   + D       G + YI KP S    +  +K  + 
Sbjct: 61  WTVCKMLRRE---RKIPIVMLTAKGEENDRVLGLDLGADDYIVKPFSTRELVARVKAVLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|228918078|ref|ZP_04081606.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228930472|ref|ZP_04093472.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228936746|ref|ZP_04099537.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228949188|ref|ZP_04111456.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228988693|ref|ZP_04148779.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|229094577|ref|ZP_04225644.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|229124969|ref|ZP_04254143.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|229142215|ref|ZP_04270739.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|229159026|ref|ZP_04287082.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|229187695|ref|ZP_04314831.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|229199595|ref|ZP_04326256.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|228584000|gb|EEK42157.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|228595763|gb|EEK53447.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|228624445|gb|EEK81216.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|228641233|gb|EEK97540.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|228658470|gb|EEL14136.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|228688824|gb|EEL42655.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|228771144|gb|EEM19624.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|228810471|gb|EEM56824.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228822955|gb|EEM68796.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228829191|gb|EEM74828.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228841558|gb|EEM86674.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
          Length = 234

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L    
Sbjct: 1   MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKATEEQPDMVLLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|15672379|ref|NP_266553.1| two-component system regulator [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116511254|ref|YP_808470.1| DNA-binding response regulator [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125623281|ref|YP_001031764.1| two-component system regulator [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281490939|ref|YP_003352919.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           KF147]
 gi|12483717|gb|AAG53732.1|AF178425_2 RrC [Lactococcus lactis subsp. cremoris MG1363]
 gi|12723270|gb|AAK04495.1|AE006276_10 two-component system regulator [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116106908|gb|ABJ72048.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactococcus lactis subsp. cremoris SK11]
 gi|124492089|emb|CAL97018.1| two-component system regulator [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281374697|gb|ADA64217.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           KF147]
 gi|300070032|gb|ADJ59432.1| Two-component response regulator [Lactococcus lactis subsp.
           cremoris NZ9000]
 gi|326405973|gb|ADZ63044.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           CV56]
          Length = 233

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   G+      +G EALE  ++ +PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQPDLILLDLMLPKLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++ ++I++     + P+I V+A   + D+    + G + Y++KP S    +  IK  + 
Sbjct: 61  LDVAREIRK---TSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|294139921|ref|YP_003555899.1| phosphate regulon response regulator PhoB [Shewanella violacea
           DSS12]
 gi|293326390|dbj|BAJ01121.1| phosphate regulon response regulator PhoB [Shewanella violacea
           DSS12]
          Length = 229

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IVED     ++   +++  G+      +   A+ +  +  PD+I++D      S
Sbjct: 1   MTAKILIVEDESAIREMLAFVLDQHGFNTTSAEDFDSAINMISEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++++D   ++IP+I +TA   + D+ R  + G + Y++KP S    +  IK  +
Sbjct: 61  GIQLAKRLRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYMTKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|146292399|ref|YP_001182823.1| two component transcriptional regulator [Shewanella putrefaciens
           CN-32]
 gi|145564089|gb|ABP75024.1| two component transcriptional regulator, winged helix family
           [Shewanella putrefaciens CN-32]
          Length = 229

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   A+ L ++  PD+I++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALLKEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|30023491|ref|NP_835122.1| two-component response regulator yycF [Bacillus cereus ATCC 14579]
 gi|206970303|ref|ZP_03231256.1| DNA-binding response regulator YycF [Bacillus cereus AH1134]
 gi|218232846|ref|YP_002370241.1| DNA-binding response regulator YycF [Bacillus cereus B4264]
 gi|228961729|ref|ZP_04123333.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|229153624|ref|ZP_04281801.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1550]
 gi|229181712|ref|ZP_04309035.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 172560W]
 gi|296505894|ref|YP_003667594.1| two-component response regulator yycF [Bacillus thuringiensis
           BMB171]
 gi|29899052|gb|AAP12323.1| Two-component response regulator yycF [Bacillus cereus ATCC 14579]
 gi|206734880|gb|EDZ52049.1| DNA-binding response regulator YycF [Bacillus cereus AH1134]
 gi|218160803|gb|ACK60795.1| DNA-binding response regulator YycF [Bacillus cereus B4264]
 gi|228601745|gb|EEK59243.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 172560W]
 gi|228629853|gb|EEK86505.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1550]
 gi|228797964|gb|EEM44973.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|296326946|gb|ADH09874.1| two-component response regulator yycF [Bacillus thuringiensis
           BMB171]
 gi|326943264|gb|AEA19160.1| two-component response regulator yycF [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 235

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|163943146|ref|YP_001648030.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|229020691|ref|ZP_04177419.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1273]
 gi|229026906|ref|ZP_04183230.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1272]
 gi|163865343|gb|ABY46402.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
 gi|228734409|gb|EEL85079.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1272]
 gi|228740606|gb|EEL90876.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1273]
          Length = 235

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|330447454|ref|ZP_08311103.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491645|dbj|GAA05600.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 1114

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 66/116 (56%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D  +N+++  + +  +GY      NG +AL +  + +PD+I++DI + E+SG E+
Sbjct: 707 ILVVDDEPVNLQILNNFLRLAGYRVKTAENGPQALAMVEEQRPDLILLDIMMPEMSGYEV 766

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +++   + E+P++ ++A     D  +  + G   Y++KP +    +  I+ Y+
Sbjct: 767 CTILRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYL 822


>gi|295838770|ref|ZP_06825703.1| DNA-binding response regulator ResD [Streptomyces sp. SPB74]
 gi|295827181|gb|EFG65293.1| DNA-binding response regulator ResD [Streptomyces sp. SPB74]
          Length = 345

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++V+D+    ++    ++ +GY      +G  AL  A  H+PD++++D+ L  + GLE
Sbjct: 15  HVLVVDDDPTVAEVVAGYLDRAGYTVDLAGDGPSALARAHAHRPDLVVLDLMLPGMDGLE 74

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++E +    +PV+ +TA   + D     + G + Y++KP S    +  +   +  
Sbjct: 75  VCRRLRERAA---VPVVMLTARGDEEDRVLGLEQGADDYVTKPFSPRELVLRVASVLRR 130


>gi|304320850|ref|YP_003854493.1| phosphate regulon response regulator PhoB [Parvularcula bermudensis
           HTCC2503]
 gi|303299752|gb|ADM09351.1| phosphate regulon response regulator PhoB [Parvularcula bermudensis
           HTCC2503]
          Length = 230

 Score =  174 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 66/120 (55%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IVED E    L    +   GY  L   +G EAL    + KPD+I++D  L ++SG+E
Sbjct: 5   RILIVEDEETIAGLLEYNLSREGYETLIAEDGEEALIQIEESKPDLIVLDWMLPKVSGIE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++   E + IP+I +TA A +GD  R    G + Y+ KP S+S     IK  +  A
Sbjct: 65  VCRRLRMKPETEGIPIILLTARAEEGDRVRGLDTGADDYVVKPFSVSELSSRIKAVLRRA 124


>gi|300118833|ref|ZP_07056553.1| DNA-binding response regulator YycF [Bacillus cereus SJ1]
 gi|298723801|gb|EFI64523.1| DNA-binding response regulator YycF [Bacillus cereus SJ1]
          Length = 235

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKASEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|229000526|ref|ZP_04160071.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock3-17]
 gi|229007908|ref|ZP_04165478.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228753336|gb|EEM02804.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228759238|gb|EEM08239.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock3-17]
          Length = 248

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++I+ED E   ++ +  +E  GY      NGME  +L   H+PD+I++D+ + +  
Sbjct: 9   MKQRILIIEDEENIREVCKRYLEREGYEVYTAMNGMEGWDLFLTHQPDLILLDLMMPKKD 68

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 69  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTIGADDYVTKPFSPRELVLRVQIIL 125

Query: 121 GE 122
             
Sbjct: 126 KR 127


>gi|332523446|ref|ZP_08399698.1| transcriptional regulatory protein WalR [Streptococcus porcinus
           str. Jelinkova 176]
 gi|332314710|gb|EGJ27695.1| transcriptional regulatory protein WalR [Streptococcus porcinus
           str. Jelinkova 176]
          Length = 236

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIMTAFDGREAITIFEEDKPDLVILDLMLPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|148261933|ref|YP_001236060.1| two component transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326405441|ref|YP_004285523.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acidiphilium multivorum AIU301]
 gi|146403614|gb|ABQ32141.1| two component transcriptional regulator, winged helix family
           [Acidiphilium cryptum JF-5]
 gi|325052303|dbj|BAJ82641.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acidiphilium multivorum AIU301]
          Length = 236

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 64/119 (53%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED    + L R  +E SG+   +  +G EAL    +  PD++++D  L  +SG+E+
Sbjct: 9   VLVVEDEAPLVTLLRYNLEKSGFRVDEAGDGGEALGRINEAMPDLVLLDWMLPTMSGIEV 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q++     + +PVI +TA A   D  R  + G + YI+KP S    +  I+  +  +
Sbjct: 69  CRQLRRKPSTRHLPVIMLTARAEDQDTVRGLETGADDYITKPFSPEALIARIRALLRRS 127


>gi|113971044|ref|YP_734837.1| two component transcriptional regulator [Shewanella sp. MR-4]
 gi|114048269|ref|YP_738819.1| two component transcriptional regulator [Shewanella sp. MR-7]
 gi|117921320|ref|YP_870512.1| two component transcriptional regulator [Shewanella sp. ANA-3]
 gi|120599604|ref|YP_964178.1| two component transcriptional regulator [Shewanella sp. W3-18-1]
 gi|113885728|gb|ABI39780.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. MR-4]
 gi|113889711|gb|ABI43762.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. MR-7]
 gi|117613652|gb|ABK49106.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. ANA-3]
 gi|120559697|gb|ABM25624.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. W3-18-1]
 gi|319425699|gb|ADV53773.1| two component transcriptional regulator, winged helix family
           [Shewanella putrefaciens 200]
          Length = 229

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   A+ L ++  PD+I++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALLKEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|315641357|ref|ZP_07896433.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
 gi|315482930|gb|EFU73450.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
          Length = 234

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EALE  R+ +PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLSKEGYEVFTAYDGEEALEKVREVEPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---TFDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|227532778|ref|ZP_03962827.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227189612|gb|EEI69679.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|327383868|gb|AEA55344.1| VicR protein [Lactobacillus casei LC2W]
 gi|327387049|gb|AEA58523.1| VicR protein [Lactobacillus casei BD-II]
          Length = 238

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 2   MAKKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALKKVEAESPDLILLDLMLPKID 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+++    + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 62  GLEVARQIRKE---HDTPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|195978501|ref|YP_002123745.1| TCS response regulator VicR [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225870885|ref|YP_002746832.1| response regulator protein [Streptococcus equi subsp. equi 4047]
 gi|195975206|gb|ACG62732.1| TCS response regulator VicR [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225700289|emb|CAW94550.1| response regulator protein [Streptococcus equi subsp. equi 4047]
          Length = 236

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDTVTAFDGKEAVAVFEEEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|29375768|ref|NP_814922.1| DNA-binding response regulator VicR [Enterococcus faecalis V583]
 gi|227518447|ref|ZP_03948496.1| DNA-binding response regulator [Enterococcus faecalis TX0104]
 gi|227552977|ref|ZP_03983026.1| DNA-binding response regulator [Enterococcus faecalis HH22]
 gi|229546129|ref|ZP_04434854.1| DNA-binding response regulator protein [Enterococcus faecalis
           TX1322]
 gi|229550318|ref|ZP_04439043.1| DNA-binding response regulator [Enterococcus faecalis ATCC 29200]
 gi|255973090|ref|ZP_05423676.1| DNA-binding response regulator [Enterococcus faecalis T1]
 gi|255976129|ref|ZP_05426715.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis T2]
 gi|256618776|ref|ZP_05475622.1| transcriptional regulatory protein [Enterococcus faecalis ATCC
           4200]
 gi|256762196|ref|ZP_05502776.1| DNA-binding response regulator [Enterococcus faecalis T3]
 gi|256852841|ref|ZP_05558211.1| VicR protein [Enterococcus faecalis T8]
 gi|256958685|ref|ZP_05562856.1| transcriptional regulatory protein [Enterococcus faecalis DS5]
 gi|256962217|ref|ZP_05566388.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Merz96]
 gi|256965407|ref|ZP_05569578.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis HIP11704]
 gi|257077961|ref|ZP_05572322.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis JH1]
 gi|257082850|ref|ZP_05577211.1| DNA-binding response regulator VicR [Enterococcus faecalis E1Sol]
 gi|257085548|ref|ZP_05579909.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Fly1]
 gi|257086546|ref|ZP_05580907.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis D6]
 gi|257089603|ref|ZP_05583964.1| two component system response regulator vicR [Enterococcus faecalis
           CH188]
 gi|257415810|ref|ZP_05592804.1| transcriptional regulatory protein [Enterococcus faecalis AR01/DG]
 gi|257419019|ref|ZP_05596013.1| DNA-binding response regulator [Enterococcus faecalis T11]
 gi|257422896|ref|ZP_05599886.1| two component system response regulator vicR [Enterococcus faecalis
           X98]
 gi|293383244|ref|ZP_06629160.1| DNA-binding response regulator VicR [Enterococcus faecalis R712]
 gi|293387601|ref|ZP_06632147.1| DNA-binding response regulator VicR [Enterococcus faecalis S613]
 gi|294781108|ref|ZP_06746458.1| response regulator receiver domain protein [Enterococcus faecalis
           PC1.1]
 gi|300860056|ref|ZP_07106144.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecalis TUSoD Ef11]
 gi|307268695|ref|ZP_07550064.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4248]
 gi|307273520|ref|ZP_07554763.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0855]
 gi|307274483|ref|ZP_07555666.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2134]
 gi|307279011|ref|ZP_07560069.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0860]
 gi|307288506|ref|ZP_07568492.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0109]
 gi|307291176|ref|ZP_07571061.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0411]
 gi|312899664|ref|ZP_07758988.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0470]
 gi|312903943|ref|ZP_07763112.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0635]
 gi|312907168|ref|ZP_07766159.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 512]
 gi|312909787|ref|ZP_07768635.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 516]
 gi|312951046|ref|ZP_07769954.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0102]
 gi|29343229|gb|AAO80992.1| DNA-binding response regulator VicR [Enterococcus faecalis V583]
 gi|227074125|gb|EEI12088.1| DNA-binding response regulator [Enterococcus faecalis TX0104]
 gi|227177886|gb|EEI58858.1| DNA-binding response regulator [Enterococcus faecalis HH22]
 gi|229304581|gb|EEN70577.1| DNA-binding response regulator [Enterococcus faecalis ATCC 29200]
 gi|229308653|gb|EEN74640.1| DNA-binding response regulator protein [Enterococcus faecalis
           TX1322]
 gi|255964108|gb|EET96584.1| DNA-binding response regulator [Enterococcus faecalis T1]
 gi|255969001|gb|EET99623.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis T2]
 gi|256598303|gb|EEU17479.1| transcriptional regulatory protein [Enterococcus faecalis ATCC
           4200]
 gi|256683447|gb|EEU23142.1| DNA-binding response regulator [Enterococcus faecalis T3]
 gi|256711300|gb|EEU26338.1| VicR protein [Enterococcus faecalis T8]
 gi|256949181|gb|EEU65813.1| transcriptional regulatory protein [Enterococcus faecalis DS5]
 gi|256952713|gb|EEU69345.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Merz96]
 gi|256955903|gb|EEU72535.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis HIP11704]
 gi|256985991|gb|EEU73293.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis JH1]
 gi|256990880|gb|EEU78182.1| DNA-binding response regulator VicR [Enterococcus faecalis E1Sol]
 gi|256993578|gb|EEU80880.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Fly1]
 gi|256994576|gb|EEU81878.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis D6]
 gi|256998415|gb|EEU84935.1| two component system response regulator vicR [Enterococcus faecalis
           CH188]
 gi|257157638|gb|EEU87598.1| transcriptional regulatory protein [Enterococcus faecalis ARO1/DG]
 gi|257160847|gb|EEU90807.1| DNA-binding response regulator [Enterococcus faecalis T11]
 gi|257164720|gb|EEU94680.1| two component system response regulator vicR [Enterococcus faecalis
           X98]
 gi|291079422|gb|EFE16786.1| DNA-binding response regulator VicR [Enterococcus faecalis R712]
 gi|291082933|gb|EFE19896.1| DNA-binding response regulator VicR [Enterococcus faecalis S613]
 gi|294451786|gb|EFG20238.1| response regulator receiver domain protein [Enterococcus faecalis
           PC1.1]
 gi|300850874|gb|EFK78623.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecalis TUSoD Ef11]
 gi|306497830|gb|EFM67362.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0411]
 gi|306500581|gb|EFM69912.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0109]
 gi|306504136|gb|EFM73348.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0860]
 gi|306508877|gb|EFM77964.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2134]
 gi|306509797|gb|EFM78824.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0855]
 gi|306515007|gb|EFM83553.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4248]
 gi|310626196|gb|EFQ09479.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 512]
 gi|310631001|gb|EFQ14284.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0102]
 gi|310632663|gb|EFQ15946.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0635]
 gi|311289745|gb|EFQ68301.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 516]
 gi|311293170|gb|EFQ71726.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0470]
 gi|315027746|gb|EFT39678.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2137]
 gi|315029162|gb|EFT41094.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4000]
 gi|315031521|gb|EFT43453.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0017]
 gi|315035063|gb|EFT46995.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0027]
 gi|315145504|gb|EFT89520.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2141]
 gi|315147675|gb|EFT91691.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4244]
 gi|315151377|gb|EFT95393.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0012]
 gi|315154083|gb|EFT98099.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0031]
 gi|315157370|gb|EFU01387.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0043]
 gi|315162567|gb|EFU06584.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0645]
 gi|315165410|gb|EFU09427.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1302]
 gi|315166596|gb|EFU10613.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1341]
 gi|315169875|gb|EFU13892.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1342]
 gi|315172774|gb|EFU16791.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1346]
 gi|315575748|gb|EFU87939.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0309B]
 gi|315578292|gb|EFU90483.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0630]
 gi|315579808|gb|EFU91999.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0309A]
 gi|323480426|gb|ADX79865.1| response regulator [Enterococcus faecalis 62]
 gi|327534818|gb|AEA93652.1| response regulator [Enterococcus faecalis OG1RF]
          Length = 234

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +   ++ +  +   GY      +G EALE   + +PD+II+D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVEEVEPDLIILDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|317132020|ref|YP_004091334.1| two component transcriptional regulator, winged helix family
           [Ethanoligenens harbinense YUAN-3]
 gi|315469999|gb|ADU26603.1| two component transcriptional regulator, winged helix family
           [Ethanoligenens harbinense YUAN-3]
          Length = 229

 Score =  174 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+    +L R  +E  GY    T +G++A++    HKPD++++DI L  + G +
Sbjct: 5   KILVVDDDRNINELLRLYLEKEGYSVASTYDGVDAIKKFEDHKPDLVLLDIMLPGMDGWQ 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++ SE    PVI +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 65  VCREIRKKSEK---PVIMITAKGETFDKVLGLELGADDYIVKPFDAKEVVARIKAVLRR 120


>gi|300854423|ref|YP_003779407.1| putative transcriptional regulator [Clostridium ljungdahlii DSM
           13528]
 gi|300434538|gb|ADK14305.1| predicted transcriptional regulator [Clostridium ljungdahlii DSM
           13528]
          Length = 231

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 70/119 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D E   +L +  +E +GY  +   NG++AL++ ++  P +I++D+ L  + G +
Sbjct: 5   KILIVDDEEHICELIKFNLEKNGYKTIVAGNGIDALKIVKEEMPQLILLDVMLPGMDGYD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+I+ D+ +  IPVI +TA   + D+    + G + Y++KP S+   +  +K  +  
Sbjct: 65  VCKEIRRDNAISFIPVIMITARGEEFDKVLGLELGADDYMTKPFSIRELVARVKAVLRR 123


>gi|332296828|ref|YP_004438750.1| two component transcriptional regulator, winged helix family
           [Treponema brennaborense DSM 12168]
 gi|332179931|gb|AEE15619.1| two component transcriptional regulator, winged helix family
           [Treponema brennaborense DSM 12168]
          Length = 248

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 65/120 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D    ++L    ++  G+  +   NG +AL++AR   PD+II+D+ L ++SG +
Sbjct: 2   KILVVDDEMPILELVSYNLQKEGFSVVTAENGTKALQIARSEHPDLIILDLMLPDMSGFD 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           I + ++ D     IP++  TA     D     + G + Y++KP S  + +  +K  +  A
Sbjct: 62  ICRILRNDKTTAVIPIVMATAKTEDTDVVSGLELGADDYVTKPFSPKVLVARVKNILRRA 121


>gi|229009103|ref|ZP_04166437.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228752157|gb|EEM01850.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
          Length = 237

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++ I+ED +   ++ +  +E+ GY      NG E   L +Q++PD+I++D+ + +  
Sbjct: 1   MTTRIAIIEDEDNIREICKRYLESEGYEVYTAENGEEGWNLFQQYQPDLIVLDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA A + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQHS---NVPIIILTARAEERDRILGLTIGADDYVTKPFSPRELVLRVQILL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|228994185|ref|ZP_04154085.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus pseudomycoides DSM 12442]
 gi|229000254|ref|ZP_04159823.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides Rock3-17]
 gi|229007777|ref|ZP_04165365.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides Rock1-4]
 gi|229087951|ref|ZP_04220061.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-44]
 gi|228695364|gb|EEL48239.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-44]
 gi|228753485|gb|EEM02935.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides Rock1-4]
 gi|228759586|gb|EEM08563.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides Rock3-17]
 gi|228765637|gb|EEM14291.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus pseudomycoides DSM 12442]
          Length = 247

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 13  MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 72

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 73  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 129

Query: 120 IGE 122
           +  
Sbjct: 130 LRR 132


>gi|77918267|ref|YP_356082.1| two-component response regulator PhoB [Pelobacter carbinolicus DSM
           2380]
 gi|77544350|gb|ABA87912.1| two-component response regulator PhoB [Pelobacter carbinolicus DSM
           2380]
          Length = 230

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 64/123 (52%), Gaps = 1/123 (0%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M KK +++VED E  + L    +   G+       G E LE   +  PD++++D+ L  +
Sbjct: 1   MAKKHILVVEDEEDILALLHYNLVREGFRVSLAGTGEEGLETLAEDPPDLVVLDLMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL++ + +KE+++ + I V+ VTA   + D     + G + Y++KP S  I +  I+  
Sbjct: 61  DGLQVCRALKENADTRHIAVVMVTAKGEEADVVAGLELGADDYVTKPFSPKILIARIRSV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|30265484|ref|NP_847861.1| DNA-binding response regulator YycF [Bacillus anthracis str. Ames]
 gi|42784660|ref|NP_981907.1| DNA-binding response regulator YycF [Bacillus cereus ATCC 10987]
 gi|47531052|ref|YP_022401.1| DNA-binding response regulator YycF [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47568665|ref|ZP_00239362.1| response regulator [Bacillus cereus G9241]
 gi|49188303|ref|YP_031556.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           Sterne]
 gi|49480468|ref|YP_039456.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52145274|ref|YP_086731.1| response regulator [Bacillus cereus E33L]
 gi|65317447|ref|ZP_00390406.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain [Bacillus
           anthracis str. A2012]
 gi|118480494|ref|YP_897645.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|165872537|ref|ZP_02217170.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0488]
 gi|167636251|ref|ZP_02394554.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0442]
 gi|167641448|ref|ZP_02399698.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0193]
 gi|170689182|ref|ZP_02880379.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0465]
 gi|170708658|ref|ZP_02899097.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0389]
 gi|177651874|ref|ZP_02934457.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0174]
 gi|190568892|ref|ZP_03021794.1| DNA-binding response regulator YycF [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036153|ref|ZP_03103553.1| DNA-binding response regulator YycF [Bacillus cereus W]
 gi|196041965|ref|ZP_03109252.1| DNA-binding response regulator YycF [Bacillus cereus NVH0597-99]
 gi|196045552|ref|ZP_03112783.1| DNA-binding response regulator YycF [Bacillus cereus 03BB108]
 gi|206975866|ref|ZP_03236777.1| DNA-binding response regulator YycF [Bacillus cereus H3081.97]
 gi|217962959|ref|YP_002341537.1| DNA-binding response regulator YycF [Bacillus cereus AH187]
 gi|218906658|ref|YP_002454492.1| DNA-binding response regulator YycF [Bacillus cereus AH820]
 gi|222098943|ref|YP_002533001.1| DNA-binding response regulator yycf [Bacillus cereus Q1]
 gi|225867447|ref|YP_002752825.1| DNA-binding response regulator YycF [Bacillus cereus 03BB102]
 gi|227818235|ref|YP_002818244.1| DNA-binding response regulator YycF [Bacillus anthracis str. CDC
           684]
 gi|229604878|ref|YP_002869675.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0248]
 gi|254687093|ref|ZP_05150951.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724124|ref|ZP_05185909.1| DNA-binding response regulator YycF [Bacillus anthracis str. A1055]
 gi|254735141|ref|ZP_05192851.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742150|ref|ZP_05199837.1| DNA-binding response regulator YycF [Bacillus anthracis str. Kruger
           B]
 gi|254755940|ref|ZP_05207972.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           Vollum]
 gi|254761652|ref|ZP_05213672.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           Australia 94]
 gi|301056940|ref|YP_003795151.1| DNA-binding response regulator YycF [Bacillus anthracis CI]
 gi|30260162|gb|AAP29347.1| DNA-binding response regulator YycF [Bacillus anthracis str. Ames]
 gi|42740592|gb|AAS44515.1| DNA-binding response regulator YycF [Bacillus cereus ATCC 10987]
 gi|47506200|gb|AAT34876.1| DNA-binding response regulator YycF [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47554653|gb|EAL13007.1| response regulator [Bacillus cereus G9241]
 gi|49182230|gb|AAT57606.1| DNA-binding response regulator YycF [Bacillus anthracis str.
           Sterne]
 gi|49332024|gb|AAT62670.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51978743|gb|AAU20293.1| response regulator [Bacillus cereus E33L]
 gi|118419719|gb|ABK88138.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|164711760|gb|EDR17304.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0488]
 gi|167510623|gb|EDR86019.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0193]
 gi|167528366|gb|EDR91137.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0442]
 gi|170126440|gb|EDS95328.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0389]
 gi|170666825|gb|EDT17591.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0465]
 gi|172082578|gb|EDT67642.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0174]
 gi|190559959|gb|EDV13942.1| DNA-binding response regulator YycF [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991320|gb|EDX55288.1| DNA-binding response regulator YycF [Bacillus cereus W]
 gi|196023759|gb|EDX62435.1| DNA-binding response regulator YycF [Bacillus cereus 03BB108]
 gi|196027220|gb|EDX65840.1| DNA-binding response regulator YycF [Bacillus cereus NVH0597-99]
 gi|206745960|gb|EDZ57356.1| DNA-binding response regulator YycF [Bacillus cereus H3081.97]
 gi|217065926|gb|ACJ80176.1| DNA-binding response regulator YycF [Bacillus cereus AH187]
 gi|218539027|gb|ACK91425.1| DNA-binding response regulator YycF [Bacillus cereus AH820]
 gi|221243002|gb|ACM15712.1| DNA-binding response regulator YycF [Bacillus cereus Q1]
 gi|225788895|gb|ACO29112.1| DNA-binding response regulator YycF [Bacillus cereus 03BB102]
 gi|227004085|gb|ACP13828.1| DNA-binding response regulator YycF [Bacillus anthracis str. CDC
           684]
 gi|229269286|gb|ACQ50923.1| DNA-binding response regulator YycF [Bacillus anthracis str. A0248]
 gi|300379109|gb|ADK08013.1| DNA-binding response regulator YycF [Bacillus cereus biovar
           anthracis str. CI]
 gi|324329417|gb|ADY24677.1| DNA-binding response regulator YycF [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 235

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKATEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|219854585|ref|YP_002471707.1| hypothetical protein CKR_1242 [Clostridium kluyveri NBRC 12016]
 gi|219568309|dbj|BAH06293.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 240

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K++IV+D E   +L +  +E +GY  +    GMEAL++A++ +P +I++D+ L  +
Sbjct: 10  MSKEKILIVDDEEHICELIKFNLENNGYKTIIASEGMEALKIAKEERPKLILLDVMLPGM 69

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++ K+I++D  +   P++ +TA   + D+    + G + YI+KP S+   +  +K  
Sbjct: 70  DGYDVCKEIRKDESIASTPIMMITARGEEFDKVLGLELGADDYITKPFSVRELLARVKAI 129

Query: 120 IGE 122
           +  
Sbjct: 130 LRR 132


>gi|187778876|ref|ZP_02995349.1| hypothetical protein CLOSPO_02471 [Clostridium sporogenes ATCC
           15579]
 gi|187772501|gb|EDU36303.1| hypothetical protein CLOSPO_02471 [Clostridium sporogenes ATCC
           15579]
          Length = 232

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 72/121 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K++IV+D E   +L +  +E +GY  +   NG++AL + ++ KPD++++D+ L  + G
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYECICALNGIDALNIVKEEKPDLVLLDLMLPGMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            ++ K+I++D+ +    +I +TA   + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 63  YDVCKEIRKDNNIATTSIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVLR 122

Query: 122 E 122
            
Sbjct: 123 R 123


>gi|110640660|ref|YP_668388.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 536]
 gi|110342252|gb|ABG68489.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 536]
          Length = 243

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|184154491|ref|YP_001842831.1| two-component response regulator [Lactobacillus fermentum IFO 3956]
 gi|260662552|ref|ZP_05863447.1| two-component system response regulator [Lactobacillus fermentum
           28-3-CHN]
 gi|183225835|dbj|BAG26351.1| two-component response regulator [Lactobacillus fermentum IFO 3956]
 gi|260553243|gb|EEX26186.1| two-component system response regulator [Lactobacillus fermentum
           28-3-CHN]
          Length = 235

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +    + +  +E  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 1   MAKKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESESPDLIVLDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ KQ++     +  P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAKQVRAK---RSTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|89897369|ref|YP_520856.1| hypothetical protein DSY4623 [Desulfitobacterium hafniense Y51]
 gi|89336817|dbj|BAE86412.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 227

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D+E   ++ R  +E  GY   +  NG  ALE  R+   D++I+D+ +  + G  
Sbjct: 2   KILVVDDDERIREIVRLYLEAEGYDIEEADNGNSALEKVRKDSFDLVILDLMMPGLDGWT 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K ++++++   IP+I +TA   + D       G + Y+ KP S       +K  +  
Sbjct: 62  VCKVLRKETK---IPIIMLTAKGEENDRVLGFDLGADDYVVKPFSPRELSARVKAVLRR 117


>gi|228989676|ref|ZP_04149658.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
 gi|228770010|gb|EEM18592.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
          Length = 237

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++I+ED +   ++ +  +E  GY      NG E   + +Q++PD+II+D+ + +  
Sbjct: 1   MKKRIVIIEDEDNIREICKRYLEREGYEVYTAVNGTEGWNVFQQYQPDLIILDLMMPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++      +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 61  GWELCEEIRQ---YSNVPIIMLTARGEERDRILGLTMGADDYVTKPFSPRELVLRVQIIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|121535090|ref|ZP_01666907.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
 gi|121306340|gb|EAX47265.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
          Length = 230

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 68/123 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IVED     +L R  +   GY+ L+  +G  AL LAR+ +PD+I++D+ L  + 
Sbjct: 1   MTGKILIVEDEANIRELVRFNLAKEGYVVLEAEDGNAALALARRERPDLIVLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ + +K  SE   + +I +TA A + D+    + G + Y+ KP S    +  IK  +
Sbjct: 61  GLDVCRILKGSSETAGMAIIMLTAKAEEVDKIIGLELGADDYMVKPFSPRELLARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|34496017|ref|NP_900232.1| phosphate regulon transcriptional regulatory protein phoB
           [Chromobacterium violaceum ATCC 12472]
 gi|34101870|gb|AAQ58238.1| phosphate regulon transcriptional regulatory protein phoB
           [Chromobacterium violaceum ATCC 12472]
          Length = 229

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+      AL L R   PD++++D  L   S
Sbjct: 1   MAANILLVEDEPAIQELIAFNLAQAGHHVLRAGTAEAALTLVRNALPDLVLLDWMLPGAS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K+++ D   + IP+I +TA + + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GIDVAKRLRADERTRHIPIIMLTARSDEQDKVAGLETGADDYITKPFSPRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|86610346|ref|YP_479108.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558888|gb|ABD03845.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 373

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 56/120 (46%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IV+D+     + +  +E  GY      NG E LE A    P +II D  + ++ G
Sbjct: 1   MTTILIVDDDPTIRLVLKRSLERQGYTVEMASNGSEGLEQAHLLVPGLIICDWMMPDMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++IK D +      I +TA     D  +    G + ++SKPI  +     ++  + 
Sbjct: 61  LEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVRAGLR 120


>gi|217967623|ref|YP_002353129.1| two component transcriptional regulator, winged helix family
           [Dictyoglomus turgidum DSM 6724]
 gi|217336722|gb|ACK42515.1| two component transcriptional regulator, winged helix family
           [Dictyoglomus turgidum DSM 6724]
          Length = 232

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VED++  +     L+   GY      +G+EAL   +   PD++++DI L E  G
Sbjct: 1   MKKILLVEDDKGIVNSLTLLLNKEGYEVEVAYDGVEALNKFKLFNPDLVLLDIMLPEKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++   +  +P+I +TA   + D+    K G + YI+KP      +  I+  + 
Sbjct: 61  WEVCKEIRK---ISNVPIIMLTAKDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|308174605|ref|YP_003921310.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|307607469|emb|CBI43840.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|328554528|gb|AEB25020.1| two-component response regulator [Bacillus amyloliquefaciens TA208]
 gi|328912934|gb|AEB64530.1| two-component response regulator [Bacillus amyloliquefaciens LL3]
          Length = 239

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 71/123 (57%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + L +  +E SGY  +   +G EALE A +  PD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEQSIVTLLQYNLERSGYDVITASDGEEALEQAEKENPDLIVLDVMLPKVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+++   +  +P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIDVCKQLRQQKMM--VPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVTARVKAIL 118

Query: 121 GEA 123
             A
Sbjct: 119 RRA 121


>gi|297569540|ref|YP_003690884.1| two component transcriptional regulator, winged helix family
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925455|gb|ADH86265.1| two component transcriptional regulator, winged helix family
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 237

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 64/120 (53%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IVED+E   +L    +  +G+  +   NG +AL L ++  PD++++D+ L  + G +
Sbjct: 11  TILIVEDDENIQQLVGYNLVKAGFQVIYADNGEQALALVQREAPDLVVLDVMLPGMDGYQ 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           I K ++ D   + +P+I +TA +   D       G + YI+KP S  I +  +K  +  +
Sbjct: 71  ICKTLRRDPRHRWLPIIMLTARSDDDDVTAGLDQGADDYITKPFSPKILVSRVKSALRRS 130


>gi|126173616|ref|YP_001049765.1| two component transcriptional regulator [Shewanella baltica OS155]
 gi|152999896|ref|YP_001365577.1| two component transcriptional regulator [Shewanella baltica OS185]
 gi|160874521|ref|YP_001553837.1| two component transcriptional regulator [Shewanella baltica OS195]
 gi|217974139|ref|YP_002358890.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS223]
 gi|304409488|ref|ZP_07391108.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS183]
 gi|307303846|ref|ZP_07583599.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica BA175]
 gi|125996821|gb|ABN60896.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS155]
 gi|151364514|gb|ABS07514.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS185]
 gi|160860043|gb|ABX48577.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS195]
 gi|217499274|gb|ACK47467.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS223]
 gi|304352006|gb|EFM16404.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS183]
 gi|306912744|gb|EFN43167.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica BA175]
 gi|315266760|gb|ADT93613.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS678]
          Length = 229

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+      +   A+ L ++  PD+I++D      S
Sbjct: 1   MTARILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALLKEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|300868611|ref|ZP_07113225.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
 gi|300333370|emb|CBN58417.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
          Length = 245

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+ ++++++D+    +L    +E +GY   Q  +G++   LA Q  PD+I++D+ L  + 
Sbjct: 1   MMPRILVIDDDPTIAELVAVNLEMAGYEVTQAEDGIKGQALAIQMLPDLIMLDLMLPRVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++++ D    +IPV+ +TA     D+      G + Y++KP  L   +  ++  +
Sbjct: 61  GFTVCQRLRRDDRTADIPVLMLTALGQTQDKVEGFNSGADDYLTKPFELEEMLARVRALL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|239637987|ref|ZP_04678948.1| transcriptional regulatory protein [Staphylococcus warneri L37603]
 gi|239596550|gb|EEQ79086.1| transcriptional regulatory protein [Staphylococcus warneri L37603]
          Length = 236

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EAL+     +PD+I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALQKVELSQPDLIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|37522238|ref|NP_925615.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
 gi|35213238|dbj|BAC90610.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
          Length = 245

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE+  +  PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFSREHPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +++++DS   ++P+I +TA     D     + G + Y+ KP S       I+  +  A
Sbjct: 71  VCQELRKDS---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRA 127


>gi|56422009|ref|YP_149327.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|297531668|ref|YP_003672943.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
 gi|56381851|dbj|BAD77759.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|297254920|gb|ADI28366.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
          Length = 237

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY  +   +G EAL+   +  PD+I++DI L    
Sbjct: 1   MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEETMPDLILLDIMLPLKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|206900113|ref|YP_002250961.1| response regulator DrrA [Dictyoglomus thermophilum H-6-12]
 gi|206739216|gb|ACI18274.1| response regulator DrrA [Dictyoglomus thermophilum H-6-12]
          Length = 232

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VED++  +     L+   GY      +G+EAL   +   PD++++DI L E  G
Sbjct: 1   MKKILLVEDDKGIVNSLSLLLNKEGYEVEVAYDGVEALNKFKLFNPDLVLLDIMLPEKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I++   +  +P+I +TA   + D+    K G + YI+KP      +  I+  + 
Sbjct: 61  WEVCKEIRK---ISNVPIIMLTAKDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|88858377|ref|ZP_01133019.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas tunicata D2]
 gi|88819994|gb|EAR29807.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas tunicata D2]
          Length = 229

 Score =  173 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D     ++   ++E +G+ A++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MSRRILVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIASLMEPYPDMILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K+IK+    + IP+I +TA   + D+ +  + G + Y++KP S    M  IK  I
Sbjct: 61  GIQIAKKIKQSEYTRHIPIIMLTARGEEEDKVKGLEVGADDYVTKPFSPKELMARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|153813611|ref|ZP_01966279.1| hypothetical protein RUMOBE_04034 [Ruminococcus obeum ATCC 29174]
 gi|149830309|gb|EDM85402.1| hypothetical protein RUMOBE_04034 [Ruminococcus obeum ATCC 29174]
          Length = 229

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +L +K  R  +E  G       +G EA+E A+++K D+I++D+ L ++ 
Sbjct: 1   MSRKVLVVDDEKLIVKGIRFNLEQDGMEVDCAYDGEEAVEKAKENKYDIILLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E      +P++ +TA     D+      G + YI+KP ++      IK  +
Sbjct: 61  GLEVCQQIRE---FSNVPIVMLTAKGEDMDKILGLDYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|154250855|ref|YP_001411679.1| two component transcriptional regulator [Parvibaculum
           lavamentivorans DS-1]
 gi|154154805|gb|ABS62022.1| two component transcriptional regulator, winged helix family
           [Parvibaculum lavamentivorans DS-1]
          Length = 272

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   VMIVED E  + L +  ++  GY  +   +G EA  L R+  PD+I++D  L  +S
Sbjct: 42  MKPSVMIVEDEEALLTLLQYNLDKEGYKVITAADGEEADLLIRETTPDLILLDWMLPGLS 101

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E + +P+I +TA   + D  R    G + Y++KP S++  +  I+  +
Sbjct: 102 GIELCRRLRGRPETRNVPIIMITARGEETDRIRGLDIGADDYVTKPFSMTELLARIRAVM 161

Query: 121 GE 122
             
Sbjct: 162 RR 163


>gi|153953971|ref|YP_001394736.1| PhoB [Clostridium kluyveri DSM 555]
 gi|146346852|gb|EDK33388.1| PhoB [Clostridium kluyveri DSM 555]
          Length = 231

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K++IV+D E   +L +  +E +GY  +    GMEAL++A++ +P +I++D+ L  +
Sbjct: 1   MSKEKILIVDDEEHICELIKFNLENNGYKTIIASEGMEALKIAKEERPKLILLDVMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++ K+I++D  +   P++ +TA   + D+    + G + YI+KP S+   +  +K  
Sbjct: 61  DGYDVCKEIRKDESIASTPIMMITARGEEFDKVLGLELGADDYITKPFSVRELLARVKAI 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|295398639|ref|ZP_06808664.1| response regulator [Aerococcus viridans ATCC 11563]
 gi|294973127|gb|EFG48929.1| response regulator [Aerococcus viridans ATCC 11563]
          Length = 238

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    +    ++  GY      +G +ALE     +PD++++D+ L +I G
Sbjct: 1   MKKILIVDDEKPISDIISFNLKNEGYEIDTAYDGQQALEKFASFQPDLVVLDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +QI++DS+   +P+I +TA   + D+    + G + Y++KP S    M  +K  I 
Sbjct: 61  LEVCRQIRKDSQ---VPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELMARVKANIR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|218779275|ref|YP_002430593.1| two component transcriptional regulator, winged helix family
           [Desulfatibacillum alkenivorans AK-01]
 gi|218760659|gb|ACL03125.1| two component transcriptional regulator, winged helix family
           [Desulfatibacillum alkenivorans AK-01]
          Length = 228

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  ++IV+D E  ++L +  +E  G+      +G +ALE  +   PD++++D+ L  I
Sbjct: 1   MPKTSILIVDDEEDILELLKFNLEREGFKIFCADSGEKALEAVKNFSPDLVLLDLMLPGI 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ + +K       IP+I +TA   + D  R  + G + Y++KP S  + +  ++  
Sbjct: 61  DGLEVARVLKSKPNTSTIPIIMLTAKGDESDVVRGLELGADDYVTKPFSPRVIIARVRAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 MRR 123


>gi|320332849|ref|YP_004169560.1| winged helix family two component transcriptional regulator
           [Deinococcus maricopensis DSM 21211]
 gi|319754138|gb|ADV65895.1| two component transcriptional regulator, winged helix family
           [Deinococcus maricopensis DSM 21211]
          Length = 227

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++VEDN    ++ R+ +   GY      NG+E L   R H PD+I++D+ +  + G
Sbjct: 1   MKTILVVEDNAGIREMVREYLAEHGYRVRVASNGVEGLLETRHHPPDLILLDVMMPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE  ++ + D      PV+ +TA   + D+    + G + Y++KP S++  +  I+  + 
Sbjct: 61  LEFLRKYRAD---AGTPVMFLTARDAELDKVLGLELGADDYLTKPFSMAELLARIRALLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|88811179|ref|ZP_01126435.1| phosphate regulon response regulator PhoB [Nitrococcus mobilis
           Nb-231]
 gi|88791718|gb|EAR22829.1| phosphate regulon response regulator PhoB [Nitrococcus mobilis
           Nb-231]
          Length = 228

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 63/122 (51%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IVED     ++    +  S Y   Q  +G   L L  +  PD++++D  L  +SG
Sbjct: 1   MVKILIVEDEAAIREMIAMALIRSDYSVHQADSGEAGLTLLDEIVPDLVLLDWMLPGMSG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           ++  +++K     +++P+I +TA   + D+ R  + G + +++KP S    +  IK  + 
Sbjct: 61  IDFARRVKRHPTYRDVPIIMLTARGEEEDKIRGLEVGADDFVTKPFSPRELLARIKAVLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|326442416|ref|ZP_08217150.1| putative two-component systen response regulator [Streptomyces
           clavuligerus ATCC 27064]
          Length = 342

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IV+D     +  +  +   GY      +G++AL  A  ++PD++++DIQ+  + GL 
Sbjct: 108 RILIVDDEPAVREALQRSLAFEGYATEVAVDGIDALAKAESYRPDLLVLDIQMPRMDGLT 167

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  +
Sbjct: 168 AARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRRS 225


>gi|295110582|emb|CBL24535.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus obeum
           A2-162]
          Length = 229

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +L +K  R  +E  G       +G EA+E A+ +K D+I++D+ L ++ 
Sbjct: 1   MSRKVLVVDDEKLIVKGIRFNLEQDGMEVDCAYDGEEAVEKAKANKYDIILLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E      +P++ +TA     D+      G + YI+KP ++      IK  +
Sbjct: 61  GLEVCQQIRE---FSNVPIVMLTAKGEDMDKILGLDYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|260892914|ref|YP_003239011.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260865055|gb|ACX52161.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 237

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +++IV+D     ++ R  +   G+   +  +G  AL   R    D++I+DI L +I G 
Sbjct: 8   ARILIVDDEHRIREVLRKYLVAEGFGVGEAADGEAALAEIRSGHWDLVILDIMLPKIDGW 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I++   + ++P++ +TA   + D     + G + YI KP S    +  +K  +  
Sbjct: 68  EVCREIRK---ISDVPILMLTARGDEIDRVLGLELGADDYIVKPFSPREVVARVKAVLRR 124

Query: 123 A 123
           A
Sbjct: 125 A 125


>gi|251781983|ref|YP_002996285.1| two-component response regulator [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390612|dbj|BAH81071.1| two-component response regulator [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 236

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|294814012|ref|ZP_06772655.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|294326611|gb|EFG08254.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 340

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IV+D     +  +  +   GY      +G++AL  A  ++PD++++DIQ+  + GL 
Sbjct: 106 RILIVDDEPAVREALQRSLAFEGYATEVAVDGIDALAKAESYRPDLLVLDIQMPRMDGLT 165

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  +
Sbjct: 166 AARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRRS 223


>gi|261420883|ref|YP_003254565.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|319768554|ref|YP_004134055.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
 gi|261377340|gb|ACX80083.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|317113420|gb|ADU95912.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
          Length = 237

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY  +   +G EAL+   +  PD+I++DI L    
Sbjct: 1   MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEETMPDLILLDIMLPLKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|254508241|ref|ZP_05120365.1| response regulator receiver domain protein [Vibrio parahaemolyticus
           16]
 gi|219548858|gb|EED25859.1| response regulator receiver domain protein [Vibrio parahaemolyticus
           16]
          Length = 1111

 Score =  173 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 64/115 (55%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D  +N+++    +   GY     ++G+EA E     KP+++++DI +  +SG ++ 
Sbjct: 708 LVVDDEPVNLRVLDSFLRLEGYRVQTAKDGLEAFEKLEAEKPELVLLDIMMPGMSGYQVC 767

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +++++D +  ++PVI +TA     D  R  + G   Y+SKP +       I+ ++
Sbjct: 768 EKLRQDYDHAQLPVIMLTALNQADDRLRGFEAGANDYLSKPFNKQELAARIRAHL 822


>gi|304394459|ref|ZP_07376380.1| phosphate regulon transcriptional regulatory protein PhoB [Ahrensia
           sp. R2A130]
 gi|303293369|gb|EFL87748.1| phosphate regulon transcriptional regulatory protein PhoB [Ahrensia
           sp. R2A130]
          Length = 233

 Score =  173 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 71/120 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED     +L    +E +G+  + T +G + +  A+   P +I++D  L  +SG+E
Sbjct: 8   KILVVEDEPSQQELLVYNLEKAGFRVVATGDGEDGVAAAQDENPALIVLDWMLPGLSGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +Q++ D++ ++IP+I +TA   +GD+ R    G + YI KP S++  +  ++ +I  A
Sbjct: 68  VCRQLRRDADTRQIPIIMLTARGEEGDKVRALDTGADDYIVKPYSVAELLARVRAHIRRA 127


>gi|255658266|ref|ZP_05403675.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Mitsuokella multacida DSM 20544]
 gi|260849578|gb|EEX69585.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Mitsuokella multacida DSM 20544]
          Length = 235

 Score =  173 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D     +L    ++ SGY      +G  AL+ A +   D++++DI L E+ GLE+
Sbjct: 3   ILVVDDEAPIRELLSFNLKKSGYEVEMAADGRTALQRAPEA--DLVLLDIMLPEVDGLEV 60

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q+K D +   IP+I +TA A + D     + G + Y+ KP S+   +  +K  +  +
Sbjct: 61  CRQLKADPQTSGIPIIMLTAKAEEIDRVLGLELGADDYVVKPFSMRELLARVKAVLRRS 119


>gi|88799154|ref|ZP_01114734.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
 gi|88778137|gb|EAR09332.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
          Length = 240

 Score =  173 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 65/124 (52%), Gaps = 1/124 (0%)

Query: 1   MLKK-VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M  + ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  + ++
Sbjct: 6   MSSRSILIVDDEAPIREVIAAALEMAGYRTLEASNAQDAHSIVVDQKPDLILLDWMMPQV 65

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SG+E  +++K D    EIP+I +TA   +  +    + G + YI+KP S    +  +K  
Sbjct: 66  SGVEFARRLKRDPLTAEIPIIMLTAKGEEDHKITGLEAGADDYITKPFSPRELVARLKAV 125

Query: 120 IGEA 123
           +  +
Sbjct: 126 LRRS 129


>gi|161504418|ref|YP_001571530.1| transcriptional regulator PhoB [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865765|gb|ABX22388.1| hypothetical protein SARI_02529 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 229

 Score =  173 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|22299907|ref|NP_683154.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22296092|dbj|BAC09916.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 251

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL   RQ +PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYTVVTAADGEEALTKFRQEQPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|119896456|ref|YP_931669.1| phosphate regulon transcriptional regulatory protein [Azoarcus sp.
           BH72]
 gi|119668869|emb|CAL92782.1| phosphate regulon transcriptional regulatory protein [Azoarcus sp.
           BH72]
          Length = 236

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  ++  +   A  L R   PD++++D  L  +S
Sbjct: 1   MPANILLVEDEPAIQELIAANLSRAGHHVVRAADAEAAQRLVRDALPDLVLLDWMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  ++++ +   +EIP+I +TA   + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GIDFARRLRAEERTREIPIIMLTARGEEQDKVAGLETGADDYITKPFSPRELVARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|209527087|ref|ZP_03275602.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
 gi|209492515|gb|EDZ92855.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
          Length = 233

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 63/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED      L R  +E  G+    ++NG+ ALE+ +Q +PDVII+D+ L  + GLE+
Sbjct: 3   ILIVEDEPEIALLIRRTLEAEGFSCQISQNGLSALEIFQQQRPDVIILDLMLPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CARIRQQPGQKDPYILMLTAKGEEIDRIVGLSTGADDYMVKPFSPRELVARVRALLRRS 121


>gi|24111777|ref|NP_706287.1| transcriptional regulator PhoB [Shigella flexneri 2a str. 301]
 gi|30061895|ref|NP_836066.1| transcriptional regulator PhoB [Shigella flexneri 2a str. 2457T]
 gi|110804422|ref|YP_687942.1| transcriptional regulator PhoB [Shigella flexneri 5 str. 8401]
 gi|27735236|sp|P45607|PHOB_SHIFL RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|24050564|gb|AAN41994.1| positive response regulator for pho regulon [Shigella flexneri 2a
           str. 301]
 gi|30040139|gb|AAP15872.1| positive response regulator for pho regulon [Shigella flexneri 2a
           str. 2457T]
 gi|110613970|gb|ABF02637.1| positive response regulator for pho regulon [Shigella flexneri 5
           str. 8401]
 gi|281599731|gb|ADA72715.1| Phosphate regulon transcriptional regulatory protein phoB [Shigella
           flexneri 2002017]
 gi|313646986|gb|EFS11443.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2a str. 2457T]
 gi|332761723|gb|EGJ92002.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2747-71]
 gi|332764273|gb|EGJ94509.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-671]
 gi|332768503|gb|EGJ98686.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2930-71]
 gi|333022012|gb|EGK41257.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-304]
          Length = 229

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|258514364|ref|YP_003190586.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778069|gb|ACV61963.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 235

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 71/122 (58%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  V++V+D +  +++ +  +E  GY  +  R+G  AL+LAR  KPD+II+DI L E  G
Sbjct: 1   MPSVLVVDDEQNIIEIIKFNLEREGYQVITARDGTTALQLARSEKPDLIILDIMLPEQDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + + ++++ + + IP+I V+A   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LAVCRLLQQEQKTRGIPIIMVSARGDELDKILGLEMGADDYVTKPFSPRELVARVKARLR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|284053232|ref|ZP_06383442.1| two component transcriptional regulator [Arthrospira platensis str.
           Paraca]
 gi|291565873|dbj|BAI88145.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 233

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 63/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED      L R  +E  G+    ++NG+ ALE+ +Q +PDVII+D+ L  + GLE+
Sbjct: 3   ILIVEDEPEIALLIRRTLEGEGFSCQISQNGLSALEIFQQQRPDVIILDLMLPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CARIRQQPGQKDPYILMLTAKGEEIDRIVGLSTGADDYMVKPFSPRELVARVRALLRRS 121


>gi|326804031|ref|YP_004321849.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650605|gb|AEA00788.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Aerococcus urinae ACS-120-V-Col10a]
          Length = 235

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    +    ++  GY  L   +G EALE    ++PD+I++D+ L +  G
Sbjct: 1   MKKILVVDDEKPISDIITFNLQKEGYDTLAAFDGEEALESFASYQPDLIVLDLMLPKKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I++      +P+I +TA   + D+    + G + Y++KP S       IK  + 
Sbjct: 61  LEVCREIRK---TSSVPIIMLTAKGEEIDKVLGLEMGADDYVTKPFSNRELSARIKANLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|149182828|ref|ZP_01861289.1| two-component response regulator [Bacillus sp. SG-1]
 gi|148849443|gb|EDL63632.1| two-component response regulator [Bacillus sp. SG-1]
          Length = 239

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 71/123 (57%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + L +  +E +GY  +   +G E  +LA +  PD++I+D+ L +I 
Sbjct: 1   MSKKILVVDDEQSIVTLLKYNLEQAGYSVITAHDGEEGRDLALEEVPDLMILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQI++   +  IP++ +TA   + D+    + G + Y++KP S    M  +K  +
Sbjct: 61  GIEVCKQIRQQKVM--IPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVMARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|15616589|ref|NP_244895.1| two-component response regulator [Bacillus halodurans C-125]
 gi|10176652|dbj|BAB07746.1| two-component response regulator [Bacillus halodurans C-125]
          Length = 236

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 66/120 (55%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +    + +  +E  G+  +   +G EA+E   Q KPD+I++DI L    G+
Sbjct: 4   KKILVVDDEKPIADILKFNLEKEGFTVICAYDGAEAVEQVNQEKPDLILLDIMLPNKDGM 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++  E   +P+I +TA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 64  EVCREVRKQFE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRR 120


>gi|114563933|ref|YP_751447.1| two component transcriptional regulator, winged helix family
           protein [Shewanella frigidimarina NCIMB 400]
 gi|114335226|gb|ABI72608.1| two component transcriptional regulator, winged helix family
           [Shewanella frigidimarina NCIMB 400]
          Length = 229

 Score =  173 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   +++  G+      +   A+EL ++  PD+I++D      S
Sbjct: 1   MTARILIVEDESAIREMLTFVMDQHGFTTAAAEDFDSAIELLKEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|197250808|ref|YP_002145379.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214511|gb|ACH51908.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
          Length = 229

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|289550550|ref|YP_003471454.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus lugdunensis HKU09-01]
 gi|289180082|gb|ADC87327.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus lugdunensis HKU09-01]
          Length = 236

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +  + L +  +ET+GYI     +G EALE   + +PD+I++D+ L +  
Sbjct: 1   MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALEKVEKVQPDLIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|296133006|ref|YP_003640253.1| response regulator receiver modulated diguanylate cyclase
           [Thermincola sp. JR]
 gi|296031584|gb|ADG82352.1| response regulator receiver modulated diguanylate cyclase
           [Thermincola potens JR]
          Length = 314

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 71/121 (58%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++++D++  +++ +D +E  G+I     +   A+EL  Q  PD+I++D+ L +++G 
Sbjct: 7   QRILVIDDDKFMVRIIKDCLEKVGFIVYGAEDFSSAMELIYQMTPDLILLDVVLPKMNGF 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           EI + ++ D+    +P+I +T+ AM  D+    + G + YI+KP      +  +K ++  
Sbjct: 67  EICRLLRNDTRTSHVPIIMITSKAMTEDKVAGLEAGADDYITKPFDPLELVARVKTHLRR 126

Query: 123 A 123
           A
Sbjct: 127 A 127


>gi|28377004|ref|NP_783896.1| response regulator [Lactobacillus plantarum WCFS1]
 gi|28269835|emb|CAD62732.1| response regulator [Lactobacillus plantarum WCFS1]
          Length = 235

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EAL+   +  PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVDEVHPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +Q++++    ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVARQVRKN---YDMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|194017268|ref|ZP_03055880.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
 gi|194011136|gb|EDW20706.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
          Length = 242

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L    +E +GY  +  R+G EALE A   +PD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLSYNLERAGYDVVTARDGEEALEKAASEQPDLIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ++    +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRIQKMM--FPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVGARVKAIL 118

Query: 121 GEA 123
             A
Sbjct: 119 RRA 121


>gi|222099706|ref|YP_002534274.1| Response regulator DrrA [Thermotoga neapolitana DSM 4359]
 gi|221572096|gb|ACM22908.1| Response regulator DrrA [Thermotoga neapolitana DSM 4359]
          Length = 251

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 65/120 (54%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+   ++L    +   GY  L+  +G EAL+LA +   D+ I+DI L  + G 
Sbjct: 16  KKILVVDDDPAILELVGYNLAKEGYDVLKAYDGEEALKLANEEDVDMFIVDIMLPGMDGF 75

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+   + +  PVI ++A   + D+    + G + YI+KP S+   +  +K     
Sbjct: 76  ELVRKIRSMEKYRNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRR 135


>gi|15903150|ref|NP_358700.1| DNA-binding response regulator [Streptococcus pneumoniae R6]
 gi|182684045|ref|YP_001835792.1| DNA-binding response regulator [Streptococcus pneumoniae CGSP14]
 gi|15458732|gb|AAK99910.1| Response regulator [Streptococcus pneumoniae R6]
 gi|182629379|gb|ACB90327.1| DNA-binding response regulator [Streptococcus pneumoniae CGSP14]
          Length = 251

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 18  MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 77

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 78  LEVAKTIRK---TSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 134

Query: 122 EA 123
            +
Sbjct: 135 RS 136


>gi|309789878|ref|ZP_07684456.1| two component transcriptional regulator, winged helix family
           [Oscillochloris trichoides DG6]
 gi|308228085|gb|EFO81735.1| two component transcriptional regulator, winged helix family
           [Oscillochloris trichoides DG6]
          Length = 231

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IVED     +  R  +E  GY  +   +G++ LE AR+  PD+I++DI L  + G
Sbjct: 1   MPTILIVEDERTLAETLRYNLEREGYTVVVASDGVQGLEQARREPPDLIVLDIMLPRLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + ++++S   ++P+I +TA   + D     + G + YISKP SL  F+  I+  + 
Sbjct: 61  FSVCRILRQES---DVPIIMLTARQDEVDRIAGLELGADDYISKPFSLGEFLARIRAIMR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|329115847|ref|ZP_08244564.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus parauberis NCFD 2020]
 gi|326906252|gb|EGE53166.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus parauberis NCFD 2020]
          Length = 236

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV+IV+D +    + +  +   GY  +   +G EA+    + KPD++I+D+ L E+ G
Sbjct: 1   MKKVLIVDDEKPISDIIKFNLTKEGYDTITAFDGREAVTAFEEEKPDLVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|332654085|ref|ZP_08419829.1| DNA-binding response regulator VicR [Ruminococcaceae bacterium D16]
 gi|332517171|gb|EGJ46776.1| DNA-binding response regulator VicR [Ruminococcaceae bacterium D16]
          Length = 240

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D  + +K     ++  GY      +G EA+ELAR+ K D+II+D+ + +I G
Sbjct: 8   MAKILVVDDERVLVKGITFNLKNEGYQVETGYDGEEAVELAREGKFDLIILDLMMPKIDG 67

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L+   +I+E      +P+I +TA +   D+    + G + YI+KP ++      ++  + 
Sbjct: 68  LQACMRIRE---FSNVPIIMLTARSEDTDKIIGFECGADDYITKPFNILELKARVRALLR 124

Query: 122 EA 123
            +
Sbjct: 125 RS 126


>gi|237707608|ref|ZP_04538089.1| transcriptional regulator PhoB [Escherichia sp. 3_2_53FAA]
 gi|226898818|gb|EEH85077.1| transcriptional regulator PhoB [Escherichia sp. 3_2_53FAA]
 gi|315289887|gb|EFU49277.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 110-3]
 gi|323958591|gb|EGB54294.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H263]
          Length = 229

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|145298254|ref|YP_001141095.1| two-component system response regulator PhoB [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851026|gb|ABO89347.1| two-component system response regulator PhoB [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 229

 Score =  173 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E  GY  ++  +  + L    +  P++I++D  +   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQKGYETIEAEDYADGLAKVCEPYPELIVLDWMMPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  KQ+K+D   ++IPV+ +TA   + D+ R  + G + YI+KP S       +   +
Sbjct: 61  GIQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|157693311|ref|YP_001487773.1| response regulator PhoP [Bacillus pumilus SAFR-032]
 gi|157682069|gb|ABV63213.1| response regulator PhoP [Bacillus pumilus SAFR-032]
          Length = 242

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L    +E +GY  +  R+G EALE A   +PD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLSYNLERAGYDVVTARDGEEALEKAASEQPDLIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ++    +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRIQKMM--FPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVGARVKAIL 118

Query: 121 GEA 123
             A
Sbjct: 119 RRA 121


>gi|91794040|ref|YP_563691.1| phosphate regulon transcriptional regulatory protein phoB
           [Shewanella denitrificans OS217]
 gi|91716042|gb|ABE55968.1| two component transcriptional regulator, winged helix family
           [Shewanella denitrificans OS217]
          Length = 229

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED     ++   ++E  G+  +   +   A+ L ++  PD+I++D      S
Sbjct: 1   MTARILIVEDESAIREMLIFVMEQHGFTTVAAEDFDSAIGLLQEPYPDLILLDWMFPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K++K+D   ++IP+I +TA   + D+ +  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLAKRLKQDKFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|15674628|ref|NP_268802.1| two-component response regulator [Streptococcus pyogenes M1 GAS]
 gi|19745650|ref|NP_606786.1| two-component response regulator [Streptococcus pyogenes MGAS8232]
 gi|21909908|ref|NP_664176.1| two-component response regulator [Streptococcus pyogenes MGAS315]
 gi|28896393|ref|NP_802743.1| two-component response regulator [Streptococcus pyogenes SSI-1]
 gi|50913815|ref|YP_059787.1| VicR [Streptococcus pyogenes MGAS10394]
 gi|56808928|ref|ZP_00366636.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain
           [Streptococcus pyogenes M49 591]
 gi|71903089|ref|YP_279892.1| two-component response regulator [Streptococcus pyogenes MGAS6180]
 gi|71910248|ref|YP_281798.1| two-component response regulator [Streptococcus pyogenes MGAS5005]
 gi|94988065|ref|YP_596166.1| two-component response regulator [Streptococcus pyogenes MGAS9429]
 gi|94989945|ref|YP_598045.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS10270]
 gi|94991951|ref|YP_600050.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS2096]
 gi|94993851|ref|YP_601949.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS10750]
 gi|139474240|ref|YP_001128956.1| response regulator protein [Streptococcus pyogenes str. Manfredo]
 gi|209558999|ref|YP_002285471.1| Two-component response regulator [Streptococcus pyogenes NZ131]
 gi|306827822|ref|ZP_07461092.1| response regulator [Streptococcus pyogenes ATCC 10782]
 gi|13621741|gb|AAK33523.1| two-component response regulator [Streptococcus pyogenes M1 GAS]
 gi|19747781|gb|AAL97285.1| two-component response regulator [Streptococcus pyogenes MGAS8232]
 gi|21904096|gb|AAM78979.1| two-component response regulator [Streptococcus pyogenes MGAS315]
 gi|28811644|dbj|BAC64576.1| putative two-component response regulator [Streptococcus pyogenes
           SSI-1]
 gi|50902889|gb|AAT86604.1| VicR [Streptococcus pyogenes MGAS10394]
 gi|71802184|gb|AAX71537.1| two-component response regulator [Streptococcus pyogenes MGAS6180]
 gi|71853030|gb|AAZ51053.1| two-component response regulator [Streptococcus pyogenes MGAS5005]
 gi|94541573|gb|ABF31622.1| two-component response regulator [Streptococcus pyogenes MGAS9429]
 gi|94543453|gb|ABF33501.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS10270]
 gi|94545459|gb|ABF35506.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS2096]
 gi|94547359|gb|ABF37405.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS10750]
 gi|134272487|emb|CAM30750.1| response regulator protein [Streptococcus pyogenes str. Manfredo]
 gi|209540200|gb|ACI60776.1| Two-component response regulator [Streptococcus pyogenes NZ131]
 gi|304429992|gb|EFM33031.1| response regulator [Streptococcus pyogenes ATCC 10782]
          Length = 236

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|332653701|ref|ZP_08419445.1| DNA-binding response regulator YycF [Ruminococcaceae bacterium D16]
 gi|332516787|gb|EGJ46392.1| DNA-binding response regulator YycF [Ruminococcaceae bacterium D16]
          Length = 237

 Score =  173 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K V+IVED +  + +    +E  GY  L+  +G   L+LA +  PD++++D+ L  + 
Sbjct: 1   MGKTVLIVEDEQNIVDILSFNLEREGYDTLEAYDGNTGLQLALEQNPDLVLLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I+E      +P++ +TA   + D+    + G + YI+KP  +   +  +K  I
Sbjct: 61  GFEVCRRIRETG--SAVPILMLTAREEEADKVLGLELGADDYITKPFGMRELLARVKANI 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|227508143|ref|ZP_03938192.1| response regulator [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227511166|ref|ZP_03941215.1| response regulator [Lactobacillus buchneri ATCC 11577]
 gi|227523372|ref|ZP_03953421.1| response regulator [Lactobacillus hilgardii ATCC 8290]
 gi|227085648|gb|EEI20960.1| response regulator [Lactobacillus buchneri ATCC 11577]
 gi|227089478|gb|EEI24790.1| response regulator [Lactobacillus hilgardii ATCC 8290]
 gi|227192372|gb|EEI72439.1| response regulator [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 238

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + + +  +   GY      +G EAL+   +  PD+II+D+ L +I 
Sbjct: 1   MAKKILVVDDEKPIVDIEKFNLTKEGYEVFVAYDGEEALKQVNEVDPDLIILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +++++    ++ P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAREVRK---TKDTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|138897044|ref|YP_001127497.1| two-component response regulater [Geobacillus thermodenitrificans
           NG80-2]
 gi|196249865|ref|ZP_03148561.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
 gi|134268557|gb|ABO68752.1| Two-component response regulater [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210741|gb|EDY05504.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
          Length = 237

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY  +   +G EAL+   +  PD+I++DI L    
Sbjct: 1   MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEETMPDLILLDIMLPLKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|256848492|ref|ZP_05553934.1| phosphate regulon transcriptional regulatory protein PhoB
           [Lactobacillus coleohominis 101-4-CHN]
 gi|256714759|gb|EEU29738.1| phosphate regulon transcriptional regulatory protein PhoB
           [Lactobacillus coleohominis 101-4-CHN]
          Length = 235

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV++V+D +    + +  +E  GY  +   +G E LE     +PD+II+D+ L +I 
Sbjct: 1   MANKVLVVDDEKPISDIIKFNLEKEGYEVVTAFDGEEGLEKVESDQPDLIILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++        P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAKRVRAK---HNTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|257870078|ref|ZP_05649731.1| transcriptional regulator [Enterococcus gallinarum EG2]
 gi|257804242|gb|EEV33064.1| transcriptional regulator [Enterococcus gallinarum EG2]
          Length = 234

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EALE   + +PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVYTAYDGEEALEKVAEIEPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++++++    ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRKN---HDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|82775697|ref|YP_402044.1| transcriptional regulator PhoB [Shigella dysenteriae Sd197]
 gi|309786981|ref|ZP_07681593.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1617]
 gi|1172482|sp|P45606|PHOB_SHIDY RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|152773|gb|AAA26535.1| phosphate regulatory protein phoB [Shigella dysenteriae]
 gi|81239845|gb|ABB60555.1| positive response regulator for pho regulon [Shigella dysenteriae
           Sd197]
 gi|308924559|gb|EFP70054.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1617]
          Length = 229

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|146310528|ref|YP_001175602.1| transcriptional regulator PhoB [Enterobacter sp. 638]
 gi|145317404|gb|ABP59551.1| two component transcriptional regulator, winged helix family
           [Enterobacter sp. 638]
          Length = 229

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPIEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K IK ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|332981325|ref|YP_004462766.1| winged helix family two component transcriptional regulator
           [Mahella australiensis 50-1 BON]
 gi|332699003|gb|AEE95944.1| two component transcriptional regulator, winged helix family
           [Mahella australiensis 50-1 BON]
          Length = 235

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 63/119 (52%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D    ++L R  +E +GY      +G  AL+  RQ  PD+II+DI L  I GLE
Sbjct: 5   TILVVDDEAHILELIRFNLENAGYKVEVAEDGETALKFCRQQVPDLIILDIMLPGIDGLE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K ++      ++P+I +TA   + D+    + G + YI+KP  +   +  +K  +  
Sbjct: 65  VCKTLRASVATAKVPIIMLTAKGEEIDKVVGLEIGADDYIAKPFGIRELIARVKALLRR 123


>gi|290474714|ref|YP_003467594.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus bovienii SS-2004]
 gi|289174027|emb|CBJ80814.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus bovienii SS-2004]
          Length = 229

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E +GY  ++  +   A+    +  PD++++D  L   S
Sbjct: 1   MAKRILVVEDEVQIREMVCLVLEQNGYQTVEAEDYDVAVWRLSEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K DS  ++IPV+ VTA   + D  R    G + YI+KP S    +  IK  +
Sbjct: 61  GIQLIKQMKRDSSTRDIPVMMVTARGEEEDRVRGLDVGADDYITKPFSPKELVARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|254788364|ref|YP_003075793.1| phosphate regulon transcriptional regulator PhoB [Teredinibacter
           turnerae T7901]
 gi|237687065|gb|ACR14329.1| phosphate regulon transcriptional regulatory protein PhoB
           [Teredinibacter turnerae T7901]
          Length = 235

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 66/121 (54%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D      + R  +E + Y  L+  +  EA ++    +PD+I++D  +  +SG+
Sbjct: 4   KKILVVDDERAIRDMLRVALEMADYAVLEAADAQEAHQIVVDTRPDLILLDWMMPGVSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E  +++K     +EIP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  EFARRLKSQEVTREIPIIMLTAKGEEDNKIQGLEIGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|42780487|ref|NP_977734.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|206977570|ref|ZP_03238464.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217958874|ref|YP_002337422.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|222095033|ref|YP_002529093.1| response regulator [Bacillus cereus Q1]
 gi|42736406|gb|AAS40342.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|206744288|gb|EDZ55701.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217068126|gb|ACJ82376.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|221239091|gb|ACM11801.1| response regulator [Bacillus cereus Q1]
          Length = 223

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+    +  D +++DI + E+
Sbjct: 1   MSKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|259502101|ref|ZP_05745003.1| DNA-binding response regulator [Lactobacillus antri DSM 16041]
 gi|312868802|ref|ZP_07728991.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus oris PB013-T2-3]
 gi|259169914|gb|EEW54409.1| DNA-binding response regulator [Lactobacillus antri DSM 16041]
 gi|311095645|gb|EFQ53900.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus oris PB013-T2-3]
          Length = 235

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY  +   +G EALE      PD+II+D+ L ++ 
Sbjct: 1   MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAFDGEEALEKVEAEDPDLIILDLMLPKVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++        P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAKRVRAK---HTTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|222529445|ref|YP_002573327.1| winged helix family two component transcriptional regulator
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456292|gb|ACM60554.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 223

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I++D+    ++ +  +E  G+  +   NGM+ + + +   PD++I+DI L +  G E
Sbjct: 2   KILIIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGIAMFKNEMPDLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|78044944|ref|YP_360245.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77997059|gb|ABB15958.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 228

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K +++V+D E   ++ R  +E  G++ L+ ++G EAL+   +HK D+II+D+ L EI G
Sbjct: 1   MKTILLVDDEEKIREVLRLYLEKEGFLVLEAQDGKEALKRFSEHKIDLIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +EI K+I++      +P+I +TA   + D+    + G + Y+ KP S    +  +K  + 
Sbjct: 61  MEIAKEIRK---TSLVPIIMLTARGEEIDKILGLEIGADDYVVKPFSPREVVARVKAVLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|156743164|ref|YP_001433293.1| response regulator receiver modulated diguanylate cyclase
           [Roseiflexus castenholzii DSM 13941]
 gi|156234492|gb|ABU59275.1| response regulator receiver modulated diguanylate cyclase
           [Roseiflexus castenholzii DSM 13941]
          Length = 443

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++I +D     +L   ++ + GY    T+NG + +  A++  PD++I+D+ + ++ 
Sbjct: 1   MTKRILIADDEPAVRQLLELVLRSQGYEVFVTQNGDQLVRTAQEWIPDLVIVDLMMPQMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  +Q++ D+    +P++ +TA +   D       G + YI+KP ++   +  I+ ++
Sbjct: 61  GYEAIRQLRNDTRTAHVPMLILTARSTAEDVVTGFDTGADDYITKPFNIPELLARIRAHL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|281355429|ref|ZP_06241923.1| two component transcriptional regulator, winged helix family
           [Victivallis vadensis ATCC BAA-548]
 gi|281318309|gb|EFB02329.1| two component transcriptional regulator, winged helix family
           [Victivallis vadensis ATCC BAA-548]
          Length = 231

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGY-IALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K K+++VED E   +L R  +   GY       +G EAL  A +  PD+I++D+ L  
Sbjct: 1   MGKEKILVVEDEEAIQELIRYNLNKDGYDRVRCCESGEEALAAATEFAPDLILLDLMLPG 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + GL + +++K D+    IP+I +TA + + D     + G + Y+ KP S  + +  IK 
Sbjct: 61  MDGLAVCRRLKSDTRTSAIPIIMLTAKSEESDIVIGLEMGADDYLPKPFSPKVLIARIKS 120

Query: 119 YIGE 122
            +  
Sbjct: 121 VLRR 124


>gi|315181014|gb|ADT87928.1| Response regulator [Vibrio furnissii NCTC 11218]
          Length = 203

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|254555220|ref|YP_003061637.1| response regulator [Lactobacillus plantarum JDM1]
 gi|300769135|ref|ZP_07079024.1| response regulator [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308179221|ref|YP_003923349.1| response regulator [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254044147|gb|ACT60940.1| response regulator [Lactobacillus plantarum JDM1]
 gi|300493375|gb|EFK28554.1| response regulator [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308044712|gb|ADN97255.1| response regulator [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 235

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EAL+   +  PD+I++D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVDEVHPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +Q++++    ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVARQVRKN---YDMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|291484740|dbj|BAI85815.1| two-component response regulator [Bacillus subtilis subsp. natto
           BEST195]
          Length = 251

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y   +  NG EA+    +   D+I++D+ +    G+E
Sbjct: 19  KILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKGLEANYDLILLDLMMPGTDGIE 78

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI+E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 79  VCRQIREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 135


>gi|90580619|ref|ZP_01236424.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Vibrio angustum S14]
 gi|90438277|gb|EAS63463.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium angustum S14]
          Length = 1114

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 68/116 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D  +N+++  + +  +GY      +G +AL++ +Q +PD+I++DI + E+SG E+
Sbjct: 707 ILVVDDEPVNLQILNNFLRLAGYRVKTAESGHQALDIVQQQRPDLILLDIMMPEMSGYEV 766

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +++   + E+P++ ++A     D  +  + G   Y++KP +    +  I+ Y+
Sbjct: 767 CTLLRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYL 822


>gi|84514488|ref|ZP_01001852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Loktanella vestfoldensis SKA53]
 gi|84511539|gb|EAQ07992.1| phosphate regulon transcriptional regulatory protein PhoB
           [Loktanella vestfoldensis SKA53]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 68/119 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E+ G+  ++  +G EAL L  + +PD+I++D  L   SG+EI
Sbjct: 8   VLVVEDEPAQREVLAYNLESEGFRVIKAADGNEALLLIEEEQPDLILLDWMLPGTSGIEI 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +QIK     +  PVI ++A + + D+ R  + G + YISKP S+   +  +K ++  +
Sbjct: 68  CRQIKSRPAFRMTPVIMLSARSEEVDKVRGLETGADDYISKPYSIIELLARVKAHLRRS 126


>gi|312127494|ref|YP_003992368.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777513|gb|ADQ06999.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 223

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  +   NG++ + + +   PD++I+DI L +  G E
Sbjct: 2   KILVIDDDVKICEVIKLYLEKEGFEVVVAHNGIDGIAMFKNEMPDLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|254456179|ref|ZP_05069608.1| phosphate regulon transcriptional regulatory protein PhoB
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083181|gb|EDZ60607.1| phosphate regulon transcriptional regulatory protein PhoB
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 227

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V I ED    + L +  +E  G+      NG EAL+  +  +PD+I+MD  L ++S
Sbjct: 1   MSAHVFIAEDETSIVTLLKYNLEKEGHKVSFCENGEEALKQIKDKQPDLILMDWMLPDLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K +K+D +  +IP+I +TA   + D+ +    G + Y++KP S       IK  +
Sbjct: 61  GVDICKNLKKDKKFNDIPIIMLTAKGEEEDKLKAFDTGADDYVTKPFSQKELNARIKSLL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|312793633|ref|YP_004026556.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312875870|ref|ZP_07735860.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797351|gb|EFR13690.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180773|gb|ADQ40943.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 223

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  +   NGM+ + + +   PD++I+DI L +  G E
Sbjct: 2   KILVIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGIAMFKNEMPDLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|317128535|ref|YP_004094817.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
 gi|315473483|gb|ADU30086.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
          Length = 238

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M +  K+++V+D E   +L +  +E   Y      NG +AL++A +++ D+I++D+ +  
Sbjct: 1   MSQDAKILVVDDEERIRRLLKMYLEREDYDVDDAENGEKALKMALENEYDLIVLDLMMPG 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           I G+E+ ++I++    +  P+I +TA   + +  +  + G + YI KP S    +  +K 
Sbjct: 61  IDGIEVCEEIRKH---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKA 117

Query: 119 YIGEA 123
            +  +
Sbjct: 118 LLRRS 122


>gi|220932997|ref|YP_002509905.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
 gi|219994307|gb|ACL70910.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
          Length = 226

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++K+++++D E   +L +  +ET+GY      +G E  +       D+II+D+ L  I G
Sbjct: 1   MEKILVIDDEENIRELIKFNLETAGYRVELAADGEEGWDRLND-SIDLIILDLMLPRIDG 59

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L   +Q++ ++  ++IP+I +TA   + D+    + G + YI+KP S    +  IK  + 
Sbjct: 60  LSFCRQVRSNNRFKDIPIIMLTAKGEEVDKIIGLEMGADDYITKPFSPRELVARIKAVLR 119

Query: 122 E 122
            
Sbjct: 120 R 120


>gi|186683796|ref|YP_001866992.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186466248|gb|ACC82049.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 247

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQLQPDLIMLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    EIPV+ +TA +   D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDDRTSEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEELLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|332760677|gb|EGJ90965.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 4343-70]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|114765354|ref|ZP_01444471.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pelagibaca bermudensis HTCC2601]
 gi|114542334|gb|EAU45363.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. HTCC2601]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 66/120 (55%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++ R  +E  G+      NG EAL +  + +PDVI++D  L  +SG+E
Sbjct: 7   TVLVVEDEASQREVLRYNLEAEGFRVAAAGNGEEALVMLDEEEPDVIVLDWMLPNLSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QIK   E + +PVI ++A + + D  R  + G + Y+ KP SL   M  +K  +  A
Sbjct: 67  VCRQIKTRPETRGVPVIMLSARSEEIDRVRGLETGADDYVVKPYSLRELMARVKAQLRRA 126


>gi|6689352|emb|CAB65451.1| VicR protein [Streptococcus pyogenes]
          Length = 239

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 4   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 64  LEVAKEIRK---TSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|148253503|ref|YP_001238088.1| two component transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146405676|gb|ABQ34182.1| two component transcriptional regulator, winged helix family
           [Bradyrhizobium sp. BTAi1]
          Length = 235

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +ET GY       G EA    ++  PD++++D  L  +S
Sbjct: 1   MTARILVVEDEEALTTLLRYNLETEGYEVETVGRGDEADTRLKERVPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRTRPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|212640658|ref|YP_002317178.1| OmpR family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212562138|gb|ACJ35193.1| DNA-binding response regulator, OmpR family (REC-wHTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 236

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +   GY      +G+EAL+     +PD+I++DI L +  
Sbjct: 3   MEKKILVVDDEKPIADILQFNLRKEGYDVHCAYDGVEALQKVEDIQPDLILLDIMLPQKD 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 63  GMEVCREIRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 119

Query: 121 GE 122
             
Sbjct: 120 RR 121


>gi|209695880|ref|YP_002263810.1| response regulator homolog PhoB (phosphate regulon transcriptional
           regulatory protein) [Aliivibrio salmonicida LFI1238]
 gi|208009833|emb|CAQ80141.1| response regulator homolog PhoB (phosphate regulon transcriptional
           regulatory protein) [Aliivibrio salmonicida LFI1238]
          Length = 230

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY  ++  +   AL L  +  PD+I++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDTALALLCEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  I
Sbjct: 61  GINLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|322376761|ref|ZP_08051254.1| DNA-binding response regulator VicR [Streptococcus sp. M334]
 gi|321282568|gb|EFX59575.1| DNA-binding response regulator VicR [Streptococcus sp. M334]
          Length = 234

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|168232366|ref|ZP_02657424.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194471011|ref|ZP_03076995.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|204927311|ref|ZP_03218513.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|238911469|ref|ZP_04655306.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|194457375|gb|EDX46214.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|204323976|gb|EDZ09171.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205333497|gb|EDZ20261.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|229542343|ref|ZP_04431403.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
 gi|229326763|gb|EEN92438.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
          Length = 236

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +   GY      +G EALE   + +PD+I++DI L +  
Sbjct: 1   MDKKILVVDDEKPIADILQFNLTKEGYTVYCAYDGEEALEKVEEVQPDLIVLDIMLPKRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++      +P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YNMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|531494|emb|CAA56927.1| phoB [Shigella flexneri]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|315658044|ref|ZP_07910917.1| response regulator [Staphylococcus lugdunensis M23590]
 gi|315496934|gb|EFU85256.1| response regulator [Staphylococcus lugdunensis M23590]
          Length = 249

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +  + L +  +ET+GYI     +G EALE   + +PD+I++D+ L +  
Sbjct: 14  MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALEKVEKVQPDLIVLDVMLPKKD 73

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 74  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 131

Query: 121 GEA 123
             +
Sbjct: 132 RRS 134


>gi|320181620|gb|EFW56535.1| transcriptional regulator PhoB [Shigella boydii ATCC 9905]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|15800125|ref|NP_286137.1| transcriptional regulator PhoB [Escherichia coli O157:H7 EDL933]
 gi|15829703|ref|NP_308476.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128384|ref|NP_414933.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           MG1655]
 gi|82542888|ref|YP_406835.1| transcriptional regulator PhoB [Shigella boydii Sb227]
 gi|89107269|ref|AP_001049.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           W3110]
 gi|91209466|ref|YP_539452.1| transcriptional regulator PhoB [Escherichia coli UTI89]
 gi|117622660|ref|YP_851573.1| transcriptional regulator PhoB [Escherichia coli APEC O1]
 gi|157154834|ref|YP_001461578.1| transcriptional regulator PhoB [Escherichia coli E24377A]
 gi|157159917|ref|YP_001457235.1| transcriptional regulator PhoB [Escherichia coli HS]
 gi|168749852|ref|ZP_02774874.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4113]
 gi|168756932|ref|ZP_02781939.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4401]
 gi|168761596|ref|ZP_02786603.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4501]
 gi|168768341|ref|ZP_02793348.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4486]
 gi|168776304|ref|ZP_02801311.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4196]
 gi|168783256|ref|ZP_02808263.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786237|ref|ZP_02811244.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC869]
 gi|168800273|ref|ZP_02825280.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC508]
 gi|170021229|ref|YP_001726183.1| transcriptional regulator PhoB [Escherichia coli ATCC 8739]
 gi|170079985|ref|YP_001729305.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170684203|ref|YP_001742532.1| transcriptional regulator PhoB [Escherichia coli SMS-3-5]
 gi|170768000|ref|ZP_02902453.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia albertii TW07627]
 gi|187733926|ref|YP_001879107.1| transcriptional regulator PhoB [Shigella boydii CDC 3083-94]
 gi|188493884|ref|ZP_03001154.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 53638]
 gi|191166743|ref|ZP_03028570.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B7A]
 gi|191173531|ref|ZP_03035058.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli F11]
 gi|193065166|ref|ZP_03046239.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E22]
 gi|193068711|ref|ZP_03049672.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E110019]
 gi|194428827|ref|ZP_03061362.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B171]
 gi|194432677|ref|ZP_03064963.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1012]
 gi|194438843|ref|ZP_03070928.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 101-1]
 gi|195938540|ref|ZP_03083922.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807385|ref|ZP_03249722.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4206]
 gi|208815127|ref|ZP_03256306.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4045]
 gi|208823163|ref|ZP_03263481.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398675|ref|YP_002269037.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4115]
 gi|209917610|ref|YP_002291694.1| transcriptional regulator PhoB [Escherichia coli SE11]
 gi|215485480|ref|YP_002327911.1| transcriptional regulator PhoB [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326124|ref|ZP_03442208.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. TW14588]
 gi|218552961|ref|YP_002385874.1| transcriptional regulator PhoB [Escherichia coli IAI1]
 gi|218557308|ref|YP_002390221.1| transcriptional regulator PhoB [Escherichia coli S88]
 gi|218688261|ref|YP_002396473.1| transcriptional regulator PhoB [Escherichia coli ED1a]
 gi|218693859|ref|YP_002401526.1| transcriptional regulator PhoB [Escherichia coli 55989]
 gi|218698697|ref|YP_002406326.1| transcriptional regulator PhoB [Escherichia coli IAI39]
 gi|218703680|ref|YP_002411199.1| transcriptional regulator PhoB [Escherichia coli UMN026]
 gi|227884595|ref|ZP_04002400.1| transcriptional regulator PhoB [Escherichia coli 83972]
 gi|238899687|ref|YP_002925483.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BW2952]
 gi|253774616|ref|YP_003037447.1| transcriptional regulator PhoB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160466|ref|YP_003043574.1| transcriptional regulator PhoB [Escherichia coli B str. REL606]
 gi|254791577|ref|YP_003076414.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020366|ref|ZP_05434231.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|256023984|ref|ZP_05437849.1| transcriptional regulator PhoB [Escherichia sp. 4_1_40B]
 gi|260842597|ref|YP_003220375.1| DNA-binding response regulator PhoB [Escherichia coli O103:H2 str.
           12009]
 gi|260853619|ref|YP_003227510.1| DNA-binding response regulator PhoB [Escherichia coli O26:H11 str.
           11368]
 gi|260866558|ref|YP_003232960.1| DNA-binding response regulator PhoB [Escherichia coli O111:H- str.
           11128]
 gi|261223875|ref|ZP_05938156.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256411|ref|ZP_05948944.1| DNA-binding response regulator PhoB [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281302|ref|YP_003498120.1| Positive response regulator for pho regulon [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403516|ref|ZP_06647607.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli FVEC1412]
 gi|293408543|ref|ZP_06652382.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B354]
 gi|293413651|ref|ZP_06656300.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B185]
 gi|293418465|ref|ZP_06660900.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B088]
 gi|298379128|ref|ZP_06989009.1| transcriptional regulator PhoB [Escherichia coli FVEC1302]
 gi|300820364|ref|ZP_07100516.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 119-7]
 gi|300900462|ref|ZP_07118630.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 198-1]
 gi|300903338|ref|ZP_07121266.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 84-1]
 gi|300918223|ref|ZP_07134829.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 115-1]
 gi|300924116|ref|ZP_07140109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 182-1]
 gi|300930309|ref|ZP_07145721.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 187-1]
 gi|300936383|ref|ZP_07151311.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 21-1]
 gi|300947953|ref|ZP_07162099.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 116-1]
 gi|300957961|ref|ZP_07170127.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 175-1]
 gi|300988101|ref|ZP_07178538.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 45-1]
 gi|300997414|ref|ZP_07181754.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 200-1]
 gi|301025440|ref|ZP_07188990.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 69-1]
 gi|301025776|ref|ZP_07189288.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 196-1]
 gi|301049597|ref|ZP_07196549.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 185-1]
 gi|301301545|ref|ZP_07207680.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 124-1]
 gi|301330743|ref|ZP_07223344.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 78-1]
 gi|301647317|ref|ZP_07247131.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 146-1]
 gi|306813135|ref|ZP_07447328.1| transcriptional regulator PhoB [Escherichia coli NC101]
 gi|307137041|ref|ZP_07496397.1| transcriptional regulator PhoB [Escherichia coli H736]
 gi|307312226|ref|ZP_07591862.1| two component transcriptional regulator, winged helix family
           [Escherichia coli W]
 gi|309794878|ref|ZP_07689299.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 145-7]
 gi|312964580|ref|ZP_07778836.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 2362-75]
 gi|312970492|ref|ZP_07784673.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1827-70]
 gi|331640913|ref|ZP_08342048.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H736]
 gi|331645570|ref|ZP_08346674.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M605]
 gi|331651327|ref|ZP_08352352.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M718]
 gi|331661771|ref|ZP_08362694.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA143]
 gi|331666746|ref|ZP_08367620.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA271]
 gi|331671945|ref|ZP_08372741.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA280]
 gi|331676064|ref|ZP_08376776.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H591]
 gi|331681792|ref|ZP_08382425.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H299]
 gi|332281544|ref|ZP_08393957.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|84029275|sp|P0AFJ6|PHOB_ECO57 RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|84029276|sp|P0AFJ5|PHOB_ECOLI RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|12513245|gb|AAG54745.1|AE005219_1 positive response regulator for pho regulon, sensor is PhoR (or
           CreC) [Escherichia coli O157:H7 str. EDL933]
 gi|42388|emb|CAA27659.1| unnamed protein product [Escherichia coli]
 gi|1657595|gb|AAB18123.1| phosphate regulon transcriptional regulatory protein phoB
           [Escherichia coli str. K-12 substr. MG1655]
 gi|1786599|gb|AAC73502.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13359906|dbj|BAB33872.1| positive response regulator for pho regulon PhoB [Escherichia coli
           O157:H7 str. Sakai]
 gi|16209152|gb|AAL09901.1| PhoB [CRIM plasmid pAH150]
 gi|81244299|gb|ABB65007.1| positive response regulator for pho regulon [Shigella boydii Sb227]
 gi|85674539|dbj|BAE76179.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K12 substr.
           W3110]
 gi|91071040|gb|ABE05921.1| positive response regulator for pho regulon [Escherichia coli
           UTI89]
 gi|115511784|gb|ABI99858.1| positive response regulator for pho regulon [Escherichia coli APEC
           O1]
 gi|157065597|gb|ABV04852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli HS]
 gi|157076864|gb|ABV16572.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E24377A]
 gi|169756157|gb|ACA78856.1| two component transcriptional regulator, winged helix family
           [Escherichia coli ATCC 8739]
 gi|169887820|gb|ACB01527.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170123488|gb|EDS92419.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia albertii TW07627]
 gi|170521921|gb|ACB20099.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli SMS-3-5]
 gi|187430918|gb|ACD10192.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii CDC 3083-94]
 gi|187768306|gb|EDU32150.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4196]
 gi|188015917|gb|EDU54039.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4113]
 gi|188489083|gb|EDU64186.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 53638]
 gi|188999370|gb|EDU68356.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4076]
 gi|189356009|gb|EDU74428.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4401]
 gi|189362392|gb|EDU80811.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4486]
 gi|189368045|gb|EDU86461.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373726|gb|EDU92142.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC869]
 gi|189377396|gb|EDU95812.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC508]
 gi|190903254|gb|EDV62976.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B7A]
 gi|190906240|gb|EDV65852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli F11]
 gi|192927140|gb|EDV81761.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E22]
 gi|192958074|gb|EDV88516.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E110019]
 gi|194413130|gb|EDX29417.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B171]
 gi|194419238|gb|EDX35321.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1012]
 gi|194422137|gb|EDX38139.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 101-1]
 gi|208727186|gb|EDZ76787.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4206]
 gi|208731775|gb|EDZ80463.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4045]
 gi|208737356|gb|EDZ85040.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4042]
 gi|209160075|gb|ACI37508.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4115]
 gi|209744234|gb|ACI70424.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744236|gb|ACI70425.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744238|gb|ACI70426.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744240|gb|ACI70427.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744242|gb|ACI70428.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209910869|dbj|BAG75943.1| two-component response regulator [Escherichia coli SE11]
 gi|213521171|gb|ACJ50526.1| PhoB [Escherichia coli]
 gi|215263552|emb|CAS07882.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322345|gb|EEC30769.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. TW14588]
 gi|218350591|emb|CAU96281.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli 55989]
 gi|218359729|emb|CAQ97270.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli IAI1]
 gi|218364077|emb|CAR01742.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli S88]
 gi|218368683|emb|CAR16423.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli IAI39]
 gi|218425825|emb|CAR06631.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli ED1a]
 gi|218430777|emb|CAR11651.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli UMN026]
 gi|222032194|emb|CAP74933.1| Phosphate regulon transcriptional regulatory protein [Escherichia
           coli LF82]
 gi|227838681|gb|EEJ49147.1| transcriptional regulator PhoB [Escherichia coli 83972]
 gi|238860869|gb|ACR62867.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BW2952]
 gi|242376177|emb|CAQ30868.1| PhoB transcriptional dual regulator [Escherichia coli BL21(DE3)]
 gi|253325660|gb|ACT30262.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972367|gb|ACT38038.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli B str. REL606]
 gi|253976576|gb|ACT42246.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BL21(DE3)]
 gi|254590977|gb|ACT70338.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O157:H7 str.
           TW14359]
 gi|257752268|dbj|BAI23770.1| DNA-binding response regulator PhoB [Escherichia coli O26:H11 str.
           11368]
 gi|257757744|dbj|BAI29241.1| DNA-binding response regulator PhoB [Escherichia coli O103:H2 str.
           12009]
 gi|257762914|dbj|BAI34409.1| DNA-binding response regulator PhoB [Escherichia coli O111:H- str.
           11128]
 gi|260450414|gb|ACX40836.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli DH1]
 gi|281177569|dbj|BAI53899.1| two-component response regulator [Escherichia coli SE15]
 gi|284920205|emb|CBG33264.1| phosphate regulon two-component system, response regulator
           [Escherichia coli 042]
 gi|290761175|gb|ADD55136.1| Positive response regulator for pho regulon [Escherichia coli
           O55:H7 str. CB9615]
 gi|291324993|gb|EFE64408.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B088]
 gi|291429369|gb|EFF02389.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli FVEC1412]
 gi|291433709|gb|EFF06682.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B185]
 gi|291471721|gb|EFF14204.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B354]
 gi|294490411|gb|ADE89167.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli IHE3034]
 gi|298280241|gb|EFI21745.1| transcriptional regulator PhoB [Escherichia coli FVEC1302]
 gi|299879979|gb|EFI88190.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 196-1]
 gi|300298642|gb|EFJ55027.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 185-1]
 gi|300304233|gb|EFJ58753.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 200-1]
 gi|300315335|gb|EFJ65119.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 175-1]
 gi|300356031|gb|EFJ71901.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 198-1]
 gi|300396025|gb|EFJ79563.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 69-1]
 gi|300404633|gb|EFJ88171.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 84-1]
 gi|300407515|gb|EFJ91053.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 45-1]
 gi|300414608|gb|EFJ97918.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 115-1]
 gi|300419669|gb|EFK02980.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 182-1]
 gi|300452489|gb|EFK16109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 116-1]
 gi|300458489|gb|EFK21982.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 21-1]
 gi|300461769|gb|EFK25262.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 187-1]
 gi|300527149|gb|EFK48218.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 119-7]
 gi|300843042|gb|EFK70802.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 124-1]
 gi|300843315|gb|EFK71075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 78-1]
 gi|301074542|gb|EFK89348.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 146-1]
 gi|305853898|gb|EFM54337.1| transcriptional regulator PhoB [Escherichia coli NC101]
 gi|306907728|gb|EFN38230.1| two component transcriptional regulator, winged helix family
           [Escherichia coli W]
 gi|307552303|gb|ADN45078.1| positive response regulator for pho regulon [Escherichia coli ABU
           83972]
 gi|307628132|gb|ADN72436.1| transcriptional regulator PhoB [Escherichia coli UM146]
 gi|308121531|gb|EFO58793.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 145-7]
 gi|309700660|emb|CBI99956.1| phosphate regulon two-component system, response regulator
           [Escherichia coli ETEC H10407]
 gi|310337141|gb|EFQ02279.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1827-70]
 gi|312290814|gb|EFR18691.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 2362-75]
 gi|312944976|gb|ADR25803.1| transcriptional regulator PhoB [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315059676|gb|ADT74003.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli W]
 gi|315135081|dbj|BAJ42240.1| positive response regulator for pho regulon [Escherichia coli DH1]
 gi|315256222|gb|EFU36190.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 85-1]
 gi|315294171|gb|EFU53522.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 153-1]
 gi|315616662|gb|EFU97279.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 3431]
 gi|320173784|gb|EFW48967.1| transcriptional regulator PhoB [Shigella dysenteriae CDC 74-1112]
 gi|320186028|gb|EFW60773.1| transcriptional regulator PhoB [Shigella flexneri CDC 796-83]
 gi|320192810|gb|EFW67450.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197165|gb|EFW71782.1| transcriptional regulator PhoB [Escherichia coli WV_060327]
 gi|320201640|gb|EFW76216.1| transcriptional regulator PhoB [Escherichia coli EC4100B]
 gi|320638387|gb|EFX08101.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           G5101]
 gi|320643767|gb|EFX12890.1| transcriptional regulator PhoB [Escherichia coli O157:H- str.
           493-89]
 gi|320649118|gb|EFX17696.1| transcriptional regulator PhoB [Escherichia coli O157:H- str. H
           2687]
 gi|320656011|gb|EFX23927.1| transcriptional regulator PhoB [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662568|gb|EFX29957.1| transcriptional regulator PhoB [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665138|gb|EFX32231.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152134|gb|EFZ38427.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli EPECa14]
 gi|323160495|gb|EFZ46443.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E128010]
 gi|323164189|gb|EFZ49996.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           sonnei 53G]
 gi|323170479|gb|EFZ56129.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli LT-68]
 gi|323178339|gb|EFZ63917.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1180]
 gi|323191316|gb|EFZ76579.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli RN587/1]
 gi|323379758|gb|ADX52026.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli KO11]
 gi|323938583|gb|EGB34832.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E1520]
 gi|323943204|gb|EGB39360.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E482]
 gi|323945298|gb|EGB41354.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H120]
 gi|323952990|gb|EGB48858.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H252]
 gi|323963384|gb|EGB58946.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H489]
 gi|323965348|gb|EGB60806.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M863]
 gi|323972248|gb|EGB67458.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA007]
 gi|323976121|gb|EGB71214.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TW10509]
 gi|324010107|gb|EGB79326.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 57-2]
 gi|324010710|gb|EGB79929.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 60-1]
 gi|324016661|gb|EGB85880.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 117-3]
 gi|324116882|gb|EGC10795.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E1167]
 gi|326341157|gb|EGD64949.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str. 1044]
 gi|326346067|gb|EGD69806.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str. 1125]
 gi|327254715|gb|EGE66331.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli STEC_7v]
 gi|330910192|gb|EGH38702.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Escherichia coli AA86]
 gi|331037711|gb|EGI09931.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H736]
 gi|331045732|gb|EGI17858.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M605]
 gi|331051068|gb|EGI23120.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M718]
 gi|331060193|gb|EGI32157.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA143]
 gi|331065970|gb|EGI37854.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA271]
 gi|331070934|gb|EGI42293.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA280]
 gi|331076122|gb|EGI47404.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H591]
 gi|331080994|gb|EGI52159.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H299]
 gi|332085836|gb|EGI91000.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 155-74]
 gi|332094547|gb|EGI99593.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii 5216-82]
 gi|332098617|gb|EGJ03583.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii 3594-74]
 gi|332103896|gb|EGJ07242.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|332341761|gb|AEE55095.1| transcriptional regulator protein PhoB [Escherichia coli UMNK88]
          Length = 229

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302520777|ref|ZP_07273119.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
 gi|302429672|gb|EFL01488.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
          Length = 244

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+D     +  R  +   GY      +G EAL+ A    PD++++DIQ+  + GL
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALQKAAATPPDLVVLDIQMPGMDGL 72

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 73  TAARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130

Query: 123 A 123
           +
Sbjct: 131 S 131


>gi|90413136|ref|ZP_01221132.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum 3TCK]
 gi|90325827|gb|EAS42279.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum 3TCK]
          Length = 1117

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 65/115 (56%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D  +N+++  + +   GY  L   +G +AL++  Q +P +I++DI + E+SG E+ 
Sbjct: 712 LVVDDEPVNLQVLNNFLRLEGYRVLTADSGPQALKIIEQQQPALILLDIMMPEMSGYEVC 771

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++E+  L E+P+I ++A     D  +  + G   Y++KP +    +  I  ++
Sbjct: 772 HILREEHSLIELPIIMLSALGQVQDRIKGFESGANDYLTKPFNKEELIARISAHL 826


>gi|15615719|ref|NP_244023.1| two-component response regulator involved in phosphate regulation
           [Bacillus halodurans C-125]
 gi|10175779|dbj|BAB06876.1| two-component response regulator involved in phosphate regulation
           [Bacillus halodurans C-125]
          Length = 239

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 68/122 (55%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D E  + L +  +E SGY  +   +G   L+LA+    D+II+D+ L E+ 
Sbjct: 1   MTQRLLVVDDEESIVTLLQFNLEQSGYEVVTAMDGASGLQLAKTQTFDLIILDLMLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ KQ+++   +   P++ +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GLDVCKQLRQSKVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVRAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|149180955|ref|ZP_01859456.1| hypothetical protein BSG1_10961 [Bacillus sp. SG-1]
 gi|148851239|gb|EDL65388.1| hypothetical protein BSG1_10961 [Bacillus sp. SG-1]
          Length = 236

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY      +G EA+++A + KPD++++DI L    
Sbjct: 1   MDKKILVVDDEKPIADILQFNLKKEGYEVHCAYDGDEAVKMAEEIKPDLVLLDIMLPNRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I++  E   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREIRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|295096819|emb|CBK85909.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K IK ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|307149957|ref|YP_003885341.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7822]
 gi|306980185|gb|ADN12066.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7822]
          Length = 242

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  RQ  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRQTNPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|218549942|ref|YP_002383733.1| transcriptional regulator PhoB [Escherichia fergusonii ATCC 35469]
 gi|218357483|emb|CAQ90122.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia fergusonii ATCC 35469]
 gi|324114618|gb|EGC08586.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia fergusonii B253]
 gi|325498318|gb|EGC96177.1| transcriptional regulator PhoB [Escherichia fergusonii ECD227]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|205374546|ref|ZP_03227342.1| response regulator PhoP [Bacillus coahuilensis m4-4]
          Length = 238

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + L +  +E +GY  L   +G E  ELA   KPD I++D+ L ++ 
Sbjct: 1   MSKKILVVDDEQSIVTLLKYNLEQAGYTVLTANDGEEGYELAMSDKPDFIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K +++   +   P++ +TA   + D+    + G + Y++KP S    +  IK  +
Sbjct: 61  GIEVCKNLRQQKMM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARIKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|121996908|ref|YP_001001695.1| two component transcriptional regulator [Halorhodospira halophila
           SL1]
 gi|121588313|gb|ABM60893.1| two component transcriptional regulator, winged helix family
           [Halorhodospira halophila SL1]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED+    ++    +E  G+  +   + M+  E  RQ  PD+I++D  L ++S
Sbjct: 1   MAVRILVVEDDPAVREMLITSLERQGFEVIPAVDAMQGSEQLRQRPPDLILLDWMLPQVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  +++KED + ++IP+I +TA   + D+ R    G + Y++KP S       +K  +
Sbjct: 61  GVEWARELKEDDQTRQIPIILLTARGEEEDKVRGFDSGVDDYVTKPFSPRELAARVKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|218885985|ref|YP_002435306.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756939|gb|ACL07838.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 230

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 70/124 (56%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K ++++VED+E  ++L     E++G+       G E LE+A + KP ++++D+ L  +
Sbjct: 1   MTKERILVVEDDEDILQLLTFTFESAGFEVRTATTGREGLEIALRQKPALVLLDLMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SGL++ +++K   E +++PVI +TA   + D     + G + Y+ KP S    +  I+  
Sbjct: 61  SGLDVCRELKRMPETEDVPVIMLTARGEEVDRIVGLELGADDYVVKPFSPRELVLRIRAV 120

Query: 120 IGEA 123
           +  A
Sbjct: 121 LKRA 124


>gi|153940678|ref|YP_001390399.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|152936574|gb|ABS42072.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|295318486|gb|ADF98863.1| DNA-binding response regulator [Clostridium botulinum F str.
           230613]
          Length = 233

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K  K+++V+D E  + + +  +E   Y  +   +G EA++L ++    +II+D+ L +
Sbjct: 1   MKKLFKILVVDDEERILDVVKAYLEKEDYEVITAMDGEEAIKLFKETSFHLIILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +SG E+  +I+E S    +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 61  LSGEEVCSKIRESS---NVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|260596767|ref|YP_003209338.1| transcriptional regulator PhoB [Cronobacter turicensis z3032]
 gi|260215944|emb|CBA28550.1| Phosphate regulon transcriptional regulatory protein phoB
           [Cronobacter turicensis z3032]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K IK ++  +EIPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHIKREALTREIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|156935054|ref|YP_001438970.1| transcriptional regulator PhoB [Cronobacter sakazakii ATCC BAA-894]
 gi|156533308|gb|ABU78134.1| hypothetical protein ESA_02905 [Cronobacter sakazakii ATCC BAA-894]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K IK ++  +EIPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHIKREALTREIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|229073625|ref|ZP_04206740.1| Two-component response regulator [Bacillus cereus F65185]
 gi|229182223|ref|ZP_04309505.1| Two-component response regulator [Bacillus cereus 172560W]
 gi|228601238|gb|EEK58777.1| Two-component response regulator [Bacillus cereus 172560W]
 gi|228709480|gb|EEL61539.1| Two-component response regulator [Bacillus cereus F65185]
          Length = 342

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D++    L    +E  G    +  + MEAL+L  + + D+II+DI +  + 
Sbjct: 115 MESKILIVDDDKEIRNLISAYLENEGLKTQKAEDAMEALQLLEEKEFDLIILDIMMPNMD 174

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E   +I+ED   + IP+I ++A +   D+ +    G + Y+SKP +    +  +K  +
Sbjct: 175 GIEACMKIRED---RNIPIIMLSAKSEDIDKIQGLASGADDYLSKPFNPLELIARVKSQL 231

Query: 121 GE 122
             
Sbjct: 232 RR 233


>gi|239828688|ref|YP_002951312.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. WCH70]
 gi|239808981|gb|ACS26046.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. WCH70]
          Length = 236

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 68/123 (55%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ K++++V+D +    + +  ++  GY  +   +G EAL+   +  PD+I++DI L + 
Sbjct: 1   MMEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEEVMPDLILLDIMLPQK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  ++  
Sbjct: 61  DGMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVRAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|333010839|gb|EGK30265.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-272]
 gi|333021338|gb|EGK40591.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-227]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|6687469|emb|CAB64972.1| VicR protein [Enterococcus faecalis]
          Length = 283

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 67/120 (55%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +   ++ +  +   GY      +G EALE   + +PD+II+D+ L ++ GL
Sbjct: 51  KKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVEEVEPDLIILDLMLPKMDGL 110

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 111 EVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 167


>gi|304407578|ref|ZP_07389230.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
 gi|304343529|gb|EFM09371.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
          Length = 233

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 61/123 (49%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + ++IV+D+    +L    +   GY      +G EAL +      D+I++D+ +  + 
Sbjct: 1   MTRTILIVDDDRQIAELVDIYLRNEGYSTAIAGDGEEALRMFEAQPFDLIVLDVMMPRMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++++ D   + +P++ V+A A   D+      G + Y++KP +       +K  +
Sbjct: 61  GLELCRRLRRDKSAETVPILMVSAKAEDMDKIMGLMTGADDYMTKPFNPLELTARVKSLL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|332702026|ref|ZP_08422114.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332552175|gb|EGJ49219.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 227

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  ++IVED+E  ++L +  +E++GY A+   +G+EAL  AR+H PD+I++D+ L  +
Sbjct: 1   MAKETILIVEDDEDILQLIKFNVESAGYDAITASDGLEALNKARRHMPDLILLDLMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+ K++K  SE   IP++ +TA   + D     + G + Y+ KP S    +  ++  
Sbjct: 61  DGFEVCKELKRGSETGRIPILMLTARGEEVDRIVGLELGADDYVVKPFSPREIILRVRAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|16759374|ref|NP_454991.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16763777|ref|NP_459392.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142855|ref|NP_806197.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62179008|ref|YP_215425.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161615421|ref|YP_001589386.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167551797|ref|ZP_02345550.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167992242|ref|ZP_02573340.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168237507|ref|ZP_02662565.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168240215|ref|ZP_02665147.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168261175|ref|ZP_02683148.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168465482|ref|ZP_02699364.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168818997|ref|ZP_02830997.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194450960|ref|YP_002044430.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736716|ref|YP_002113428.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197264166|ref|ZP_03164240.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198244456|ref|YP_002214351.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200390991|ref|ZP_03217602.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|207855879|ref|YP_002242530.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213051513|ref|ZP_03344391.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213417376|ref|ZP_03350518.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213582091|ref|ZP_03363917.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213620466|ref|ZP_03373292.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647670|ref|ZP_03377723.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855581|ref|ZP_03383821.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224582234|ref|YP_002636032.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|289828482|ref|ZP_06546340.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25300971|pir||AD0551 phosphate regulon transcription regulatory protein PhoB STY0432
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16418901|gb|AAL19351.1| response regulator in two-component regulatory system with PhoR (or
           CreC) [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16501665|emb|CAD08852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138487|gb|AAO70057.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|62126641|gb|AAX64344.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulates pho regulon (OmpR family) [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161364785|gb|ABX68553.1| hypothetical protein SPAB_03192 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409264|gb|ACF69483.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194712218|gb|ACF91439.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195631850|gb|EDX50370.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197242421|gb|EDY25041.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197289486|gb|EDY28849.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938972|gb|ACH76305.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199603436|gb|EDZ01982.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205323482|gb|EDZ11321.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205329543|gb|EDZ16307.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205340400|gb|EDZ27164.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205344060|gb|EDZ30824.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205349830|gb|EDZ36461.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206707682|emb|CAR31966.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224466761|gb|ACN44591.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261245680|emb|CBG23476.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267992105|gb|ACY86990.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157009|emb|CBW16492.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312911430|dbj|BAJ35404.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320084671|emb|CBY94462.1| Phosphate regulon transcriptional regulatory protein phoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321225121|gb|EFX50182.1| Phosphate regulon transcriptional regulatory protein PhoB SphR
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322614680|gb|EFY11609.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618786|gb|EFY15674.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623493|gb|EFY20332.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629209|gb|EFY25988.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631929|gb|EFY28683.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637333|gb|EFY34035.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642019|gb|EFY38629.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646219|gb|EFY42733.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652515|gb|EFY48869.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653322|gb|EFY49655.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660529|gb|EFY56765.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664681|gb|EFY60874.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669266|gb|EFY65416.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670812|gb|EFY66945.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678950|gb|EFY75005.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681978|gb|EFY78003.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685193|gb|EFY81190.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322713467|gb|EFZ05038.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323128714|gb|ADX16144.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194459|gb|EFZ79654.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197005|gb|EFZ82147.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203989|gb|EFZ89006.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206925|gb|EFZ91878.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211059|gb|EFZ95915.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214547|gb|EFZ99298.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223104|gb|EGA07447.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227053|gb|EGA11234.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230129|gb|EGA14249.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233867|gb|EGA17956.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238439|gb|EGA22497.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244127|gb|EGA28136.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246287|gb|EGA30270.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251913|gb|EGA35776.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323257910|gb|EGA41589.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261077|gb|EGA44669.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264993|gb|EGA48492.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272556|gb|EGA55963.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326622099|gb|EGE28444.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332987345|gb|AEF06328.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|116750317|ref|YP_847004.1| two component transcriptional regulator [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699381|gb|ABK18569.1| two component transcriptional regulator, winged helix family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 227

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 70/124 (56%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +++IVED+   + L    IE +G+  ++  +G  ALE+ R+H PD++++D+ +  I
Sbjct: 1   MPKARILIVEDDSDILHLLAYNIEAAGFDVVKAMDGNTALEMVRRHPPDLVVLDLMIPGI 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+ K++K  +E + IPVI +TA   + D     + G + Y+ KP S    +  I+  
Sbjct: 61  DGFEVCKELKRGAETRGIPVIMLTARGEEVDRIVGLELGADDYVVKPFSPRELILRIRAI 120

Query: 120 IGEA 123
           +  +
Sbjct: 121 LRRS 124


>gi|227529845|ref|ZP_03959894.1| DNA-binding response regulator [Lactobacillus vaginalis ATCC 49540]
 gi|227350329|gb|EEJ40620.1| DNA-binding response regulator [Lactobacillus vaginalis ATCC 49540]
          Length = 241

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY  +   +G EALE     KPD+II+D+ L +I 
Sbjct: 7   MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAFDGEEALEKVEGEKPDLIILDLMLPKID 66

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++        P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 67  GLEVAKRVRAK---HTTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 123

Query: 121 GE 122
             
Sbjct: 124 RR 125


>gi|86606539|ref|YP_475302.1| DNA-binding response regulator RpaA [Synechococcus sp. JA-3-3Ab]
 gi|86555081|gb|ABD00039.1| DNA-binding response regulator RpaA [Synechococcus sp. JA-3-3Ab]
          Length = 251

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 67/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+ED+   + + R  +E +GY  ++  +G+    LA Q  PD+II+D+ L ++ G
Sbjct: 1   MARILIIEDDPSILDILRINLELAGYEVVKATDGVRGQALALQVLPDLIILDLMLPQVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + ++++ +    EIP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  LTVCQRLRREERTSEIPILMLTALGQTQDKIEGFNAGADDYLTKPFEVQELLVRVRALLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|226357509|ref|YP_002787249.1| response regulator, CheY [Deinococcus deserti VCD115]
 gi|226319500|gb|ACO47495.1| putative response regulator, CheY [Deinococcus deserti VCD115]
          Length = 227

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++IVEDN     + R+ ++  GY      NG E L   R H+PD++++D+ +  + G
Sbjct: 1   MKTILIVEDNPGVRDMVREYLQEHGYRVRVASNGHEGLLEVRHHRPDLVLLDMMMPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE  ++ +        PV+ +TA   + D+    + G + Y++KP S++  +  ++ ++ 
Sbjct: 61  LEFLRRFRAAE---HAPVVFLTARDAELDKVLGLELGADDYVTKPFSMAELLARVRAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|146297008|ref|YP_001180779.1| two component transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410584|gb|ABP67588.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 223

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  +   NG + + + +   PD++I+DI L +  G E
Sbjct: 2   KILVIDDDVKICEVIKLYLEKEGFEVIIAHNGSDGITMFKHEMPDLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCREIRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|224367365|ref|YP_002601528.1| two-component DNA-binding response regulator [Desulfobacterium
           autotrophicum HRM2]
 gi|223690081|gb|ACN13364.1| two-component DNA-binding response regulator [Desulfobacterium
           autotrophicum HRM2]
          Length = 233

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 67/119 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D    ++L R  ++  GY  L   +G EAL +A++  PD++++D+ L  I G E
Sbjct: 5   KILIVDDERDIVELVRFNLKREGYHTLVAFSGEEALSMAKREMPDLVVLDLMLPGIDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +T++I+ ++   EIP++ +TA   + D     + G   YISKP S    +  I+  +  
Sbjct: 65  VTRRIRGNAVTVEIPIVMLTAKGEESDIVTGLEIGANDYISKPFSPRELVARIRGILRR 123


>gi|158320425|ref|YP_001512932.1| two component transcriptional regulator [Alkaliphilus oremlandii
           OhILAs]
 gi|158140624|gb|ABW18936.1| two component transcriptional regulator, winged helix family
           [Alkaliphilus oremlandii OhILAs]
          Length = 237

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++V+D E  ++L R  +E  GY  L   NG E + + + +K D++++D+ L  + G+
Sbjct: 7   KTILVVDDEEHILELIRFNLEKEGYDVLLCENGDECIPMIQNNKVDLVVLDLMLPGMDGI 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +I K++    E + +P+I +TA + + D     + G + YI+KP S+   +  I+  +  
Sbjct: 67  QICKKLNRMDEYENLPIIMLTAKSEETDRVLGLELGADDYITKPFSVRELIARIRAVLRR 126

Query: 123 A 123
           +
Sbjct: 127 S 127


>gi|22297889|ref|NP_681136.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294067|dbj|BAC07898.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 121

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 69/120 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VED+    ++  +L+  +G+      +G+EA+E  +Q  PDV+++DI +  ++G
Sbjct: 1   MTKVLVVEDSPPQREMISELLAKTGFEVTVATDGVEAMEQLQQSTPDVVVLDIVMPRMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ +QIK D   Q IPV+  ++   + D     K G +AYI+KP      + TIK+ + 
Sbjct: 61  YEVCRQIKSDPRTQSIPVVMCSSKGEEFDRYWGMKQGADAYITKPFDPKELVGTIKQLLR 120


>gi|227514133|ref|ZP_03944182.1| DNA-binding response regulator [Lactobacillus fermentum ATCC 14931]
 gi|227087504|gb|EEI22816.1| DNA-binding response regulator [Lactobacillus fermentum ATCC 14931]
          Length = 245

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +    + +  +E  GY  +   +G EAL+      PD+I++D+ L +I 
Sbjct: 11  MDKKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESESPDLIVLDLMLPKID 70

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ KQ++     +  P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 71  GLEVAKQVRAK---RSTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 127

Query: 121 GE 122
             
Sbjct: 128 RR 129


>gi|163854786|ref|YP_001629084.1| response regulator [Bordetella petrii DSM 12804]
 gi|163258514|emb|CAP40813.1| response regulator [Bordetella petrii]
          Length = 232

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAHTLIRAELPDLILLDWMLPGTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + +++++D   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLTLARKLRDDERTRAVPVIMLTAKGAEQDKVEGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302390009|ref|YP_003825830.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200637|gb|ADL08207.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
          Length = 227

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D E  + L +  +E  G+   +  +G +AL++  + + ++II+D+ L  I G  
Sbjct: 5   RILVVDDEEKIVDLVKLYLEKEGFKVDEAHDGQQALDMIAKGEYNLIILDLMLPVIDGWT 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K++++ S   +IP+I +TA   + D+    + G + Y+ KP S    +  +K  +  
Sbjct: 65  VCKEVRKKS---DIPIIMLTARGEEFDKVLGFELGADDYVVKPFSPRELVARVKALLRR 120


>gi|261340989|ref|ZP_05968847.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cancerogenus ATCC 35316]
 gi|288316853|gb|EFC55791.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cancerogenus ATCC 35316]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPIEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K IK ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|321312445|ref|YP_004204732.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|320018719|gb|ADV93705.1| two-component response regulator [Bacillus subtilis BSn5]
          Length = 240

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|119961724|ref|YP_947342.1| two-component system response regulator [Arthrobacter aurescens
           TC1]
 gi|119948583|gb|ABM07494.1| two-component system response regulator [Arthrobacter aurescens
           TC1]
          Length = 274

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++VED +    + RD +  +G+      +G  ALELA   +PD++I+D  L  + G+
Sbjct: 32  RRILLVEDEQTIADVVRDYLLKAGFQVDMAGDGFTALELAASRQPDLVILDRMLPGLDGV 91

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++      +PVI VTA   + D     + G + Y++KP S    +  +K  +  
Sbjct: 92  EVCRRLRQ---TMSVPVIMVTALGTEDDRILGLEMGADDYVTKPFSPRELVLRVKSVLRR 148

Query: 123 A 123
           +
Sbjct: 149 S 149


>gi|311070584|ref|YP_003975507.1| YycF protein [Bacillus atrophaeus 1942]
 gi|310871101|gb|ADP34576.1| YycF [Bacillus atrophaeus 1942]
          Length = 236

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 66/123 (53%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L   
Sbjct: 1   MMDKKILVVDDEKPIADILEFNLRKEGYEVHCAYDGNEAVEMVEEIQPDLILLDIMLPNK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|312880968|ref|ZP_07740768.1| two component transcriptional regulator, winged helix family
           [Aminomonas paucivorans DSM 12260]
 gi|310784259|gb|EFQ24657.1| two component transcriptional regulator, winged helix family
           [Aminomonas paucivorans DSM 12260]
          Length = 235

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 66/121 (54%), Gaps = 1/121 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED      L  + +   GY      +G +ALE+A    PD++I+D+ L ++ G E
Sbjct: 5   RILVVEDERSIADLVAEALRRQGYRVETAGDGDQALEVAETTLPDLVILDLMLPKLDGWE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG-E 122
           + ++++E+   + IP+I +TA   + D     + G + Y+ KP SL+  +  +K ++   
Sbjct: 65  VCRRLREEETTRRIPIIMLTARRDEKDVVAGLELGADDYLRKPFSLAELLARVKAHLRAR 124

Query: 123 A 123
           A
Sbjct: 125 A 125


>gi|300818279|ref|ZP_07098490.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 107-1]
 gi|300529170|gb|EFK50232.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 107-1]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|222151385|ref|YP_002560541.1| response regulator protein [Macrococcus caseolyticus JCSC5402]
 gi|222120510|dbj|BAH17845.1| response regulator protein [Macrococcus caseolyticus JCSC5402]
          Length = 235

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K++IV+D +   KL +  +E  GY  ++  +G  ALELA       I++DI L  + 
Sbjct: 1   MKEKILIVDDEDRIRKLAKMYLEREGYETVEAEDGERALELALSENFHCILLDIMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K+++E+   +  PVI +TA   + +     + G + YI KP S    +  +K  +
Sbjct: 61  GIQVCKRLREE---KSTPVIMLTAKGEEHNRVEGFEIGADDYIVKPFSPREVVLRVKAIL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|261419126|ref|YP_003252808.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|319765943|ref|YP_004131444.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
 gi|261375583|gb|ACX78326.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|317110809|gb|ADU93301.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
          Length = 224

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++V+D+    +L    +   G+   +  NG EAL++    K D++IMDI + E+ G
Sbjct: 1   MARILVVDDDAHIRELVSHFLSLEGFTIHEAANGKEALDVLETVKVDLVIMDIMMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++++   +  ++P++ +TA      + +  + G + Y+ KP      +  +K  + 
Sbjct: 61  WELCRELR---DYDDVPILMLTAKGETKQKVKGFELGADDYLVKPFDPLELVARVKALLK 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|92116259|ref|YP_575988.1| two component transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91799153|gb|ABE61528.1| two component transcriptional regulator, winged helix family
           [Nitrobacter hamburgensis X14]
          Length = 233

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  ++  GY       G EA    ++  PD++++D  L  +S
Sbjct: 1   MSARILVVEDEEALTTLLRYNLDAEGYEVETVARGDEADTWLKERTPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + Y+ KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETRQLPIIMLTARGEESERVRGLATGADDYVVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|229543409|ref|ZP_04432469.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
 gi|229327829|gb|EEN93504.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
          Length = 224

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D E  + L    +E +GY   +   G EA+   ++   D+I++DI + E  G
Sbjct: 1   MKKLLLVDDEERMLDLLALYLEPAGYACDKVTRGPEAIRYIQEETYDLILLDIMMPETDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ +QI++ S+   +PVI +TA   K D  +  K G + YISKP      +  I   + 
Sbjct: 61  WEVCRQIRKMSQ---VPVIMLTARTDKPDVVKGLKIGADDYISKPFDEKELLARIDAVLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|226939099|ref|YP_002794170.1| PhoB [Laribacter hongkongensis HLHK9]
 gi|226714023|gb|ACO73161.1| PhoB [Laribacter hongkongensis HLHK9]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  SG+  L+  +   A  L +   PD++++D  L   S
Sbjct: 1   MPATILLVEDEPAIQELIAFNLAQSGHQVLRAASAEAAQTLVKNALPDLVLLDWMLPGQS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  ++++ D   +E+P+I +TA + + D+    + G + YI+KP S       IK  +
Sbjct: 61  GIEFARRLRSDERTREVPIIMLTARSDEQDKIAGLETGADDYITKPFSPRELQARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|283784214|ref|YP_003364079.1| phosphate regulon two-component system, response regulator
           [Citrobacter rodentium ICC168]
 gi|212380327|gb|ACJ24903.1| PhoB [Citrobacter rodentium]
 gi|282947668|emb|CBG87223.1| phosphate regulon two-component system, response regulator
           [Citrobacter rodentium ICC168]
          Length = 229

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAAIREMVCFVLEQNGFQPVEAEDYDTAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|254411201|ref|ZP_05024978.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181702|gb|EDX76689.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 249

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MHRILLIDDDPAISELVSINLEMAGYEVHQAPDGIKGQALALQLQPDLIMLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IPV+ +TA     D+      G + Y++KP  L   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTTDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFELEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|295402148|ref|ZP_06812107.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112732|ref|YP_003991048.1| transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294975831|gb|EFG51450.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217833|gb|ADP76437.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY  +   +G EAL+   +  PD+I++DI L +  
Sbjct: 1   MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEEVMPDLILLDIMLPQKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GMEVCREVRKK---YDMPIIILTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVRANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|221310230|ref|ZP_03592077.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221314553|ref|ZP_03596358.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221319475|ref|ZP_03600769.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221323751|ref|ZP_03605045.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|255767498|ref|NP_390193.2| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|251757323|sp|P35163|RESD_BACSU RecName: Full=Transcriptional regulatory protein resD
 gi|225185126|emb|CAB14244.2| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 240

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y   +  NG EA+    +   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKGLEANYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI+E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 68  VCRQIREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 124


>gi|54307731|ref|YP_128751.1| sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum SS9]
 gi|46912154|emb|CAG18949.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum SS9]
          Length = 1131

 Score =  172 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 65/115 (56%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D  +N+++  + +   GY  L   +G +AL++  Q +P +I++DI + E+SG E+ 
Sbjct: 726 LVVDDEPVNLQVLNNFLRLEGYRVLTADSGPQALKIIEQQQPALILLDIMMPEMSGYEVC 785

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++E+  L E+P+I ++A     D  +  + G   Y++KP +    +  I  ++
Sbjct: 786 HILREEYSLIELPIIMLSALGQVQDRIKGFESGANDYLTKPFNKEELIARISAHL 840


>gi|163790938|ref|ZP_02185361.1| DNA-binding response regulator [Carnobacterium sp. AT7]
 gi|159873780|gb|EDP67861.1| DNA-binding response regulator [Carnobacterium sp. AT7]
          Length = 235

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EALE   +  PD+II+D+ L +  G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVFTAYDGEEALEKVEEVLPDLIILDLMLPKKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++++++    ++P+I VTA   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVCREVRKN---HDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELAARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|143328|gb|AAA22661.1| phoP protein (put.); putative [Bacillus subtilis]
          Length = 241

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|187778177|ref|ZP_02994650.1| hypothetical protein CLOSPO_01769 [Clostridium sporogenes ATCC
           15579]
 gi|187775105|gb|EDU38907.1| hypothetical protein CLOSPO_01769 [Clostridium sporogenes ATCC
           15579]
          Length = 239

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 69/125 (55%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K  K+++V+D E  + + +  +E  GY  +   +G EA++L ++    ++I+D+ L +
Sbjct: 7   MKKLFKILVVDDEERILDVVKAYLEKEGYEVITAMDGEEAIKLFKEISFHLVILDLMLPK 66

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +SG E+  +I+E S    +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 67  LSGEEVCSKIRESS---NVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVKA 123

Query: 119 YIGEA 123
            I  A
Sbjct: 124 LIRRA 128


>gi|410141|gb|AAA67497.1| ORFX17 [Bacillus subtilis subsp. subtilis str. 168]
          Length = 240

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y   +  NG EA+    +   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKGLEANYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI+E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 68  VCRQIREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 124


>gi|328952021|ref|YP_004369355.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfobacca acetoxidans DSM 11109]
 gi|328452345|gb|AEB08174.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfobacca acetoxidans DSM 11109]
          Length = 382

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 68/130 (52%), Gaps = 7/130 (5%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++I +DN  N++L R  +   GY      +G EAL+   +  PD++I+DI + ++ 
Sbjct: 27  MKKKILIADDNPDNVELLRKRLSAQGYQIAAAFDGEEALQAVLKENPDLLILDIMMPKLD 86

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +++K+  E + +PVI +TA     D+ +    G + YI+KP +    +  ++  +
Sbjct: 87  GYEVLRRLKKQDEYRNLPVILLTAKKEIPDKLKGLDIGADDYITKPFNPQELLARVRSLM 146

Query: 121 -------GEA 123
                    A
Sbjct: 147 ALREEQERRA 156


>gi|157694431|ref|YP_001488893.1| response regulator [Bacillus pumilus SAFR-032]
 gi|194016445|ref|ZP_03055059.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
 gi|157683189|gb|ABV64333.1| response regulator [Bacillus pumilus SAFR-032]
 gi|194011918|gb|EDW21486.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
          Length = 235

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    +   GY      +G EALE+  + KPD+I++DI L    
Sbjct: 1   MEKKILVVDDEKPIADILEFNLRKEGYEVHCAYDGNEALEMVEEIKPDIILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|126731218|ref|ZP_01747025.1| phosphate regulon transcriptional regulatory protein PhoB
           [Sagittula stellata E-37]
 gi|126708129|gb|EBA07188.1| phosphate regulon transcriptional regulatory protein PhoB
           [Sagittula stellata E-37]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++    +E  G+      NG EAL +  +  PD++++D  L  +SG+E
Sbjct: 7   TVLLVEDEPAQREVLSYNLEAEGFRVASAGNGEEALLMMAEENPDIVVLDWMLPNVSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QIK   E + +P+I ++A + + D  R  + G + Y+ KP S+   M  ++  +  A
Sbjct: 67  VCRQIKTKPETRNVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRAQLRRA 126


>gi|171780121|ref|ZP_02921025.1| hypothetical protein STRINF_01909 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281469|gb|EDT46904.1| hypothetical protein STRINF_01909 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 236

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+    +  PD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAITKFEEENPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K++++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|253579947|ref|ZP_04857215.1| two component transcriptional regulator [Ruminococcus sp.
           5_1_39B_FAA]
 gi|251848946|gb|EES76908.1| two component transcriptional regulator [Ruminococcus sp.
           5_1_39BFAA]
          Length = 230

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +L +K  R  +E  G       +G EA+E A+  K D+I++D+ L ++ 
Sbjct: 1   MSRKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEAVEKAKDKKYDIILLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E      +P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GLEVCQQIRE---FSNVPIVMLTAKGEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|237730369|ref|ZP_04560850.1| transcriptional regulator PhoB [Citrobacter sp. 30_2]
 gi|226905908|gb|EEH91826.1| transcriptional regulator PhoB [Citrobacter sp. 30_2]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|283834288|ref|ZP_06354029.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citrobacter youngae ATCC 29220]
 gi|291069814|gb|EFE07923.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citrobacter youngae ATCC 29220]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IP++ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPIMMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|221310852|ref|ZP_03592699.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221315178|ref|ZP_03596983.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221320095|ref|ZP_03601389.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221324377|ref|ZP_03605671.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|255767672|ref|NP_390789.2| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|251757501|sp|P13792|PHOP_BACSU RecName: Full=Alkaline phosphatase synthesis transcriptional
           regulatory protein phoP
 gi|40056|emb|CAA47908.1| phoP [Bacillus subtilis]
 gi|225185300|emb|CAB14871.2| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291485344|dbj|BAI86419.1| two-component response regulator [Bacillus subtilis subsp. natto
           BEST195]
          Length = 240

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|320160915|ref|YP_004174139.1| putative OmpR family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
 gi|319994768|dbj|BAJ63539.1| putative OmpR family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
          Length = 244

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + +++V+D E  ++  R  +E  G+  +    G EALE  R   PD++++D+ L ++ G 
Sbjct: 8   RSILVVDDEERMVRFIRLNLEHDGFQVISAYRGYEALEKVRTEMPDLVLLDVMLPDLDGF 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K I+E S     PVI +TA   + D  R  + G + YI+KP S    +  +K  +  
Sbjct: 68  EVLKLIRESS---NTPVIMLTAKGEEDDRVRGLELGADDYITKPFSPRELVSRVKAVLRR 124


>gi|300721765|ref|YP_003711043.1| response regulator in two-component regulatory system with PhoR
           [Xenorhabdus nematophila ATCC 19061]
 gi|297628260|emb|CBJ88819.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+K++++VED     ++   ++E +GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MVKRILVVEDEVPIREMVCFVLEQNGYQAIEAEDYDTAIRRLSEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +K D   + IPVI VTA A + D  R    G + YI+KP S    +  +K  +
Sbjct: 61  GIQLIKHMKRDHNTKTIPVIMVTARAEEEDRVRGLDVGADDYITKPFSPKELIARVKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|261368149|ref|ZP_05981032.1| DNA-binding response regulator RegX3 [Subdoligranulum variabile DSM
           15176]
 gi|282569913|gb|EFB75448.1| DNA-binding response regulator RegX3 [Subdoligranulum variabile DSM
           15176]
          Length = 228

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D++   +L R  +   GY      +G  AL    +  PD++++D+ +  + G E
Sbjct: 5   KILVVDDDKNICELLRLYLVKEGYNVTMVHDGNAALTEFDKLHPDLVLLDVMMPVMDGWE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I+        P+I +TA     D+    + G + YI KP         IK  +  +
Sbjct: 65  VCRKIRAKD---NTPIIMLTAKGETYDKVLGLELGADDYIVKPFDAKEVTARIKAVLRRS 121


>gi|296332101|ref|ZP_06874565.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675504|ref|YP_003867176.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150872|gb|EFG91757.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413748|gb|ADM38867.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 240

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|218441116|ref|YP_002379445.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
 gi|218173844|gb|ACK72577.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
          Length = 247

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  RQ  PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRQTSPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|206973171|ref|ZP_03234093.1| two component transcriptional regulator, winged helix family
           [Bacillus cereus AH1134]
 gi|206732055|gb|EDZ49255.1| two component transcriptional regulator, winged helix family
           [Bacillus cereus AH1134]
          Length = 342

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D++    L    +E  G    +  + MEAL+L  + + D+II+DI +  + 
Sbjct: 115 MESKILIVDDDKEIRNLISAYLENEGLKTQKAEDAMEALQLLEEKEFDLIILDIMMPNMD 174

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E   +I+ED   + IP+I ++A +   D+ +    G + Y+SKP +    +  +K  +
Sbjct: 175 GIEACMKIRED---RNIPIIMLSAKSEDIDKIQGLASGADDYLSKPFNPLELIARVKSQL 231

Query: 121 GE 122
             
Sbjct: 232 RR 233


>gi|2293270|gb|AAC00348.1| signal transduction regulator [Bacillus subtilis]
          Length = 240

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 1   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|322411348|gb|EFY02256.1| Two-component response regulator [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 236

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +    KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTVFEDEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|302874727|ref|YP_003843360.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulovorans 743B]
 gi|307690659|ref|ZP_07633105.1| two component transcriptional regulator, winged helix family
           protein [Clostridium cellulovorans 743B]
 gi|302577584|gb|ADL51596.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulovorans 743B]
          Length = 234

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K++IV+D E  ++L +  +E   Y  L   +G+EA ++A++ KP +I++D+ L  I
Sbjct: 1   MAKEKILIVDDEEHIVELIKYNLEAEEYKVLTAHDGIEAGKIAKKEKPSLILLDLMLPGI 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SG+E+ K+I+ D E+ EIP+I +TA + + D+    + G + YI+KP S+   +  +K  
Sbjct: 61  SGMEVCKKIRRDDEISEIPIIMLTAKSDELDKILGLELGADDYITKPFSIRELLARVKAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|39996204|ref|NP_952155.1| DNA-binding response regulator [Geobacter sulfurreducens PCA]
 gi|39982969|gb|AAR34428.1| DNA-binding response regulator [Geobacter sulfurreducens PCA]
 gi|298505216|gb|ADI83939.1| winged-helix phosphate transcriptional response regulator
           [Geobacter sulfurreducens KN400]
          Length = 225

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 62/122 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++I+ED      L    +E  GY  L   +G   LELAR   PD+I++D+ L  + G
Sbjct: 1   MKTILIIEDERDLADLVAFNLEKEGYRTLTALDGANGLELARSQPPDLILLDLMLPGMMG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ K +K+  +   IPVI +TA   + D     + G + Y+ KP S    +  +K  + 
Sbjct: 61  MEVCKILKKSEKTAHIPVIMLTARGEEIDRVVGFEVGADDYVVKPFSTRELLLRVKAVLR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|288554258|ref|YP_003426193.1| winged helix family two component transcriptional regulator
           [Bacillus pseudofirmus OF4]
 gi|288545418|gb|ADC49301.1| two component transcriptional regulator, winged helix family
           [Bacillus pseudofirmus OF4]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 65/123 (52%), Gaps = 5/123 (4%)

Query: 2   LK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           +K  +++IVED     +L +  +   GY+  +   G+EALE   +    V+++D+ + E+
Sbjct: 1   MKEIRILIVEDEAPMRELLQLYLRKEGYVVDEAITGIEALEKVEKTLYSVVLLDVMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+ ++I++   + ++PVI +TA     D+ +  K G + Y++KP      +  ++  
Sbjct: 61  DGFEVCREIRK---VSQVPVIMLTARTQTLDKVKGLKIGADDYLTKPFEQEELLARVEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|194445785|ref|YP_002039637.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194404448|gb|ACF64670.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 229

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|253995872|ref|YP_003047936.1| two component transcriptional regulator PhoB [Methylotenera mobilis
           JLW8]
 gi|253982551|gb|ACT47409.1| two component transcriptional regulator PhoB, winged helix family
           [Methylotenera mobilis JLW8]
          Length = 235

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++ED     +L    I  +G+ A++  +G  AL+L R+  PD+I++D  L  ++
Sbjct: 1   MPANILVIEDEPAIQELLALNITQAGHNAIRALSGEIALDLMRETVPDLILLDWMLPGMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +++K D+  + IP+I +TA   + D+ R  + G + Y++KP S       IK  +
Sbjct: 61  GLELARKLKSDTYTKNIPIIMLTARGEEYDKVRGLEVGADDYVTKPFSPRELNARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|323126805|gb|ADX24102.1| Two-component response regulator [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 236

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+ +  + KPD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYGIVTAFDGREAVTIFEEEKPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++      +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEIRK---TSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|167464300|ref|ZP_02329389.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 227

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 67/120 (55%), Gaps = 3/120 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++VED  +  ++ +D +   GY  L+  NG EAL L  +++  ++I+DI + E+ 
Sbjct: 1   MQKTILVVEDEHILREIIKDYLLNEGYQVLEAINGKEALTLFEENEVHLVILDIMMPELD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++I++      IPVI +TA A + D     + G + Y++KP S  I +   K+ +
Sbjct: 61  GWSVCRRIRK---TSNIPVIMLTARADEDDTLLGFELGADDYVTKPFSPPILLARAKRLL 117


>gi|298243980|ref|ZP_06967787.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297557034|gb|EFH90898.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 252

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 62/120 (51%), Gaps = 1/120 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQ-EISGL 62
           +V++V+D E  ++  R  +   G+      +G   +  A +  PD+II+D+ +   I GL
Sbjct: 18  RVLVVDDEENIIEFIRLGLRYEGFQVESANDGETGIATALRINPDIIILDVMMPPGIDGL 77

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++E+   +EIP++ +TA     D     + G + Y++KP      +E I+  +  
Sbjct: 78  EVCRRLRENPTTREIPILMLTARDEVRDRIAGLRTGADDYLTKPFDFDELLERIRAILRR 137


>gi|298246255|ref|ZP_06970061.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297553736|gb|EFH87601.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 247

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+K ++++ED     +L R  +E +GY  +   +G+  +EL  + KPD++I+D+ L  + 
Sbjct: 1   MMK-ILVIEDEANIAQLLRLYLEQAGYAVVTANDGIAGIELHAREKPDLVILDLMLPMLD 59

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I+        P++ +TA   + D       G + Y+ KP S    +  +K  +
Sbjct: 60  GMEVCRRIR---TWANTPILMLTARQGEEDRIAGLDSGADDYLVKPFSPREVISRVKAIL 116

Query: 121 GEA 123
             A
Sbjct: 117 RRA 119


>gi|258512880|ref|YP_003186314.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257479606|gb|ACV59925.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 230

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED E    + R  +E  GY      +G EALE  R  +PD+I++D+ L E+ 
Sbjct: 1   MPAHILVVEDEEPIANILRFALEREGYRVSCAYDGAEALERWRALQPDLILLDVMLPEVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ + I++ S    +PVI +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GFDVLRAIRQASG---VPVIILTAKDDEVDKVLGLELGADDYVTKPFSTRELVARVKANL 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|148273519|ref|YP_001223080.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147831449|emb|CAN02409.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 283

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 62/120 (51%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++VED+    ++    ++ SG+      +G+EA+ +A +  PD++++D  L  + GL
Sbjct: 31  RRILVVEDDPTVNEVVCRYLKASGFQVETVADGLEAVRVATERMPDLVVLDRMLPGLDGL 90

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+       +PV+ +TA     D       G + Y++KP S    +  ++  +  
Sbjct: 91  EVCRRIRAHHPESPVPVVMLTALGQGEDRVNGLDAGADDYLAKPFSPRELVLRVRAVLRR 150


>gi|90961025|ref|YP_534941.1| two-component response regulator [Lactobacillus salivarius UCC118]
 gi|227891713|ref|ZP_04009518.1| response regulator [Lactobacillus salivarius ATCC 11741]
 gi|301299933|ref|ZP_07206164.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|90820219|gb|ABD98858.1| Two-component response regulator [Lactobacillus salivarius UCC118]
 gi|227866516|gb|EEJ73937.1| response regulator [Lactobacillus salivarius ATCC 11741]
 gi|300213968|gb|ADJ78384.1| Two-component response regulator [Lactobacillus salivarius CECT
           5713]
 gi|300852478|gb|EFK80131.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 236

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EAL+  ++ +PD+I++D+ L +I G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVKEVEPDLILLDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|328956405|ref|YP_004373791.1| two-component response regulator [Carnobacterium sp. 17-4]
 gi|328672729|gb|AEB28775.1| two-component response regulator [Carnobacterium sp. 17-4]
          Length = 235

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EALE   +  PD+II+D+ L +  G
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVFTAYDGEEALEKVEEVLPDLIILDLMLPKKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++++++    ++P+I VTA   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVCREVRKN---HDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELTARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|15901089|ref|NP_345693.1| DNA-binding response regulator [Streptococcus pneumoniae TIGR4]
 gi|111657843|ref|ZP_01408558.1| hypothetical protein SpneT_02000966 [Streptococcus pneumoniae
           TIGR4]
 gi|116515650|ref|YP_816556.1| DNA-binding response regulator [Streptococcus pneumoniae D39]
 gi|148985122|ref|ZP_01818361.1| DNA-binding response regulator [Streptococcus pneumoniae SP3-BS71]
 gi|148989249|ref|ZP_01820629.1| DNA-binding response regulator [Streptococcus pneumoniae SP6-BS73]
 gi|148993837|ref|ZP_01823239.1| DNA-binding response regulator [Streptococcus pneumoniae SP9-BS68]
 gi|148998657|ref|ZP_01826096.1| DNA-binding response regulator [Streptococcus pneumoniae SP11-BS70]
 gi|149002595|ref|ZP_01827527.1| DNA-binding response regulator [Streptococcus pneumoniae SP14-BS69]
 gi|149007115|ref|ZP_01830784.1| DNA-binding response regulator [Streptococcus pneumoniae SP18-BS74]
 gi|149012278|ref|ZP_01833347.1| DNA-binding response regulator [Streptococcus pneumoniae SP19-BS75]
 gi|149019219|ref|ZP_01834581.1| DNA-binding response regulator [Streptococcus pneumoniae SP23-BS72]
 gi|168484877|ref|ZP_02709822.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1873-00]
 gi|168486549|ref|ZP_02711057.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1087-00]
 gi|168489055|ref|ZP_02713254.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP195]
 gi|168491148|ref|ZP_02715291.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC0288-04]
 gi|168493149|ref|ZP_02717292.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC3059-06]
 gi|168577194|ref|ZP_02723003.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae MLV-016]
 gi|169832995|ref|YP_001694658.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pneumoniae Hungary19A-6]
 gi|194397986|ref|YP_002037828.1| response regulator [Streptococcus pneumoniae G54]
 gi|221231922|ref|YP_002511074.1| response regulator protein [Streptococcus pneumoniae ATCC 700669]
 gi|225854693|ref|YP_002736205.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae JJA]
 gi|225856894|ref|YP_002738405.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae P1031]
 gi|225859008|ref|YP_002740518.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 70585]
 gi|225860939|ref|YP_002742448.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649929|ref|ZP_04524181.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CCRI 1974]
 gi|237822522|ref|ZP_04598367.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CCRI 1974M2]
 gi|298230882|ref|ZP_06964563.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254363|ref|ZP_06977949.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502777|ref|YP_003724717.1| DNA-binding response regulator [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303254277|ref|ZP_07340386.1| response regulator protein [Streptococcus pneumoniae BS455]
 gi|303258862|ref|ZP_07344841.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP-BS293]
 gi|303261546|ref|ZP_07347493.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP14-BS292]
 gi|303264216|ref|ZP_07350136.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS397]
 gi|303266153|ref|ZP_07352046.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS457]
 gi|303268120|ref|ZP_07353920.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS458]
 gi|307067876|ref|YP_003876842.1| CheY-like receiver/winged-helix DNA-binding domain-containing
           response regulator [Streptococcus pneumoniae AP200]
 gi|307127185|ref|YP_003879216.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 670-6B]
 gi|14193094|gb|AAK55817.1|AF219111_1 putative response regulator [Streptococcus pneumoniae]
 gi|5830523|emb|CAB54568.1| response regulator [Streptococcus pneumoniae]
 gi|14972708|gb|AAK75333.1| DNA-binding response regulator [Streptococcus pneumoniae TIGR4]
 gi|116076226|gb|ABJ53946.1| DNA-binding response regulator [Streptococcus pneumoniae D39]
 gi|147755494|gb|EDK62542.1| DNA-binding response regulator [Streptococcus pneumoniae SP11-BS70]
 gi|147759206|gb|EDK66199.1| DNA-binding response regulator [Streptococcus pneumoniae SP14-BS69]
 gi|147761419|gb|EDK68385.1| DNA-binding response regulator [Streptococcus pneumoniae SP18-BS74]
 gi|147763604|gb|EDK70539.1| DNA-binding response regulator [Streptococcus pneumoniae SP19-BS75]
 gi|147922567|gb|EDK73685.1| DNA-binding response regulator [Streptococcus pneumoniae SP3-BS71]
 gi|147925227|gb|EDK76306.1| DNA-binding response regulator [Streptococcus pneumoniae SP6-BS73]
 gi|147927662|gb|EDK78687.1| DNA-binding response regulator [Streptococcus pneumoniae SP9-BS68]
 gi|147931089|gb|EDK82068.1| DNA-binding response regulator [Streptococcus pneumoniae SP23-BS72]
 gi|168995497|gb|ACA36109.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Hungary19A-6]
 gi|172041974|gb|EDT50020.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1873-00]
 gi|183570421|gb|EDT90949.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1087-00]
 gi|183572520|gb|EDT93048.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP195]
 gi|183574479|gb|EDT95007.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC0288-04]
 gi|183576730|gb|EDT97258.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC3059-06]
 gi|183577211|gb|EDT97739.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae MLV-016]
 gi|194357653|gb|ACF56101.1| response regulator TCS02 [Streptococcus pneumoniae G54]
 gi|220674382|emb|CAR68932.1| response regulator protein [Streptococcus pneumoniae ATCC 700669]
 gi|225721755|gb|ACO17609.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 70585]
 gi|225722501|gb|ACO18354.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae JJA]
 gi|225724998|gb|ACO20850.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae P1031]
 gi|225727250|gb|ACO23101.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238372|gb|ADI69503.1| DNA-binding response regulator [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301794310|emb|CBW36735.1| response regulator protein [Streptococcus pneumoniae INV104]
 gi|301800148|emb|CBW32753.1| response regulator protein [Streptococcus pneumoniae OXC141]
 gi|301801917|emb|CBW34641.1| response regulator protein [Streptococcus pneumoniae INV200]
 gi|302598771|gb|EFL65808.1| response regulator protein [Streptococcus pneumoniae BS455]
 gi|302637126|gb|EFL67614.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP14-BS292]
 gi|302639805|gb|EFL70261.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP-BS293]
 gi|302642337|gb|EFL72684.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS458]
 gi|302644323|gb|EFL74577.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS457]
 gi|302646028|gb|EFL76255.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS397]
 gi|306409413|gb|ADM84840.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Streptococcus
           pneumoniae AP200]
 gi|306484247|gb|ADM91116.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 670-6B]
 gi|332073565|gb|EGI84044.1| response regulator [Streptococcus pneumoniae GA17570]
 gi|332074837|gb|EGI85309.1| response regulator [Streptococcus pneumoniae GA41301]
 gi|332200675|gb|EGJ14747.1| response regulator [Streptococcus pneumoniae GA41317]
 gi|332201690|gb|EGJ15760.1| response regulator [Streptococcus pneumoniae GA47368]
 gi|332203075|gb|EGJ17143.1| response regulator [Streptococcus pneumoniae GA47901]
          Length = 234

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|89072496|ref|ZP_01159068.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium sp. SKA34]
 gi|89051600|gb|EAR57053.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium sp. SKA34]
          Length = 1132

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 68/116 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D  +N+++  + +  +GY      +G +A+++ +Q +PD+I++DI + E+SG E+
Sbjct: 721 ILVVDDEPVNLQILNNFLRLAGYRVKTAESGHQAIDIVQQQRPDLILLDIMMPEMSGYEV 780

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
              +++   + E+P++ ++A     D  +  + G   Y++KP +    +  I+ Y+
Sbjct: 781 CTLLRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYL 836


>gi|315186290|gb|EFU20051.1| two component transcriptional regulator, winged helix family
           [Spirochaeta thermophila DSM 6578]
          Length = 226

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D    ++L R  +E  GY  + T  G +ALE AR   PD II+D+ L  +SGLE
Sbjct: 2   TILVVDDEPDIVELVRFHLEREGYEVVSTGEGRDALEKARNLLPDAIILDLMLPGMSGLE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + +++      IP++ +TA + + D     + G + YI+KP S  I +  +K  +  
Sbjct: 62  VCRLLRQQDRTSHIPILMLTAKSEETDVVVGLELGADDYITKPFSPRILLARLKAVLKR 120


>gi|302554749|ref|ZP_07307091.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
 gi|302472367|gb|EFL35460.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
          Length = 249

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D+    ++    ++ +GY+  +  +G  AL  A  H PD++++D+ L  + GLE
Sbjct: 16  RILVVDDDPTVAEVVAGYLDRAGYLVDRADDGPTALTRAAAHWPDLVVLDLMLPGMDGLE 75

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  +
Sbjct: 76  VCRRMRGHGP---VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRS 132


>gi|297584465|ref|YP_003700245.1| winged helix family two component transcriptional regulator
           [Bacillus selenitireducens MLS10]
 gi|297142922|gb|ADH99679.1| two component transcriptional regulator, winged helix family
           [Bacillus selenitireducens MLS10]
          Length = 237

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++V+D E   +L +  +E   Y      NG  AL+ A  +  D+I++D+ +  + G+
Sbjct: 5   ARILVVDDEERIRRLLKMYLERENYDVDDAENGEIALKKALDYDYDLIVLDLMMPGMDGI 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I++    +  P++ +TA   + +  +  + G + YI KP S    +  +K  +  
Sbjct: 65  EVCEKIRKQ---KATPIVMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRR 121

Query: 123 A 123
           A
Sbjct: 122 A 122


>gi|254490292|ref|ZP_05103481.1| phosphate regulon transcriptional regulatory protein PhoB
           [Methylophaga thiooxidans DMS010]
 gi|224464425|gb|EEF80685.1| phosphate regulon transcriptional regulatory protein PhoB
           [Methylophaga thiooxydans DMS010]
          Length = 230

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 60/122 (49%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VED+     +    ++ +G+      +G   L+  ++ +PD+I++D  L  I 
Sbjct: 1   MATSVLVVEDDVAIRDMLSFTLKQAGFGCDSVGDGEAGLDFLKKQQPDMILLDWMLPGID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  ++++ +  L  IPVI +TA     D  +    G + Y++KP S    M  I+  +
Sbjct: 61  GIEFIRRLRANEFLANIPVIMLTAKGESEDMVKGLAVGADDYVNKPFSPPELMARIRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|71282474|ref|YP_267951.1| phosphate regulon response regulator PhoB [Colwellia
           psychrerythraea 34H]
 gi|71148214|gb|AAZ28687.1| phosphate regulon response regulator PhoB [Colwellia
           psychrerythraea 34H]
          Length = 233

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 69/122 (56%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++VED     ++   +++ +G+ A++  +  +AL    +  PD+I++D  L   +
Sbjct: 1   MSRKILVVEDETPIREMISFVLDQNGFNAIEACDIEQALAKIHEPYPDLILLDWMLPGGT 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K++K++   + IP+I +TA + + D+ +  + G + +++KP S    +  IK  I
Sbjct: 61  GVSLAKKLKQNEYTRNIPIIMLTARSDEDDKVKGFEAGVDDFVTKPFSPKELIARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|167945734|ref|ZP_02532808.1| sensor histidine kinase with ATPase domain, two fused [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 415

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 78/119 (65%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++VEDN +N ++  +L+++ G + L   +G  AL   ++   D+++MD+Q+  + G E
Sbjct: 253 KVLLVEDNPINQQVALELLQSFGLLVLVAEDGRAALRRLQESAFDLVLMDVQMPLMDGYE 312

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            T+QI++  ELQ++PVIA+TA AM GD E+    G   Y+SKPI  +  + T++ ++GE
Sbjct: 313 TTRQIRQQPELQQLPVIAMTAHAMSGDREKCLDAGMSDYLSKPIDPAKLLATLRHWLGE 371



 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE---------LARQHKPDVIIMDI 54
           +V++V+DN +   +  D++ +  +      N  EA E         LA+     +++MD 
Sbjct: 102 RVLLVDDNPMVRTVLADMLRSFSFEVEVGANAAEAYELLMGAGAVGLAKPKPFQLVLMDW 161

Query: 55  QLQEISGLEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFM 113
            +  ++G++  + IK++  L + P +I VTAF  +   ++ +  G +A + KP + S+  
Sbjct: 162 HMPPVNGIDAVQHIKQELALVQQPKMILVTAFGREELMQQSQAAGLDAVLLKPANPSLLF 221

Query: 114 ETIKKYIGEA 123
           +TI     E+
Sbjct: 222 DTIMSVFKES 231


>gi|209527854|ref|ZP_03276344.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
 gi|209491711|gb|EDZ92076.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
          Length = 243

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EALE+ RQ +PD++++D+ + ++ G  
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEIFRQTEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|209883802|ref|YP_002287659.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oligotropha carboxidovorans OM5]
 gi|209871998|gb|ACI91794.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oligotropha carboxidovorans OM5]
          Length = 234

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  ++  GY       G EA    ++  PD++++D  L  +S
Sbjct: 1   MSARILVVEDEEALATLLRYNLDAEGYDVETVARGDEADTRLKERVPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|16081093|ref|NP_391921.1| two-component response regulator YycG [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|586808|sp|P37478|YYCF_BACSU RecName: Full=Transcriptional regulatory protein yycF
 gi|467327|dbj|BAA05173.1| unknown [Bacillus subtilis]
 gi|1064814|dbj|BAA11300.1| yycF [Bacillus subtilis]
 gi|2636588|emb|CAB16078.1| two-component response regulator [YycG] [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 235

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L    
Sbjct: 1   MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|271961733|ref|YP_003335929.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270504908|gb|ACZ83186.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 231

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 64/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D+    ++    +E  G++     +G EAL  A    PD++++D+ L ++ 
Sbjct: 1   MSARILVVDDDPTVAEVVARYLERDGHVVECVGDGAEALRRALSDPPDLLVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ ++++E      +PVI +TA   + D     + G + Y++KP S       ++  +
Sbjct: 61  GLQVCRKLRERWP---VPVIMLTALGEEIDRVVGLETGADDYVTKPFSPRELALRVQSVL 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|212638357|ref|YP_002314877.1| OmpR family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212559837|gb|ACJ32892.1| DNA-binding response regulator, OmpR family (REC-wHTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 261

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 68/122 (55%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+V++V+D +  + L    ++ +G+I L   +G E L  A + +PD II+D+ L ++ 
Sbjct: 24  MSKRVLVVDDEQSIVTLLEYNLKQAGFIVLTAYDGEEGLHKALEERPDFIILDLMLPKLD 83

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 84  GIEVCKQLRQQKVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 141

Query: 121 GE 122
             
Sbjct: 142 RR 143


>gi|221312018|ref|ZP_03593865.1| hypothetical protein Bsubs1_21806 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221316343|ref|ZP_03598148.1| hypothetical protein BsubsN3_21712 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221321256|ref|ZP_03602550.1| hypothetical protein BsubsJ_21665 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325539|ref|ZP_03606833.1| hypothetical protein BsubsS_21821 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296329976|ref|ZP_06872460.1| two-component response regulator (YycG) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676701|ref|YP_003868373.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|321313602|ref|YP_004205889.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|291486678|dbj|BAI87753.1| hypothetical protein BSNT_06200 [Bacillus subtilis subsp. natto
           BEST195]
 gi|296153015|gb|EFG93880.1| two-component response regulator (YycG) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414945|gb|ADM40064.1| two-component response regulator (paired with YycG) [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|320019876|gb|ADV94862.1| two-component response regulator [Bacillus subtilis BSn5]
          Length = 236

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 66/123 (53%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L   
Sbjct: 1   MMDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|302036228|ref|YP_003796550.1| putative phosphate regulon transcriptional regulatory protein PhoB
           [Candidatus Nitrospira defluvii]
 gi|300604292|emb|CBK40624.1| putative Phosphate regulon transcriptional regulatory protein phoB
           [Candidatus Nitrospira defluvii]
          Length = 238

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 66/120 (55%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++IVED +  ++L +  +E  G+  +    G E L   +   PD+II+D+ L E+ GL
Sbjct: 9   KKILIVEDEKDILQLVKLYLEKEGFRTVSAMTGTEGLRQVKAEHPDLIILDLMLPELDGL 68

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+ + E   +P++ +TA A + D     + G + Y++KP S    +  +K  +  
Sbjct: 69  EVCKRIRLNQETALLPILMLTAKAEESDTVIGLELGADDYVTKPFSPKALVARVKALLRR 128


>gi|296101518|ref|YP_003611664.1| transcriptional regulator PhoB [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055977|gb|ADF60715.1| transcriptional regulator PhoB [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 229

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|192361393|ref|YP_001980674.1| phosphate regulon transcriptional regulatory protein PhoB
           [Cellvibrio japonicus Ueda107]
 gi|190687558|gb|ACE85236.1| phosphate regulon transcriptional regulatory protein PhoB
           [Cellvibrio japonicus Ueda107]
          Length = 232

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 64/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D      + R  +E + Y  ++  N  +A  L    KPD+I++D  +   SG+
Sbjct: 4   RKILIVDDESAIRDMLRVALEMADYQCIEAGNAQDAHSLIIDEKPDLILLDWMMPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D     +P+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDEVTANLPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|168178458|ref|ZP_02613122.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
 gi|182670774|gb|EDT82748.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
          Length = 233

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K  K+++V+D E  + + +  +E   Y  +   +G EA++L ++    +II+D+ L +
Sbjct: 1   MKKLFKILVVDDEERILDVVKAYLEKEDYEVITAMDGEEAIKLFKETSFHLIILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +SG E+  +I+E S    +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 61  LSGEEVCSKIRESS---NVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|295837513|ref|ZP_06824446.1| DNA-binding response regulator [Streptomyces sp. SPB74]
 gi|295826557|gb|EFG64921.1| DNA-binding response regulator [Streptomyces sp. SPB74]
          Length = 244

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+D     +  R  +   GY      +G EAL  A    PD++++DIQ+  + GL
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALRQAAATPPDLVVLDIQMPGMDGL 72

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 73  TAARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130

Query: 123 A 123
           +
Sbjct: 131 S 131


>gi|229916170|ref|YP_002884816.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
 gi|229467599|gb|ACQ69371.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
          Length = 238

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 67/120 (55%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D E   +L +  +E   Y+  +  NG EAL LA +++ DVI++D+ + ++ G+E
Sbjct: 6   KILVVDDEERIRRLLKMYLEREQYVIEEAVNGEEALALALENEYDVILLDLMMPKMDGVE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++    +  PVI +TA   + D  +  + G + YI KP S    +  +K  +  +
Sbjct: 66  VCTELRK---TKATPVIMLTAKGEEIDRVQGFEVGADDYIVKPFSPREVVLRVKALLRRS 122


>gi|322383919|ref|ZP_08057649.1| two-component response regulator YclK-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321151396|gb|EFX44583.1| two-component response regulator YclK-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 244

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 67/120 (55%), Gaps = 3/120 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++VED  +  ++ +D +   GY  L+  NG EAL L  +++  ++I+DI + E+ 
Sbjct: 18  MQKTILVVEDEHILREIIKDYLLNEGYQVLEAINGKEALTLFEENEVHLVILDIMMPELD 77

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++I++      IPVI +TA A + D     + G + Y++KP S  I +   K+ +
Sbjct: 78  GWSVCRRIRK---TSNIPVIMLTARADEDDTLLGFELGADDYVTKPFSPPILLARAKRLL 134


>gi|307547006|ref|YP_003899485.1| phosphate regulon transcriptional regulator PhoB [Halomonas
           elongata DSM 2581]
 gi|307219030|emb|CBV44300.1| phosphate regulon transcriptional regulatory protein PhoB
           [Halomonas elongata DSM 2581]
          Length = 229

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 64/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V+IV+D     ++    +E + Y  L+  N   A  +   H+PD++++D  +   SG+
Sbjct: 4   KTVLIVDDEAPIREMIAVALEMADYHVLEADNAQAAHAMIVDHQPDLVLLDWMMPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K +    E+P+I +TA + + ++ +    G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKREETTAEMPIIMLTAKSEEDNKIQGLDAGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|317056207|ref|YP_004104674.1| winged helix family two component transcriptional regulator
           [Ruminococcus albus 7]
 gi|315448476|gb|ADU22040.1| two component transcriptional regulator, winged helix family
           [Ruminococcus albus 7]
          Length = 224

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D    + L     E  GY  +   +G +A+++ R+   D+I+MDI + +  G
Sbjct: 1   MSRILIVDDEPDIITLISRYAEREGYEVVTAEDGSQAIDICRKEDFDLIVMDIMMPDTDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
               K+IKE    ++IPVI ++A   + D+    + G + Y++KP S    M  IK  I 
Sbjct: 61  FTACKKIKE---FKDIPVIMLSARGTEFDKLFGFEVGVDDYVTKPFSPRELMARIKAVIN 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|324325416|gb|ADY20676.1| response regulator [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 223

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+    +  D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|296535704|ref|ZP_06897875.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseomonas cervicalis ATCC 49957]
 gi|296263965|gb|EFH10419.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseomonas cervicalis ATCC 49957]
          Length = 238

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 65/124 (52%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M +  +++VED    + L R  +E  G+   +  +G EAL    +  PD++++D  L  +
Sbjct: 8   MARPTILVVEDEAPLLTLLRYNLEKQGFRVDEAADGQEALMRVAEAPPDLVLLDWMLPAL 67

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SGLE+ +Q++   + +++P+I VTA     D  R    G + YI+KP  +   M  I+  
Sbjct: 68  SGLEVCRQLRRRPDTRDLPIIMVTARTEDQDAVRALDTGADDYIAKPFVMDALMARIRAL 127

Query: 120 IGEA 123
           +  +
Sbjct: 128 LRRS 131


>gi|26246403|ref|NP_752442.1| transcriptional regulator PhoB [Escherichia coli CFT073]
 gi|26106801|gb|AAN78986.1|AE016756_169 Phosphate regulon transcriptional Regulatory protein phoB
           [Escherichia coli CFT073]
          Length = 229

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEVPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|284031362|ref|YP_003381293.1| winged helix family two component transcriptional regulator
           [Kribbella flavida DSM 17836]
 gi|283810655|gb|ADB32494.1| two component transcriptional regulator, winged helix family
           [Kribbella flavida DSM 17836]
          Length = 244

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D    ++L    +  +GY      +G EAL  AR+ +PD++++D+ +  + 
Sbjct: 12  MSPHLLVVDDEPNIVELLSASLRFAGYDVTTAAHGTEALRKAREVEPDLVVLDVMMPGLD 71

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++++   E + +PV+ +TA     D+    + G + Y++KP SL   +  ++  +
Sbjct: 72  GFEVVRRLR--GEDRHVPVLFLTARDAVEDKVLGLQTGGDDYVTKPFSLDELVARVRALL 129

Query: 121 GEA 123
             +
Sbjct: 130 RRS 132


>gi|220927161|ref|YP_002502463.1| two component transcriptional regulator PhoB, winged helix family
           [Methylobacterium nodulans ORS 2060]
 gi|219951768|gb|ACL62160.1| two component transcriptional regulator PhoB, winged helix family
           [Methylobacterium nodulans ORS 2060]
          Length = 234

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED E    L R  +E  G+       G EA    R+  PD++++D  +  +S
Sbjct: 1   MSTRILIVEDEEPLTLLLRYNLEAEGFEVDAVARGDEADIRLREQIPDLVLLDWMVPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I+   E + +P+I +TA   +GD  R    G + YI KP S+   +  ++  +
Sbjct: 61  GIELCRRIRARRETERLPIIMLTARGEEGDRVRGLATGADDYIVKPFSVPELLARVRALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|37527767|ref|NP_931112.1| phosphate regulon transcriptional regulatory protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36787203|emb|CAE16283.1| phosphate regulon transcriptional regulatory protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 229

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  ++  +   AL    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEKNGYQPVEAEDYDSALACLSEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+I KQ+K ++ +++IPV+ +TA   + D  R  + G + YI+KP S    +  +K  +
Sbjct: 61  GLQIIKQMKRNNNIRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARVKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|260427208|ref|ZP_05781187.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citreicella sp. SE45]
 gi|260421700|gb|EEX14951.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citreicella sp. SE45]
          Length = 229

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 65/120 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++ R  +E  G+      NG EAL +  +  PDVI++D  L  +SG+E
Sbjct: 7   TVLVVEDEAAQREVLRYNLEAEGFRVAAAGNGEEALMMMDEESPDVIVLDWMLPNLSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QIK   E + +PVI ++A + + D  R  + G + Y+ KP SL   M  ++  +  A
Sbjct: 67  VCRQIKTRPETRGVPVIMLSARSEEVDRIRGLETGADDYVVKPYSLRELMARVRAQLRRA 126


>gi|226310980|ref|YP_002770874.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093928|dbj|BAH42370.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 231

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++V+D    +KL +  +E SG+  +   +G +ALE+ +  +PD II+D+ L ++ G
Sbjct: 1   MIKVLVVDDEASIVKLLQFNLEKSGFQVVTAFDGKQALEVVKSEQPDFIILDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +++ K +++  E    P++ +TA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  MDVCKTLRQ--ERNNTPILMLTAKDDELDKILGLELGADDYLTKPFSPREVIARVKAILR 118

Query: 122 E 122
            
Sbjct: 119 R 119


>gi|22299966|ref|NP_683213.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22296151|dbj|BAC09975.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 242

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 67/123 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++I++D+     +    ++ +GY   ++ +GM+   LA Q  PD+I++D+ L ++ 
Sbjct: 1   MKPRILIIDDDPAIADVLAINLQMAGYEVTKSLDGMQGQALAVQLSPDLILLDLMLPQVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  I ++++ D   Q+IP++ +TA +   ++      G + Y++KP  L   +  ++  +
Sbjct: 61  GFTICQRLRRDPRTQDIPILMLTALSQTHNKVEGFNAGADDYLTKPFELEEMLARVRALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|269103478|ref|ZP_06156175.1| chitin catabolic cascade sensor histidine kinase ChiS
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163376|gb|EEZ41872.1| chitin catabolic cascade sensor histidine kinase ChiS
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 1130

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 65/115 (56%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D  +N+++  + +   GY  L   +G +ALEL + HKP +I++DI + E+SG E+ 
Sbjct: 724 LVVDDEPVNLQILNNFLRLEGYRVLTAESGKQALELVQSHKPALILLDIMMPEMSGYEVC 783

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            Q+++     E+P++ ++A     D  +  + G   Y++KP +       IK ++
Sbjct: 784 SQLRQQYTPLELPIMMLSALGQVKDRVKGFECGANDYLTKPFNKEELTARIKAHL 838


>gi|206967625|ref|ZP_03228581.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|206736545|gb|EDZ53692.1| DNA-binding response regulator [Bacillus cereus AH1134]
          Length = 223

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+    +  D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|17227625|ref|NP_484173.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|75907720|ref|YP_322016.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|17135107|dbj|BAB77653.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|75701445|gb|ABA21121.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 247

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQLQPDLIMLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    EIPV+ +TA +   D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTAEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|197335063|ref|YP_002156819.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           fischeri MJ11]
 gi|197316553|gb|ACH66000.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           fischeri MJ11]
          Length = 230

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY  ++  +   AL L  +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDSALSLLCEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  I
Sbjct: 61  GINLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|313902101|ref|ZP_07835512.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467619|gb|EFR63122.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 294

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D+     L +  +   G+      +G EAL +AR+  PD++I+DI +  + GLE
Sbjct: 73  RILVVDDDPAVTSLLKRGLAYEGFAVDTASSGEEALRIAREQPPDLVILDIMMPGMDGLE 132

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++      E+PV+ +TA     D+ +  + G + Y+ KP +  + +  ++  +  
Sbjct: 133 VLQRLRAAD--PELPVLFLTARDAPADQVQGLEAGADDYVVKPFTFEVLVARVRALLRR 189


>gi|59712595|ref|YP_205371.1| DNA-binding response regulator in two-component regulatory system
           with PhoR [Vibrio fischeri ES114]
 gi|59480696|gb|AAW86483.1| DNA-binding response regulator in two-component regulatory system
           with PhoR [Vibrio fischeri ES114]
          Length = 230

 Score =  171 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY  ++  +   AL L  +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDSALSLLCEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  I
Sbjct: 61  GINLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|225573005|ref|ZP_03781760.1| hypothetical protein RUMHYD_01196 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039656|gb|EEG49902.1| hypothetical protein RUMHYD_01196 [Blautia hydrogenotrophica DSM
           10507]
          Length = 229

 Score =  171 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E          +G EALELA+ +K D+I++D+ L ++ 
Sbjct: 1   MSKKVLVVDDEKLIVKGIRFSLEQDDMDVDCAYDGEEALELAKANKYDIILLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E     ++P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GLEVCQQIRE---FSDVPIVMLTAKGEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|46579496|ref|YP_010304.1| phosphate regulon transcriptional regulator PhoB [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602954|ref|YP_967354.1| two component transcriptional regulator [Desulfovibrio vulgaris
           DP4]
 gi|46448910|gb|AAS95563.1| phosphate regulon transcriptional regulator PhoB [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120563183|gb|ABM28927.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris DP4]
 gi|311233311|gb|ADP86165.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris RCH1]
          Length = 229

 Score =  171 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K ++++VED+E  ++L R  +E +G+  +    G + LE A++H P ++++D+ L  +
Sbjct: 1   MAKERILVVEDDEDILQLLRFTLEAAGFEVVTAATGRDGLESAQRHVPGLVLLDLMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SG ++ +++K     + +PVI +TA   + D     + G + Y+ KP S    +  I+  
Sbjct: 61  SGFDVCRELKRTPATEHVPVIMLTARGEEVDRIVGLELGADDYVIKPFSPRELVLRIRAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LKR 123


>gi|172059033|ref|YP_001815493.1| two component transcriptional regulator [Exiguobacterium sibiricum
           255-15]
 gi|171991554|gb|ACB62476.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sibiricum 255-15]
          Length = 236

 Score =  171 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K+++V+D +    + +  +E  GY      +G+EALE   +  PD+I++DI L  + G+
Sbjct: 4   RKILVVDDEQPIADILKFKLEKEGYSVAVANDGVEALEKVEEFNPDLILLDIMLPLMDGM 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ +++++     ++P+I +TA   + D     + G   Y++KP S    +  +K ++ 
Sbjct: 64  EVCREVRK---TSKVPIIMLTAKDSEIDTVLGLELGANDYVTKPFSSRELLARVKAHLR 119


>gi|318059644|ref|ZP_07978367.1| two-component system response regulator [Streptomyces sp. SA3_actG]
 gi|318078239|ref|ZP_07985571.1| two-component system response regulator [Streptomyces sp. SA3_actF]
          Length = 244

 Score =  171 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+D     +  R  +   GY      +G EAL  A    PD++++DIQ+  + GL
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALRKAAATPPDLVVLDIQMPGMDGL 72

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++       +PV+ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 73  TAARRLRATGST--VPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130

Query: 123 A 123
           +
Sbjct: 131 S 131


>gi|297203135|ref|ZP_06920532.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
 gi|297148314|gb|EFH28936.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
          Length = 240

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 66/120 (55%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D+    ++    ++ +GY+  +  +G EAL  A  H+PD++++D+ L  + GLE
Sbjct: 12  RVLVVDDDPTVAEVVSGYLDRAGYLVDRAADGPEALARAAAHRPDLVVLDLMLPGMDGLE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  +
Sbjct: 72  VCRRMRGRGP---VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRS 128


>gi|170744715|ref|YP_001773370.1| two component transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198989|gb|ACA20936.1| two component transcriptional regulator, winged helix family
           [Methylobacterium sp. 4-46]
          Length = 234

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IVED E    L R  +E  G+       G EA    R+  PD++++D  +  +S
Sbjct: 1   MSTRILIVEDEEPLTLLLRYNLEAEGFTVDAVARGDEADIRLREQVPDLVLLDWMVPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I+   E + +PVI +TA   +GD  R    G + YI KP S+   +  ++  +
Sbjct: 61  GIELCRRIRARRETERLPVIMLTARGEEGDRVRGLATGADDYIVKPFSVPELLARVRALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|157146995|ref|YP_001454314.1| transcriptional regulator PhoB [Citrobacter koseri ATCC BAA-895]
 gi|157084200|gb|ABV13878.1| hypothetical protein CKO_02772 [Citrobacter koseri ATCC BAA-895]
          Length = 229

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + Y++KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYVTKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|311280718|ref|YP_003942949.1| two component transcriptional regulator PhoB, winged helix family
           [Enterobacter cloacae SCF1]
 gi|308749913|gb|ADO49665.1| two component transcriptional regulator PhoB, winged helix family
           [Enterobacter cloacae SCF1]
          Length = 229

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVTQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|89096800|ref|ZP_01169692.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911]
 gi|89088815|gb|EAR67924.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911]
          Length = 236

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY      +G EALE   + KPD+I++DI L +  
Sbjct: 1   MDKKILVVDDEKPIADILQFNLKKEGYEVHCAYDGNEALEKVEEVKPDLILLDIMLPQRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++  E   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|197103973|ref|YP_002129350.1| phosphate regulon response regulator PhoB [Phenylobacterium
           zucineum HLK1]
 gi|196477393|gb|ACG76921.1| phosphate regulon response regulator PhoB [Phenylobacterium
           zucineum HLK1]
          Length = 230

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IVED +    L +  +E  GY      +G EAL   ++  PD+I++D  L ++SG+E
Sbjct: 5   RILIVEDEDSLATLLQYNLEKEGYEVAAAGDGEEALLQVQERLPDLIVLDWMLPKVSGIE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++  E + +P+I +TA   + D  R    G + Y+ KP ++S     I+  +  
Sbjct: 65  VCRRLRQRPESRNVPIIMLTARGEETDRIRGLDTGADDYVVKPFAMSELAARIRAVLRR 123


>gi|126651382|ref|ZP_01723589.1| PhoP [Bacillus sp. B14905]
 gi|126591911|gb|EAZ85994.1| PhoP [Bacillus sp. B14905]
          Length = 238

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++++ED      L +  +E +GY+     +G E LE A + +P++I++D+ L ++ 
Sbjct: 1   MTKTILVIEDEFSIATLLKYNLEQAGYLVETAADGQEGLEKAIEIQPNLILLDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQI++  +    P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCKQIRQ--QRMNTPIIMLTAKDDEFDKVLGLELGADDYMTKPFSPREVLARVKAVL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|86607748|ref|YP_476510.1| DNA-binding response regulator RpaA [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556290|gb|ABD01247.1| DNA-binding response regulator RpaA [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 250

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 67/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I+ED+   + + R  +E +GY  ++  +G+    LA Q  PD+II+D+ L ++ G
Sbjct: 1   MARILIIEDDPSILDILRINLELAGYEVVKATDGVRGQALALQVLPDLIILDLMLPQVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + ++++ +    EIP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  LTVCQRLRREERTSEIPILMLTALGQTQDKIEGFNAGADDYLTKPFEVQELLVRVRALLR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|75674709|ref|YP_317130.1| phosphate regulon transcriptional regulatory protein phoB
           [Nitrobacter winogradskyi Nb-255]
 gi|74419579|gb|ABA03778.1| two component transcriptional regulator, winged helix family
           [Nitrobacter winogradskyi Nb-255]
          Length = 234

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +E  GY       G EA    ++  PD++++D  L  +S
Sbjct: 1   MGARILVVEDEEALTTLLRYNLEAEGYEVETVVRGDEADTRLKERVPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++  S+ +++P+I +TA   + +  R    G + Y+ KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARSDTRQLPIIMLTARGEESERVRGLATGADDYVVKPFSVPELLARVKSLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|225378285|ref|ZP_03755506.1| hypothetical protein ROSEINA2194_03946 [Roseburia inulinivorans DSM
           16841]
 gi|225209852|gb|EEG92206.1| hypothetical protein ROSEINA2194_03946 [Roseburia inulinivorans DSM
           16841]
          Length = 230

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E  G       +G EAL++A ++  D+I++DI L ++ 
Sbjct: 1   MAKKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEALKMATENHYDMILLDIMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ + I+E     ++P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFEVCQHIRE---FSDMPIVMLTAKGDDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|288905747|ref|YP_003430969.1| essential two-component response regulator [Streptococcus
           gallolyticus UCN34]
 gi|306831845|ref|ZP_07465001.1| response regulator [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325978780|ref|YP_004288496.1| two-component response regulator [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288732473|emb|CBI14045.1| conserved essential two-component response regulator [Streptococcus
           gallolyticus UCN34]
 gi|304426043|gb|EFM29159.1| response regulator [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325178708|emb|CBZ48752.1| two-component response regulator [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 236

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+    +  PD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAITKFEEEDPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K++++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|238765163|ref|ZP_04626095.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           kristensenii ATCC 33638]
 gi|238696597|gb|EEP89382.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           kristensenii ATCC 33638]
          Length = 279

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 51  MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPYPDLVLLDWMLPGGS 110

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 111 GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 170

Query: 121 GE 122
             
Sbjct: 171 RR 172


>gi|326797358|ref|YP_004315178.1| PhoB family transcriptional regulator [Marinomonas mediterranea
           MMB-1]
 gi|326548122|gb|ADZ93342.1| two component transcriptional regulator PhoB, winged helix family
           [Marinomonas mediterranea MMB-1]
          Length = 231

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 70/121 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+I++D     ++    +E +GY  L+  N     E+   H+PD+I++D  +   SG+
Sbjct: 4   KKVLIIDDEAPIREMIAVALEMAGYEYLEAENAQHGHEIIVDHRPDLILVDWMMPGGSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+T+++K+DS   EIPVI +TA + + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELTRRLKKDSTTAEIPVIMLTAKSEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|325982918|ref|YP_004295320.1| two component transcriptional regulator PhoB, winged helix family
           [Nitrosomonas sp. AL212]
 gi|325532437|gb|ADZ27158.1| two component transcriptional regulator PhoB, winged helix family
           [Nitrosomonas sp. AL212]
          Length = 240

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IVED     +L    ++ +GY ++   +  +A+ +     PD+I++D  L  ++
Sbjct: 1   MSAKILIVEDEAAIRELIAYNLQQAGYESICAEDAEKAMTIIHDALPDLILLDWMLPNMT 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  + ++ +   + IP+I +TA   + D+    + G + Y++KP S    +  I   +
Sbjct: 61  GIDFARLLRRNERTRIIPIIMLTARTQEADKVAGLEIGADDYVTKPFSPRELIARINAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|331700440|ref|YP_004397399.1| winged helix family two component transcriptional regulator
           [Lactobacillus buchneri NRRL B-30929]
 gi|329127783|gb|AEB72336.1| two component transcriptional regulator, winged helix family
           [Lactobacillus buchneri NRRL B-30929]
          Length = 238

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + + +  +   GY      +G EAL+  +   PD+II+D+ L ++ 
Sbjct: 1   MAKKILVVDDEKPIVDIEKFNLTKEGYEVSVAYDGEEALQQVKDVDPDLIILDLMLPKVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +++++    ++ P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAREVRK---TKDTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|310659192|ref|YP_003936913.1| DNA-binding response regulator in two-component regulatory system
           with phor (or crec) [Clostridium sticklandii DSM 519]
 gi|308825970|emb|CBH22008.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Clostridium sticklandii]
          Length = 230

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 42/122 (34%), Positives = 71/122 (58%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV+IV+D E  ++L +  +E  GY      +G EAL+ A+  KP +I++D+ L  + 
Sbjct: 1   MNKKVLIVDDEENIVELLKFNMELKGYKVEYAYDGEEALKKAKDIKPGLILLDLMLPIMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++  +I+ED EL++ P+I +TA  M+ D+    + G + YI+KP S+   M  +K   
Sbjct: 61  GTKVCSKIREDEELKDTPIIMLTAKNMEKDKIYGLELGADDYITKPFSIKELMARVKAVT 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|146338745|ref|YP_001203793.1| two-component regulatory system response regulator [Bradyrhizobium
           sp. ORS278]
 gi|146191551|emb|CAL75556.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Bradyrhizobium sp. ORS278]
          Length = 235

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +E  GY       G EA    ++  PD++++D  L  +S
Sbjct: 1   MGARILVVEDEEALTTLLRYNLEAEGYEVETVARGDEADTRLKERIPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++  SE +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARSETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|320160319|ref|YP_004173543.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319994172|dbj|BAJ62943.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 407

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D+ L   +    + T G+  L+  NG++A+E A  H+PD+IIMD+ + E+ 
Sbjct: 1   MPEKILVVDDDALMRLMVTKTLSTEGFEFLEAENGVQAVEKAIAHQPDLIIMDVNMPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  ++I+ +     IP+I VT+ +   D+ +    G + YI KP         +   +
Sbjct: 61  GYEACQRIRSNPITSAIPIILVTSLSTVEDKIKGFDSGADDYIPKPFDPIELTMRVNVLL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|15644403|ref|NP_229455.1| response regulator DrrA [Thermotoga maritima MSB8]
 gi|4982229|gb|AAD36722.1|AE001807_13 response regulator DrrA [Thermotoga maritima MSB8]
          Length = 247

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+   ++L    +   GY  L+  +G EAL++A     D+ I+DI L  I G 
Sbjct: 12  KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGF 71

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+   + +  PVI ++A   + D+    + G + YI+KP S+   +  +K     
Sbjct: 72  ELVRKIRSMEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRR 131


>gi|301052937|ref|YP_003791148.1| response regulator [Bacillus anthracis CI]
 gi|300375106|gb|ADK04010.1| response regulator [Bacillus cereus biovar anthracis str. CI]
          Length = 223

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MSKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|270289944|ref|ZP_06196170.1| two-component system, OmpR family, response regulator VicR
           [Pediococcus acidilactici 7_4]
 gi|304385805|ref|ZP_07368149.1| response regulator [Pediococcus acidilactici DSM 20284]
 gi|270281481|gb|EFA27313.1| two-component system, OmpR family, response regulator VicR
           [Pediococcus acidilactici 7_4]
 gi|304328309|gb|EFL95531.1| response regulator [Pediococcus acidilactici DSM 20284]
          Length = 233

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +  ++  GY  +   +G EALE     +PD+I++D+ L +I G
Sbjct: 1   MPKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALEKVESEEPDLILLDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +Q++       IP+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVARQVRAK---HNIPIIMVTAKDSELDKVVGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|319892740|ref|YP_004149615.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus pseudintermedius HKU10-03]
 gi|317162436|gb|ADV05979.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus pseudintermedius HKU10-03]
 gi|323464228|gb|ADX76381.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus pseudintermedius ED99]
          Length = 234

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 71/123 (57%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++V++V+D +  + L +  +E SGY+    ++G EAL+  ++ KPD+I++D+ L +  
Sbjct: 1   MAQRVLVVDDEQSIVTLLKYNLEQSGYVVEVAQDGEEALQKEKETKPDLIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D    ++P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKN--QVPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|74310968|ref|YP_309387.1| transcriptional regulator PhoB [Shigella sonnei Ss046]
 gi|73854445|gb|AAZ87152.1| positive response regulator for pho regulon [Shigella sonnei Ss046]
          Length = 229

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDCAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302391634|ref|YP_003827454.1| two component transcriptional regulator, winged helix family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203711|gb|ADL12389.1| two component transcriptional regulator, winged helix family
           [Acetohalobium arabaticum DSM 5501]
          Length = 235

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 69/120 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D E  ++L +  +E  GY    T +G  AL+  ++   D++++D+ L EI GL
Sbjct: 4   KKILVVDDEENIVELVKFNLEKEGYQVFVTYDGQAALDKLQEEDIDLLVLDLMLPEIGGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           +I +QI+ D EL ++P+I +TA   + D     + G + Y++KP S    +  +K  +  
Sbjct: 64  DICRQIRNDDELSDLPIIMLTAKEKEVDRILGLELGADDYVTKPFSPRELVARVKAILRR 123


>gi|301061392|ref|ZP_07202164.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300444516|gb|EFK08509.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 229

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 70/123 (56%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K ++++V+D E  ++L    +   GY  + T  G  A+E++R  +PD+I++D+ L  +
Sbjct: 1   MAKERILVVDDEEDILELVNFNLAKEGYRVISTTTGERAVEMSRVERPDLIVLDLMLPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ K +K++ E Q IP++ +TA   + D     + G + Y++KP S  I +  I+  
Sbjct: 61  DGLEVAKFLKKNQETQNIPIVMLTAKGEESDVVTGLELGADDYVTKPFSPKILLARIRAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|152998395|ref|YP_001343230.1| two component transcriptional regulator [Marinomonas sp. MWYL1]
 gi|150839319|gb|ABR73295.1| two component transcriptional regulator, winged helix family
           [Marinomonas sp. MWYL1]
          Length = 236

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 72/121 (59%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV+I++D     ++    +E +GY  L+  N  +A E+   H+PD+I++D  +   SG+
Sbjct: 9   KKVLIIDDESSIREMIAIALEMAGYEYLEAENIQQAHEIIVDHRPDLILVDWMMPGGSGI 68

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+T+++K+D+   EIPVI +TA + + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 69  ELTRRLKKDTTTAEIPVIMLTAKSEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 128

Query: 123 A 123
           A
Sbjct: 129 A 129


>gi|220909111|ref|YP_002484422.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7425]
 gi|219865722|gb|ACL46061.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7425]
          Length = 263

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++++D+    +L    +E +GY   Q  +G++   LA Q  PD+I++D+ L  + 
Sbjct: 1   MKPRILVIDDDPAIAELVAINLEMAGYDVSQAADGVKGQALAVQLMPDLIMLDLMLPRVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++++ D     IP++ +TA +   D+      G + Y++KP  +   +  ++  +
Sbjct: 61  GFTVCQRLRRDERTSAIPILMLTALSQTQDKVEGFNAGADDYLTKPFEIEEMLARVRALL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|144900225|emb|CAM77089.1| phosphate regulon transcriptional regulatory protein phoB
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 233

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IVED      + R  +E  GY   +  +G EAL L  + KPD++++D  L  +S
Sbjct: 3   MKPLILIVEDEAALATMLRYNLEKEGYRVCEAGDGEEALTLVSERKPDLMVLDWMLPSLS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +Q++     +E+P+I +TA   +GD+ R    G + Y++KP SL   M  I+  +
Sbjct: 63  GIEVCRQLRRKPATRELPIIMLTARGEEGDKIRGLNTGADDYMTKPFSLPELMARIRAML 122

Query: 121 GE 122
             
Sbjct: 123 RR 124


>gi|49477181|ref|YP_035526.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49328737|gb|AAT59383.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 223

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MSKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|321311784|ref|YP_004204071.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|320018058|gb|ADV93044.1| two-component response regulator [Bacillus subtilis BSn5]
          Length = 240

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y   +  NG EA+    +   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLRMYLERENYAIDEADNGDEAITKGLEANYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI+E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 68  VCRQIREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 124


>gi|6862582|gb|AAD30120.2| DNA binding response regulator RpaA [Tolypothrix sp. PCC 7601]
          Length = 247

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQLQPDLIMLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    EIPV+ +TA +   D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTAEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|21388712|dbj|BAC00821.1| phosphate regulon transcriptional regulatory protein [Rhodobacter
           sphaeroides f. sp. denitrificans]
          Length = 230

 Score =  171 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 66/119 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E+ G+  +Q  NG EAL L  +  PDVI++D  L  +SG+E+
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEALMLVEEAGPDVIVLDWMLPSVSGIEV 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q+K     + +P+I ++A + + D  R  + G + Y+ KP S+   M  ++  +  A
Sbjct: 69  CRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127


>gi|323706155|ref|ZP_08117723.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534448|gb|EGB24231.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 231

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D +  +++ +  +E +GY  ++  +G E L++A++  PD+I++D+ L ++ G
Sbjct: 1   MSRILIVDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKMAQEKNPDLILLDVMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + +++       P++ +TA   + D+    + G + Y++KP S+   +  +K  + 
Sbjct: 61  FTVLRILRQ---TMTTPILMLTAKEEEVDKVLGLELGADDYVTKPFSMRELIARVKANLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|121535983|ref|ZP_01667776.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
 gi|121305443|gb|EAX46392.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
          Length = 231

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V+IV+D +   ++       SG+   +  +G EAL    Q KPD++I+DI +  + G 
Sbjct: 4   KTVLIVDDEKQIREILAIYFTQSGFTVAEAADGAEALIKVEQVKPDIVILDIMMPVLDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +QI++      +P+I +T+     D     + G + Y++KP +    +  +K  +  
Sbjct: 64  EVCQQIRK---YSPVPIIMLTSRTQDDDRIMGLEIGADDYVTKPFNPKEVVARVKAILRR 120


>gi|148543262|ref|YP_001270632.1| two component transcriptional regulator [Lactobacillus reuteri DSM
           20016]
 gi|184152673|ref|YP_001841014.1| two-component response regulator [Lactobacillus reuteri JCM 1112]
 gi|77745293|gb|ABB02547.1| response regulator [Lactobacillus reuteri]
 gi|148530296|gb|ABQ82295.1| two component transcriptional regulator, winged helix family
           [Lactobacillus reuteri DSM 20016]
 gi|183224017|dbj|BAG24534.1| two-component response regulator [Lactobacillus reuteri JCM 1112]
          Length = 235

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY  +   +G  ALE      PD+II+D+ L +I 
Sbjct: 1   MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAYDGEAALEQVEAENPDLIILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++       +P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAKRVRAK---HTMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|89893567|ref|YP_517054.1| hypothetical protein DSY0821 [Desulfitobacterium hafniense Y51]
 gi|89333015|dbj|BAE82610.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 227

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D+E   ++ R  +E  G+   +  NG  ALE  R    D+II+D+ +  + G  
Sbjct: 2   RILVVDDDERIREIVRLYLEAEGFETDEAENGNIALEKVRNGTFDLIILDLMIPGLDGWT 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K ++++++   IP+I +TA   + D       G + YI KP S       +K  +  
Sbjct: 62  VCKVLRKETQ---IPIIMLTAKGEENDRILGFDLGADDYIVKPFSPRELCARVKAVLRR 117


>gi|218291254|ref|ZP_03495238.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218238856|gb|EED06067.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 230

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED E    + R  +E  GY      +G EAL+  R  +PD+I++D+ L E+ 
Sbjct: 1   MPAHILVVEDEEPIANILRFALEREGYRVSCAYDGAEALQRWRALQPDLILLDVMLPEVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ + I++ S    +PVI +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GFDVLRAIRQASG---VPVIILTAKDDEVDKVLGLELGADDYVTKPFSTRELVARVKANL 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|260584310|ref|ZP_05852057.1| DNA-binding response regulator VicR [Granulicatella elegans ATCC
           700633]
 gi|260157828|gb|EEW92897.1| DNA-binding response regulator VicR [Granulicatella elegans ATCC
           700633]
          Length = 238

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   G+  +   +G E L +     PD++I+D+ L +I G
Sbjct: 1   MKKILVVDDEKPISDIVKFSLSKEGFEVVTAFDGEEGLAVFSAENPDLVILDLMLPKIEG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I++      +P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVCREIRK---TSNVPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|229824434|ref|ZP_04450503.1| hypothetical protein GCWU000282_01757 [Catonella morbi ATCC 51271]
 gi|229786035|gb|EEP22149.1| hypothetical protein GCWU000282_01757 [Catonella morbi ATCC 51271]
          Length = 237

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 69/121 (57%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    +    +E  GY   +  +G +AL++  + +PD++I+D+ L ++ G
Sbjct: 4   MKKILVVDDEKPISDIISFNLENEGYAIEKAYDGEQALKVFEKSQPDLVILDLMLPKMDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I++ S    +PVI +TA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 64  LEVCREIRKQSA---VPVIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|47566185|ref|ZP_00237213.1| two-component response regulator [Bacillus cereus G9241]
 gi|47556738|gb|EAL15069.1| two-component response regulator [Bacillus cereus G9241]
          Length = 223

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+    +  D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|281412572|ref|YP_003346651.1| two component transcriptional regulator, winged helix family
           [Thermotoga naphthophila RKU-10]
 gi|281373675|gb|ADA67237.1| two component transcriptional regulator, winged helix family
           [Thermotoga naphthophila RKU-10]
          Length = 239

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+   ++L    +   GY  L+  +G EAL++A     D+ I+DI L  I G 
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+   + +  PVI ++A   + D+    + G + YI+KP S+   +  +K     
Sbjct: 64  ELVRKIRAIEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAVFRR 123


>gi|332971396|gb|EGK10354.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 273

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++VED +    + +  +   G+      +G EAL+   +  PD+I++D+ L    
Sbjct: 39  MAAKILVVEDEKPIADILQFNLSKEGFEVECIHDGDEALKRIHEEPPDLILLDLMLPGTD 98

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+EI ++++E      +P+I VTA   + D+    + G + Y++KP S    +  IK  +
Sbjct: 99  GIEICRKVREKYR---MPIIMVTAKDSEVDKVLGLELGADDYVTKPFSNRELLARIKANL 155

Query: 121 GE 122
             
Sbjct: 156 RR 157


>gi|288556018|ref|YP_003427953.1| two-component response regulator [Bacillus pseudofirmus OF4]
 gi|288547178|gb|ADC51061.1| two-component response regulator [Bacillus pseudofirmus OF4]
          Length = 238

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+++V+D +   +L +  +E   Y   +  NG +AL LA +   D+I++DI +  + G+
Sbjct: 5   AKILVVDDEDRIRRLLKMYLERENYEVEEAENGEKALSLALEIDYDLILLDIMMPGMDGI 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++    +  PV+ +TA   + +  +  + G + YI KP S    +  +K  +  
Sbjct: 65  EVCQELRK---TKATPVMMLTAKGEEANRVQGFEVGTDDYIVKPFSPREVVLRVKALLRR 121

Query: 123 A 123
           +
Sbjct: 122 S 122


>gi|223043539|ref|ZP_03613584.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Staphylococcus capitis SK14]
 gi|314933846|ref|ZP_07841211.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus caprae C87]
 gi|222443027|gb|EEE49127.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Staphylococcus capitis SK14]
 gi|313653996|gb|EFS17753.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus caprae C87]
          Length = 236

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EAL+   + +P++I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALKKVEEEQPELIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKSIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|323140625|ref|ZP_08075549.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414889|gb|EFY05684.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
          Length = 234

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K++I +D     ++ R   E  G+  ++  +G  A+   +  KPD++++DI +  +
Sbjct: 3   MAKQKILIADDEAQIREILRIYFEKEGFEVIEAEDGAAAILKVQSEKPDILLLDIMMPVL 62

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E+ KQ+++ S   ++P+I VTA     D     + G + YI+KP +    +  +K  
Sbjct: 63  DGIEVCKQVRKMS---DLPIIMVTAKDDDDDRIAGLEIGADDYITKPFNSREVVARVKAV 119

Query: 120 IGEA 123
           +  A
Sbjct: 120 LRRA 123


>gi|302871747|ref|YP_003840383.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574606|gb|ADL42397.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 223

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  + T NGM+ + + +   PD++I+DI L +  G E
Sbjct: 2   KILVIDDDIKICEVIKLYLEKEGFEVVVTHNGMDGISVFKNEMPDLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|284048184|ref|YP_003398523.1| two component transcriptional regulator, winged helix family
           [Acidaminococcus fermentans DSM 20731]
 gi|283952405|gb|ADB47208.1| two component transcriptional regulator, winged helix family
           [Acidaminococcus fermentans DSM 20731]
          Length = 232

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 5/124 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K   V+I +D     ++     +  G+  ++  +G EAL   +  KPD+I++DI +  
Sbjct: 1   MNKQQTVLIADDEPQIREILSIYFKKEGFKVIEAADGAEALVQVQAGKPDIILLDIMMPV 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + GLE+ KQ+++   + +IP+I +TA     D     + G + YISKP +    +  +K 
Sbjct: 61  LDGLEVCKQVRK---ISDIPIIMLTAKDSDDDRILGLEIGADDYISKPFNTREVVARVKA 117

Query: 119 YIGE 122
            +  
Sbjct: 118 VLRR 121


>gi|205351709|ref|YP_002225510.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205271490|emb|CAR36308.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326626742|gb|EGE33085.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 229

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDCAVNKLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|300790130|ref|YP_003770421.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
 gi|299799644|gb|ADJ50019.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
          Length = 233

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D+E    + R  +E +G+      NG E L     H+PD++++D+ +  I+GLE
Sbjct: 7   RVLVVDDDETVRDVVRRYLEVAGFTVDVAGNGAEGLAKFGAHEPDLVVLDVMMPGINGLE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + K++++   + ++P++ +TA   + +     + G + Y++KP S       +   +  A
Sbjct: 67  VCKRLRQ---VSQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKELALRVASVLRRA 123


>gi|330813170|ref|YP_004357409.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486265|gb|AEA80670.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 228

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+ IVED      L +  +E   Y    + NG E L+  ++ +PD+I++D  L ++S
Sbjct: 1   MKAKIFIVEDEPSIATLVKYNLEKENYKVFISNNGEEGLKEIKKIEPDLILLDWMLPDLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+EI + +K+D + + IP+I +TA   + D+      G + Y+ KP S S  +  I   +
Sbjct: 61  GIEICRSLKKDKKFKFIPIIMLTAKGQEEDKVLGLNTGADDYLVKPFSHSELVARINALL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302382814|ref|YP_003818637.1| PhoB family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193442|gb|ADL01014.1| two component transcriptional regulator PhoB, winged helix family
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 229

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++++ED +    L +  +E  GY  +   +G E L    + +PD++++D  L ++S
Sbjct: 1   MQPYILVMEDEDALATLLQYNLEKEGYDVVVAADGEEGLVQIDERQPDLVLLDWMLPKVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E + +PVI +TA   + D  R    G + Y++KP S++  +  I+  +
Sbjct: 61  GIEVCRRLRGRPETRNLPVIMLTARGEESDRVRGLDTGADDYLTKPFSMTELIARIRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|291550846|emb|CBL27108.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus torques
           L2-14]
          Length = 229

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +L +K  R  +E  G       +G EALE AR+ + D++++D+ L ++ 
Sbjct: 1   MSKKILVVDDEKLIVKGIRFSLEQEGMEVDCAYDGEEALEYARRCEYDLVLLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ +QI+E     ++P++ +TA +   D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFQVCQQIRE---FSDMPIVMLTAKSEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|258515194|ref|YP_003191416.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778899|gb|ACV62793.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 236

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 67/121 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+D +  +++ R  +E +GY  +  ++G  ALELAR   PD+I++D+ +  + G
Sbjct: 1   MPNILVVDDEQNVLEIVRFNLERAGYKVITAKDGNIALELARSRNPDLIVLDLLMPGLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             I + ++ D   + IP+I ++A + + D+    + G + YI+KP S    +  +   + 
Sbjct: 61  YSICRLLQRDPATRRIPIIMLSARSDELDKVLGLEMGADDYITKPFSPRELVARVNARLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|220906550|ref|YP_002481861.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7425]
 gi|219863161|gb|ACL43500.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7425]
          Length = 243

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYNVVTAADGEEALETFREEVPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|154498537|ref|ZP_02036915.1| hypothetical protein BACCAP_02527 [Bacteroides capillosus ATCC
           29799]
 gi|150272605|gb|EDM99790.1| hypothetical protein BACCAP_02527 [Bacteroides capillosus ATCC
           29799]
          Length = 234

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED +  + +    +   GY  L+  +G   L+LA +  PD++++D+ L +++
Sbjct: 1   MNKRILIVEDEKNIVDILSFNLGREGYETLEAYDGQSGLQLALEQDPDLVLLDLMLPKMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ + I+   E +  PVI +TA   + D+    + G + YI+KP S+   +  +K  I
Sbjct: 61  GFDVCRSIRA--EGKNTPVIMLTAREEENDKVMGLELGADDYITKPFSMRELLARVKANI 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|148658022|ref|YP_001278227.1| response regulator receiver modulated diguanylate cyclase
           [Roseiflexus sp. RS-1]
 gi|148570132|gb|ABQ92277.1| response regulator receiver modulated diguanylate cyclase
           [Roseiflexus sp. RS-1]
          Length = 443

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 68/123 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++I +D     +L   ++ + GY  + T+NG + +  A++  PD++I+D+ + ++ 
Sbjct: 1   MTKRILIADDEPAVRQLLELVLRSQGYEVVATQNGDQLVRTAQEWIPDLVIIDLMMPQMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  +Q++ D+    +P++ +TA +   D       G + Y++KP ++   +  I+ ++
Sbjct: 61  GYEAIRQLRNDTRTAHVPMLILTARSTAEDVVTGFDTGADDYVTKPFNIPELLARIRAHL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|52144036|ref|YP_082792.1| response regulator [Bacillus cereus E33L]
 gi|118476873|ref|YP_894024.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|196035354|ref|ZP_03102759.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196040638|ref|ZP_03107937.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|196046479|ref|ZP_03113704.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|218902506|ref|YP_002450340.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225863261|ref|YP_002748639.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|254726203|ref|ZP_05187985.1| DNA-binding response regulator [Bacillus anthracis str. A1055]
 gi|51977505|gb|AAU19055.1| response regulator [Bacillus cereus E33L]
 gi|118416098|gb|ABK84517.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|195992031|gb|EDX55994.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196022663|gb|EDX61345.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|196028428|gb|EDX67036.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|218538516|gb|ACK90914.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225785753|gb|ACO25970.1| DNA-binding response regulator [Bacillus cereus 03BB102]
          Length = 223

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MSKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|168187034|ref|ZP_02621669.1| transcriptional regulatory protein ResD [Clostridium botulinum C
           str. Eklund]
 gi|169295053|gb|EDS77186.1| transcriptional regulatory protein ResD [Clostridium botulinum C
           str. Eklund]
          Length = 228

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ML K++IV+D+E   ++ +  +E+SGY      +G  A     ++KPD++++D+ L  + 
Sbjct: 4   MLGKILIVDDDENICEIIKMYLESSGYSTECCYDGKSAQGAFFEYKPDLVLLDVMLPHMD 63

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K I+++SE    PVI +TA     D+    + G + YI KP      +  IK  +
Sbjct: 64  GIDVLKWIRKESET---PVIMLTAKGETFDKVLALELGADDYIVKPFEPKELIARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|47231509|gb|AAT12781.1| PhoB [Alcaligenes faecalis]
          Length = 236

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSTSILVVEDEPAIQELISVNLSFAGHKVLRAFDAEQAQILIRAELPDLILVDWMLPGSS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + ++++ D   + IPVI +TA   + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GINLARKLRSDERTRHIPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELIARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|30261401|ref|NP_843778.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47526577|ref|YP_017926.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184231|ref|YP_027483.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|65318666|ref|ZP_00391625.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain [Bacillus
           anthracis str. A2012]
 gi|167634425|ref|ZP_02392746.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|167639277|ref|ZP_02397549.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|170686885|ref|ZP_02878105.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|170706300|ref|ZP_02896761.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|177651390|ref|ZP_02934179.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|227815860|ref|YP_002815869.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229604024|ref|YP_002865817.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|254682541|ref|ZP_05146402.1| DNA-binding response regulator [Bacillus anthracis str. CNEVA-9066]
 gi|254733959|ref|ZP_05191673.1| DNA-binding response regulator [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740353|ref|ZP_05198044.1| DNA-binding response regulator [Bacillus anthracis str. Kruger B]
 gi|254753741|ref|ZP_05205776.1| DNA-binding response regulator [Bacillus anthracis str. Vollum]
 gi|254758837|ref|ZP_05210864.1| DNA-binding response regulator [Bacillus anthracis str. Australia
           94]
 gi|30255255|gb|AAP25264.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47501725|gb|AAT30401.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178158|gb|AAT53534.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|167512716|gb|EDR88090.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|167530313|gb|EDR93039.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|170128834|gb|EDS97700.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|170669408|gb|EDT20151.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|172082668|gb|EDT67731.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|227002678|gb|ACP12421.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229268432|gb|ACQ50069.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
          Length = 223

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MSKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|312135255|ref|YP_004002593.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor owensensis OL]
 gi|311775306|gb|ADQ04793.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor owensensis OL]
          Length = 223

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  +   NGM+ + + +   PD++I+DI L +  G +
Sbjct: 2   KILVIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGISVFKNEMPDLVILDIMLPKKDGYD 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|166364232|ref|YP_001656505.1| OmpR family two-component response regulator [Microcystis
           aeruginosa NIES-843]
 gi|166086605|dbj|BAG01313.1| two-component response regulator OmpR subfamily [Microcystis
           aeruginosa NIES-843]
          Length = 246

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY      +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAIAELVSINLEMAGYDVNPAEDGIKGQALAVQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTSDIPILMLTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|119486641|ref|ZP_01620691.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119456258|gb|EAW37390.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 243

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+ +PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRKTEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|301059412|ref|ZP_07200334.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300446493|gb|EFK10336.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 231

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 1/123 (0%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M  K V++V+D E  ++L R  +   GY       G EA+++ +  +PD++++D+ L  I
Sbjct: 1   MSGKHVLVVDDEEDILELVRFNLSREGYRVDCVGTGEEAIKIIKSKQPDLMVLDLMLPGI 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+ + +K D E   IP++ +TA   + D     + G + Y++KP S  I    IK  
Sbjct: 61  DGFEVARFLKRDPETSNIPIVMLTAKTEEADVLTGLEMGADDYVTKPFSPRILTARIKAI 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|77463153|ref|YP_352657.1| phosphate regulon transcriptional regulator, PhoR [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462025|ref|YP_001043139.1| two component transcriptional regulator [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221639010|ref|YP_002525272.1| winged helix family two component transcriptional regulator
           [Rhodobacter sphaeroides KD131]
 gi|332558027|ref|ZP_08412349.1| Two component transcriptional regulator, winged helix family
           protein [Rhodobacter sphaeroides WS8N]
 gi|77387571|gb|ABA78756.1| Phosphate regulon transcriptional regulator, PhoR [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103689|gb|ABN76367.1| two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221159791|gb|ACM00771.1| Two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides KD131]
 gi|332275739|gb|EGJ21054.1| Two component transcriptional regulator, winged helix family
           protein [Rhodobacter sphaeroides WS8N]
          Length = 230

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 66/119 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E+ G+  +Q  NG EAL L  +  PDVI++D  L  +SG+E+
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEALMLVEEAGPDVIVLDWMLPSVSGIEV 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q+K     + +P+I ++A + + D  R  + G + Y+ KP S+   M  ++  +  A
Sbjct: 69  CRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127


>gi|323487712|ref|ZP_08092970.1| response regulator [Planococcus donghaensis MPA1U2]
 gi|323398446|gb|EGA91234.1| response regulator [Planococcus donghaensis MPA1U2]
          Length = 235

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++V+D +    + +  ++  G+  +   +G EA+++A + +PD++++DI L    
Sbjct: 1   MSKTILVVDDEKPIADILQFNLKKEGFNVVCAYDGDEAIKIASEIQPDLMLLDIMLPNRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I++  +    P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREIRKKYDF---PIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|306833967|ref|ZP_07467091.1| response regulator [Streptococcus bovis ATCC 700338]
 gi|304423968|gb|EFM27110.1| response regulator [Streptococcus bovis ATCC 700338]
          Length = 236

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EA+    +  PD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLAKEGYETVTAFDGREAITKFEEENPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K++++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|330505652|ref|YP_004382521.1| two component transcriptional regulator [Pseudomonas mendocina
           NK-01]
 gi|328919938|gb|AEB60769.1| two component transcriptional regulator [Pseudomonas mendocina
           NK-01]
          Length = 229

 Score =  170 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   KNILIVDDEAPIREMIAVALEMAGYECLEAENTQQAHAVIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTSDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|86606063|ref|YP_474826.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554605|gb|ABC99563.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 243

 Score =  170 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EALE+ R+  PD++++D+ + ++ G  
Sbjct: 8   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFRKQDPDLVVLDVMMPKLDGYG 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 68  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 123


>gi|307704960|ref|ZP_07641848.1| response regulator [Streptococcus mitis SK597]
 gi|307709233|ref|ZP_07645692.1| response regulator [Streptococcus mitis SK564]
 gi|307620179|gb|EFN99296.1| response regulator [Streptococcus mitis SK564]
 gi|307621470|gb|EFO00519.1| response regulator [Streptococcus mitis SK597]
          Length = 235

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|11467627|ref|NP_050679.1| Ycf27 [Guillardia theta]
 gi|6136611|sp|O78428|YCF27_GUITH RecName: Full=Probable transcriptional regulator ycf27; AltName:
           Full=OmpR-like protein
 gi|3602952|gb|AAC35613.1| ompR homolog [Guillardia theta]
          Length = 254

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D     K+    +   GY  +   +G EAL L  Q  PDV+I+DI + ++ G  
Sbjct: 16  KVLIVDDEASIRKILETRLSMIGYFVVTASDGEEALNLFHQEMPDVVILDIMMPKLDGYG 75

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++DS   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 76  VCQEIRKDS---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRAVLRR 131


>gi|148270266|ref|YP_001244726.1| two component transcriptional regulator [Thermotoga petrophila
           RKU-1]
 gi|170288963|ref|YP_001739201.1| two component transcriptional regulator [Thermotoga sp. RQ2]
 gi|147735810|gb|ABQ47150.1| two component transcriptional regulator, winged helix family
           [Thermotoga petrophila RKU-1]
 gi|170176466|gb|ACB09518.1| two component transcriptional regulator, winged helix family
           [Thermotoga sp. RQ2]
          Length = 239

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+   ++L    +   GY  L+  +G EAL++A     D+ I+DI L  I G 
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+   + +  PVI ++A   + D+    + G + YI+KP S+   +  +K     
Sbjct: 64  ELVRKIRAIEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRR 123


>gi|119468896|ref|ZP_01611921.1| phosphate regulon transcriptional regulatory protein phoB
           [Alteromonadales bacterium TW-7]
 gi|119447548|gb|EAW28815.1| phosphate regulon transcriptional regulatory protein phoB
           [Alteromonadales bacterium TW-7]
          Length = 229

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D     ++   ++E +G+ A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMVEPYPDMVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K+ K++   ++IP+I +TA   + D+ R  + G + Y++KP S    M  IK  I
Sbjct: 61  GIQIAKKFKQNEHTRQIPIIMLTARGEEEDKVRGLEVGADDYVTKPFSPKELMARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|289168019|ref|YP_003446288.1| response regulator [Streptococcus mitis B6]
 gi|288907586|emb|CBJ22423.1| response regulator [Streptococcus mitis B6]
          Length = 235

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDTEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|304318074|ref|YP_003853219.1| transcriptional regulator [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779576|gb|ADL70135.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 232

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++I++D +  +++ +  +E +GY  ++  +G E L+LA++  PD+I++D+ L ++ 
Sbjct: 1   MSSRILIIDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKLAQEKNPDLILLDVMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + +++       P++ +TA   + D+    + G + Y++KP S+   +  +K  +
Sbjct: 61  GFTVLRILRQ---TMTTPILMLTAKEEEVDKVLGLELGADDYVTKPFSMRELIARVKANL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|217968684|ref|YP_002353918.1| two component transcriptional regulator PhoB, winged helix family
           [Thauera sp. MZ1T]
 gi|217506011|gb|ACK53022.1| two component transcriptional regulator PhoB, winged helix family
           [Thauera sp. MZ1T]
          Length = 236

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  ++  +   A  + R+  PD++++D  L   S
Sbjct: 1   MPANILLVEDEPAIQELIAANLARAGHHVVRANDAESAQRIVREALPDLVLLDWMLPGAS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  ++++ D   ++IP+I +TA   + D+    + G + Y++KP S    +  IK  +
Sbjct: 61  GVEFARRLRADERTRDIPIIMLTARGEEQDKVTALEVGADDYVTKPFSPRELVARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302530364|ref|ZP_07282706.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
 gi|302439259|gb|EFL11075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
          Length = 233

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D+E    + R  +ET+G+      +G  AL    +  PD++++D+ +  ++GLE
Sbjct: 7   RVLVVDDDETVRDVVRRYLETAGFTVDLAGDGTAALAQFAERVPDLVVLDVMMPGLNGLE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +++++     ++P++ +TA   + +     + G + Y++KP S       +   +  A
Sbjct: 67  VCRRLRQ---TSQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKELTLRVASVLRRA 123


>gi|295402032|ref|ZP_06811993.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110946|ref|YP_003989262.1| transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294975923|gb|EFG51540.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216047|gb|ADP74651.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y4.1MC1]
          Length = 223

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+D    ++L    +   GY  ++  +G+ A++    HK D++++DI + E+ G
Sbjct: 1   MYTILLVDDETRMLELLALYLSPKGYHCVKCESGLAAVQYLENHKADLVLLDIMMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E  K+I+E     ++P+I VTA     D  +    G + YI+KP   +  +  I+  + 
Sbjct: 61  WETCKRIRE---FSDVPIIMVTARDQTLDIVKGLNIGADDYITKPFDEAELLARIEAVLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|118443576|ref|YP_877112.1| transcriptional regulator [Clostridium novyi NT]
 gi|118134032|gb|ABK61076.1| transcriptional regulatory protein [Clostridium novyi NT]
          Length = 228

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ML K++IV+D+E   ++ +  +E+SGY      +G  A     ++KPD++++D+ L  + 
Sbjct: 4   MLGKILIVDDDENICEIIKMYLESSGYSTECCYDGKSAQTAFYEYKPDLVLLDVMLPHMD 63

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K I+++    E PVI +TA     D+    + G + YI KP      +  IK  +
Sbjct: 64  GIDVLKWIRKE---CETPVIMLTAKGETFDKVLALELGADDYIVKPFEPKELIARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|220932165|ref|YP_002509073.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
 gi|219993475|gb|ACL70078.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
          Length = 227

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 66/123 (53%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D +   K+ +  +E   +      +G EAL    +  PD+II+D+ L EIS
Sbjct: 1   MNPKILVVDDEKKIRKVLKAFLEKHDFSIEMASDGKEALSKVNEFNPDLIILDLMLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++D   ++ P++ +TA   + D+      G + Y+ KP SL   +  IK  +
Sbjct: 61  GEEVCQKIRQD---KQTPILMLTAKGTEEDKVNGFAYGADDYLVKPFSLRELLARIKAIL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|152968913|ref|YP_001334022.1| transcriptional regulator PhoB [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206576178|ref|YP_002240146.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella pneumoniae 342]
 gi|238893323|ref|YP_002918057.1| transcriptional regulator PhoB [Klebsiella pneumoniae NTUH-K2044]
 gi|262042405|ref|ZP_06015566.1| phosphate regulon response regulator [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936893|ref|YP_003440952.1| two component transcriptional regulator, winged helix family
           [Klebsiella variicola At-22]
 gi|290510051|ref|ZP_06549421.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. 1_1_55]
 gi|330006877|ref|ZP_08305751.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. MS 92-3]
 gi|1172481|sp|P45605|PHOB_KLEPN RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|149295|gb|AAA25122.1| phosphate regulatory protein phoB [Klebsiella pneumoniae]
 gi|150953762|gb|ABR75792.1| positive response regulator for pho regulon, sensor is PhoR (or
           CreC) [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|206565236|gb|ACI07012.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella pneumoniae 342]
 gi|238545639|dbj|BAH61990.1| positive response regulator for pho regulon [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040237|gb|EEW41347.1| phosphate regulon response regulator [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891602|gb|ADC59920.1| two component transcriptional regulator, winged helix family
           [Klebsiella variicola At-22]
 gi|289776767|gb|EFD84765.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. 1_1_55]
 gi|328535683|gb|EGF62130.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. MS 92-3]
          Length = 229

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKLLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|11467431|ref|NP_043139.1| hypothetical protein CypaCp002 [Cyanophora paradoxa]
 gi|1351749|sp|P48259|YCF27_CYAPA RecName: Full=Probable transcriptional regulator ycf27; AltName:
           Full=OmpR-like protein
 gi|1016232|gb|AAA81319.1| ycf27 [Cyanophora paradoxa]
          Length = 239

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D     ++    +   GY  +   +G EAL + +   P+++++D+ + ++ G 
Sbjct: 6   KKILVVDDEISIRRILETRLSMIGYEVVTAADGEEALTIFQLEHPNLVVLDVMMPKLDGY 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 66  GVCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSLLRR 122


>gi|332708796|ref|ZP_08428767.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
 gi|332352338|gb|EGJ31907.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
          Length = 245

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAISELVTINLEMAGYDVSQAMDGIKGQALALQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IPV+ +TA     D+      G + Y++KP  L   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTSDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFELEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|306825161|ref|ZP_07458503.1| DNA-binding response regulator [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432597|gb|EFM35571.1| DNA-binding response regulator [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 235

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKAIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|84393908|ref|ZP_00992650.1| Response regulator [Vibrio splendidus 12B01]
 gi|86145558|ref|ZP_01063888.1| Response regulator [Vibrio sp. MED222]
 gi|218708602|ref|YP_002416223.1| DNA-binding response regulator PhoB [Vibrio splendidus LGP32]
 gi|84375458|gb|EAP92363.1| Response regulator [Vibrio splendidus 12B01]
 gi|85836529|gb|EAQ54655.1| Response regulator [Vibrio sp. MED222]
 gi|218321621|emb|CAV17573.1| DNA-binding response regulator PhoB [Vibrio splendidus LGP32]
          Length = 229

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLCEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|146309422|ref|YP_001189887.1| two component transcriptional regulator [Pseudomonas mendocina ymp]
 gi|145577623|gb|ABP87155.1| two component transcriptional regulator, winged helix family
           [Pseudomonas mendocina ymp]
          Length = 229

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   KNILIVDDEAPIREMIAVALEMAGYECLEAENTQQAHAVIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTSDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|75761471|ref|ZP_00741436.1| Two-component response regulator yycF [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74491032|gb|EAO54283.1| Two-component response regulator yycF [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 173

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 70/123 (56%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    + +  +E  G+  +   +G EA+E A + +PD++++DI L   
Sbjct: 1   MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ ++I++ SE   +P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGLEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|228994533|ref|ZP_04154374.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
 gi|228765212|gb|EEM13925.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
          Length = 248

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++I+ED E   ++ +  +E  GY      NGME  +L   H+PD+I++D+ + +  
Sbjct: 9   MKQRILIIEDEENIREVCKRYLEREGYEVYTAMNGMEGWDLFLTHQPDLILLDLMMSKKD 68

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + D       G + Y++KP S    +  ++  +
Sbjct: 69  GWELCEEIRQQS---NVPIIMLTAKGEERDRILGLTIGADDYVTKPFSPRELVLRVQIIL 125

Query: 121 GE 122
             
Sbjct: 126 KR 127


>gi|1575577|gb|AAC44436.1| DNA-binding response regulator [Thermotoga maritima]
          Length = 239

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+   ++L    +   GY  L+  +G EAL++A     D+ I+DI L  I G 
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+   + +  PVI ++A   + D+    + G + YI+KP S+   +  +K     
Sbjct: 64  ELVRKIRSMEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRR 123


>gi|56419443|ref|YP_146761.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|56379285|dbj|BAD75193.1| two-component response regulator [Geobacillus kaustophilus HTA426]
          Length = 224

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+    +L    +   G+   +  NG EAL++    K D++IMDI + E+ G
Sbjct: 1   MTRILIVDDDAHIRELVSHFLNLEGFTIHEAANGKEALDVLETVKVDLVIMDIMMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++++   +  ++P++ +TA      + +  + G + Y+ KP      +  +K  + 
Sbjct: 61  WELCRELR---DYDDVPILMLTAKGETRQKVKGFELGADDYLVKPFDPLELVARVKALLK 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|163785470|ref|ZP_02180068.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879260|gb|EDP73166.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Hydrogenivirga sp. 128-5-R1-1]
          Length = 311

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 37/117 (31%), Positives = 69/117 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D+E N  LF+ +++  GY   +  NG E ++ A + KPDVI+MD+ +  + G  
Sbjct: 8   KILIVDDDERNRLLFKVILKKEGYETTEAENGEEGIKKALEEKPDVILMDVMMPVMDGFT 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            TK++K D   + IPVI +TA   + ++ +  + G   +++KP+     +  IK ++
Sbjct: 68  ATKKLKSDDRTKHIPVIILTALNEREEKLKGIESGANDFLTKPVDTKELLLRIKNHL 124


>gi|307150227|ref|YP_003885611.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7822]
 gi|306980455|gb|ADN12336.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7822]
          Length = 246

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAISELVSINLEMAGYDVNQAEDGIKGQALAVQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IPV+ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTSDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|306829564|ref|ZP_07462754.1| DNA-binding response regulator [Streptococcus mitis ATCC 6249]
 gi|304428650|gb|EFM31740.1| DNA-binding response regulator [Streptococcus mitis ATCC 6249]
          Length = 252

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 18  MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 77

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 78  LEVAKAIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 134

Query: 122 E 122
            
Sbjct: 135 R 135


>gi|293570841|ref|ZP_06681888.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
 gi|291609109|gb|EFF38384.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
          Length = 234

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++V+D +    + +  +   GY      +G EALE   + +PD+I++D+ L ++ G
Sbjct: 1   MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKVAEVEPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---TYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|69247564|ref|ZP_00604398.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|227552548|ref|ZP_03982597.1| VicR family response regulator [Enterococcus faecium TX1330]
 gi|258614681|ref|ZP_05712451.1| DNA-binding response regulator VicR [Enterococcus faecium DO]
 gi|293378479|ref|ZP_06624642.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
 gi|293553004|ref|ZP_06673649.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|293559841|ref|ZP_06676356.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|293567713|ref|ZP_06679056.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|294616677|ref|ZP_06696447.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|294619190|ref|ZP_06698676.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecium E1679]
 gi|294623110|ref|ZP_06701996.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|68194788|gb|EAN09265.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|227178297|gb|EEI59269.1| VicR family response regulator [Enterococcus faecium TX1330]
 gi|291589648|gb|EFF21453.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|291590431|gb|EFF22170.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|291594572|gb|EFF25963.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecium E1679]
 gi|291597479|gb|EFF28644.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|291602810|gb|EFF33017.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|291606205|gb|EFF35624.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|292642808|gb|EFF60955.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
          Length = 234

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++V+D +    + +  +   GY      +G EALE   + +PD+I++D+ L ++ G
Sbjct: 1   MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKVAEVEPDLILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---TYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|307708758|ref|ZP_07645220.1| DNA-binding response regulator [Streptococcus mitis NCTC 12261]
 gi|307615124|gb|EFN94335.1| DNA-binding response regulator [Streptococcus mitis NCTC 12261]
          Length = 235

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|159037489|ref|YP_001536742.1| response regulator receiver modulated diguanylate cyclase
           [Salinispora arenicola CNS-205]
 gi|157916324|gb|ABV97751.1| response regulator receiver modulated diguanylate cyclase
           [Salinispora arenicola CNS-205]
          Length = 326

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 63/118 (53%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D+E   +     +   GY  +  R+G EALE+  QH+PD+ ++D+ +  + GLE+
Sbjct: 11  ILVVDDDEDIARFVEFNLRLHGYEVIHARDGQEALEVIAQHRPDLAVVDLMMPRVDGLEL 70

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T++++ D     +PVI +TA  M  D+      G + Y+ KP   +  +  +   +  
Sbjct: 71  TRRLRADPMTAALPVIMLTAKGMTVDKVHGLSAGADDYLVKPFDTAELVARVSSTLRR 128


>gi|239617306|ref|YP_002940628.1| two component transcriptional regulator, winged helix family
           [Kosmotoga olearia TBF 19.5.1]
 gi|239506137|gb|ACR79624.1| two component transcriptional regulator, winged helix family
           [Kosmotoga olearia TBF 19.5.1]
          Length = 221

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 1/122 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV++VED+    K  +  +E  GY       G +AL+   +  PDV+++D+ L E++
Sbjct: 1   MKAKVLLVEDDPHIRKFIQLELEHEGYEVKTAVTGPQALDELEKELPDVVLLDVMLPEMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++I+ED    E+PVI +TA     D  R  K G + YI KP  +   +  ++  +
Sbjct: 61  GFTVLERIREDFST-ELPVIMLTARGELEDRVRGLKSGADDYIVKPFHIEELLARLEAVL 119

Query: 121 GE 122
             
Sbjct: 120 RR 121


>gi|254414140|ref|ZP_05027907.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178815|gb|EDX73812.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 245

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R  +PD++++D+ + ++ G  
Sbjct: 10  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRTSEPDLVVLDVMMPKLDGYG 69

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 70  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 125


>gi|153854191|ref|ZP_01995499.1| hypothetical protein DORLON_01490 [Dorea longicatena DSM 13814]
 gi|149753240|gb|EDM63171.1| hypothetical protein DORLON_01490 [Dorea longicatena DSM 13814]
          Length = 229

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++V++V+D +L +K  R  +E  GY      +G EAL+LA+++  D+I++D+ L +  
Sbjct: 1   MSRRVLVVDDEKLIVKGIRFSLEQDGYDVDCAYDGEEALKLAKENAYDIILLDVMLPKYD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +QI+E     ++P+I +TA     D+      G + YI+KP ++      IK  +
Sbjct: 61  GFEVCQQIRE---YSDVPIIMLTAKGDDMDKILGLDYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|307718247|ref|YP_003873779.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
 gi|306531972|gb|ADN01506.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
          Length = 226

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D    ++L R  +E  GY  + T  G +ALE AR   PD II+D+ L  +SGLE
Sbjct: 2   TILVVDDEPDIVELVRFHLEREGYDVVSTGEGRDALEKARNLLPDAIILDLMLPGMSGLE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + +++      IP++ +TA + + D     + G + YI+KP S  I +  +K  +  
Sbjct: 62  VCRLLRQQDRTSHIPILMLTAKSEETDVVVGLELGADDYITKPFSPRILLARLKAVLKR 120


>gi|242373983|ref|ZP_04819557.1| response regulator [Staphylococcus epidermidis M23864:W1]
 gi|242348337|gb|EES39939.1| response regulator [Staphylococcus epidermidis M23864:W1]
          Length = 236

 Score =  170 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EAL+     +P++I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALQKVEDEQPELIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKSIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|311103716|ref|YP_003976569.1| phosphate regulon transcriptional regulatory protein PhoB
           [Achromobacter xylosoxidans A8]
 gi|310758405|gb|ADP13854.1| phosphate regulon transcriptional regulatory protein PhoB
           [Achromobacter xylosoxidans A8]
          Length = 232

 Score =  170 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAELPDLILLDWMLPGTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + ++++ D   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLAMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|257899652|ref|ZP_05679305.1| transcriptional regulator [Enterococcus faecium Com15]
 gi|257837564|gb|EEV62638.1| transcriptional regulator [Enterococcus faecium Com15]
          Length = 244

 Score =  170 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++V+D +    + +  +   GY      +G EALE   + +PD+I++D+ L ++ G
Sbjct: 11  MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKVAEVEPDLILLDLMLPKMDG 70

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 71  LEVAREVRK---TYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 127

Query: 122 E 122
            
Sbjct: 128 R 128


>gi|257880368|ref|ZP_05660021.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257882229|ref|ZP_05661882.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257885424|ref|ZP_05665077.1| transcriptional regulator [Enterococcus faecium 1,231,501]
 gi|257888221|ref|ZP_05667874.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257891026|ref|ZP_05670679.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257894279|ref|ZP_05673932.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|257896891|ref|ZP_05676544.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|260562331|ref|ZP_05832845.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|261208378|ref|ZP_05923028.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289566829|ref|ZP_06447239.1| transcriptional regulatory protein yycF [Enterococcus faecium
           D344SRF]
 gi|314939997|ref|ZP_07847192.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|314943532|ref|ZP_07850297.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|314948950|ref|ZP_07852317.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
 gi|314950769|ref|ZP_07853845.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|314994105|ref|ZP_07859422.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|314998036|ref|ZP_07862928.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|257814596|gb|EEV43354.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257817887|gb|EEV45215.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257821280|gb|EEV48410.1| transcriptional regulator [Enterococcus faecium 1,231,501]
 gi|257824275|gb|EEV51207.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257827386|gb|EEV54012.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257830658|gb|EEV57265.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|257833456|gb|EEV59877.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|260073255|gb|EEW61596.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|260077439|gb|EEW65158.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289161360|gb|EFD09250.1| transcriptional regulatory protein yycF [Enterococcus faecium
           D344SRF]
 gi|313587966|gb|EFR66811.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|313591472|gb|EFR70317.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|313597049|gb|EFR75894.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|313597770|gb|EFR76615.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|313640767|gb|EFS05347.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|313644649|gb|EFS09229.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
          Length = 244

 Score =  170 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++V+D +    + +  +   GY      +G EALE   + +PD+I++D+ L ++ G
Sbjct: 11  MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKVAEVEPDLILLDLMLPKMDG 70

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 71  LEVAREVRK---TYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 127

Query: 122 E 122
            
Sbjct: 128 R 128


>gi|332798939|ref|YP_004460438.1| winged helix family two component transcriptional regulator
           [Tepidanaerobacter sp. Re1]
 gi|332696674|gb|AEE91131.1| two component transcriptional regulator, winged helix family
           [Tepidanaerobacter sp. Re1]
          Length = 239

 Score =  170 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 68/118 (57%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D +   +L R  +E+ GY   +  +G EAL +AR  +P +II+D+ L +I GLE+
Sbjct: 8   ILVVDDEKNIRELVRFNLESRGYKVKEAMDGKEALSIARTDEPLLIILDLMLPKIDGLEV 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + +K D   ++IP+I +TA   + D+    + G + YI+KP S    +  ++  I  
Sbjct: 68  CRILKGDPSTKKIPIIMLTALGDEIDKIVGLELGADDYITKPFSPREMVARVRAVIRR 125


>gi|299535466|ref|ZP_07048788.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Lysinibacillus fusiformis ZC1]
 gi|298729227|gb|EFI69780.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Lysinibacillus fusiformis ZC1]
          Length = 238

 Score =  170 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++++ED      L +  +E +GY+     +G E LE A   +P++I++D+ L ++ 
Sbjct: 1   MTKTILVIEDEFSIATLLKYNLEQAGYVVETAADGQEGLEKAIDLQPNLILLDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQI++  +    P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCKQIRQ--QRMNTPIIMLTAKDDEFDKVLGLELGADDYMTKPFSPREVLARVKAVL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|228475155|ref|ZP_04059881.1| transcriptional regulatory protein [Staphylococcus hominis SK119]
 gi|314936205|ref|ZP_07843552.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus hominis subsp. hominis C80]
 gi|228270766|gb|EEK12168.1| transcriptional regulatory protein [Staphylococcus hominis SK119]
 gi|313654824|gb|EFS18569.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus hominis subsp. hominis C80]
          Length = 236

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 71/123 (57%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EAL+  ++ KP++I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVDVAYDGEEALKKVKEVKPELIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|170760425|ref|YP_001786436.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407414|gb|ACA55825.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 233

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 67/125 (53%), Gaps = 6/125 (4%)

Query: 2   LK---KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           +K   K+++V+D E  + + +  +E  GY  +   +G EA++L ++    ++I+D+ L +
Sbjct: 1   MKEFFKILVVDDEERILDVVKAYLEKEGYEVITAMDGEEAIKLFKEISFHLVILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           I G E+  +I+E      +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 61  IFGEEVCSKIRE---FSNVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|254415706|ref|ZP_05029464.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196177412|gb|EDX72418.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 236

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 62/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED     KL +  +E  G+     R+G+ A++  +  +PDVII+D+ L  + GLE+
Sbjct: 3   ILIVEDEAEIAKLIQLTLEREGFTCYSCRDGLAAIQAFQSQQPDVIILDLMLPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S +  +  ++  +  +
Sbjct: 63  CARIRQKPGPKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPTELVARVRALLRRS 121


>gi|282898472|ref|ZP_06306462.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
 gi|281196638|gb|EFA71544.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
          Length = 242

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKANPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|169829556|ref|YP_001699714.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Lysinibacillus sphaericus C3-41]
 gi|168994044|gb|ACA41584.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           [Lysinibacillus sphaericus C3-41]
          Length = 238

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++++ED      L +  +E +GY+     +G E LE A   +P++I++D+ L ++ 
Sbjct: 1   MTKTILVIEDEFSIATLLKYNLEQAGYLVETAADGQEGLEKAIDIQPNLILLDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQI++  +    P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCKQIRQ--QRMNTPIIMLTAKDDEFDKVLGLELGADDYMTKPFSPREVLARVKAVL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|125974818|ref|YP_001038728.1| two component transcriptional regulator [Clostridium thermocellum
           ATCC 27405]
 gi|256004925|ref|ZP_05429898.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281418728|ref|ZP_06249747.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
 gi|125715043|gb|ABN53535.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum ATCC 27405]
 gi|255991105|gb|EEU01214.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281407812|gb|EFB38071.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
 gi|316941938|gb|ADU75972.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 1313]
          Length = 232

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D +  + + +  +   G+  L+  +G +A+ELA   KPD+I++DI L ++ 
Sbjct: 1   MSAKILVVDDEKNIVDILKFNLAKEGFSTLEANDGEQAIELALSEKPDLILLDIMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++++E       P+I +TA   + D+    + G + YI+KP S    M  +K  +
Sbjct: 61  GFTVCRKLRESI---STPIIMITAKEEEVDKVLGLELGADDYITKPFSTRELMARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|86609993|ref|YP_478755.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558535|gb|ABD03492.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 246

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EALE+  +  PD++++D+ + ++ G  
Sbjct: 8   RILVVDDEASIRRILETRLSMIGYDVVTASDGEEALEVFHKQDPDLVVLDVMMPKLDGYG 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 68  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 123


>gi|313887650|ref|ZP_07821332.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846259|gb|EFR33638.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 233

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D      + +   E  GY+     NG EA+ LA+++  D+I++DI + +++
Sbjct: 1   MEEKILVVDDESAISDIIKFNFEKEGYLVETACNGKEAIALAKENNYDLILLDIMMPKLN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  ++I++     ++PVI +TA   + D+    + G + Y+ KP S+   +  +K  +
Sbjct: 61  GFEALREIRK---TSDVPVIMLTAREEEVDKVLGLELGADDYVVKPFSMRELLARVKAVL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|218440560|ref|YP_002378889.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
 gi|218173288|gb|ACK72021.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
          Length = 246

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAISELVSINLEMAGYDVNQAEDGIKGQALAVQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDDRTSDIPILMLTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|21283366|ref|NP_646454.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MW2]
 gi|49486519|ref|YP_043740.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|297207594|ref|ZP_06924029.1| response regulator [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300911675|ref|ZP_07129119.1| response regulator [Staphylococcus aureus subsp. aureus TCH70]
 gi|21204806|dbj|BAB95502.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MW2]
 gi|49244962|emb|CAG43423.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|296887611|gb|EFH26509.1| response regulator [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300887096|gb|EFK82297.1| response regulator [Staphylococcus aureus subsp. aureus TCH70]
          Length = 234

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D    + L +  +ET+GY  +   +G EALE     +PD+II+D+ L +  
Sbjct: 1   MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K ++ +  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIDVCKTVRTNKNL--VPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|296332246|ref|ZP_06874708.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674948|ref|YP_003866620.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150560|gb|EFG91447.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413192|gb|ADM38311.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 240

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y+  +  NG EA+    +   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLRMYLERENYVIDEAENGDEAIAKGLEANYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +Q++E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 68  VCRQVREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 124


>gi|156741487|ref|YP_001431616.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156232815|gb|ABU57598.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 231

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D+    +L    +E +G+  L   +G  AL LAR  +PD++++D+ L +I 
Sbjct: 1   MPQRILVVDDDRQITRLVSAYLEHAGFQTLTAHDGATALRLARSERPDLMVLDLMLPDID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++T+ I+ D  +  +P+I +TA     D     + G + YI+KP +    +  ++  +
Sbjct: 61  GADLTRAIRADPHIAAMPIIMLTARVDDTDRIVGLELGADDYITKPFNPREVVARVRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|52082613|ref|YP_081404.1| putative two-component response regulator YycF [Bacillus
           licheniformis ATCC 14580]
 gi|52788011|ref|YP_093840.1| YycF [Bacillus licheniformis ATCC 14580]
 gi|319648478|ref|ZP_08002694.1| transcriptional regulatory protein yycF [Bacillus sp. BT1B_CT2]
 gi|52005824|gb|AAU25766.1| putative two-component response regulator YycF [Bacillus
           licheniformis ATCC 14580]
 gi|52350513|gb|AAU43147.1| YycF [Bacillus licheniformis ATCC 14580]
 gi|317389557|gb|EFV70368.1| transcriptional regulatory protein yycF [Bacillus sp. BT1B_CT2]
          Length = 235

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    ++  GY      +G EAL++     PD+I++DI L    
Sbjct: 1   MEKKILVVDDEKPIADILEFNLKKEGYEVHCAYDGNEALQMVEDLNPDMILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|39937833|ref|NP_950109.1| winged helix family two component transcriptional regulator
           [Rhodopseudomonas palustris CGA009]
 gi|192293618|ref|YP_001994223.1| two component transcriptional regulator, winged helix family
           [Rhodopseudomonas palustris TIE-1]
 gi|39651693|emb|CAE30215.1| two-component phosphate transcriptional regulator PhoB
           [Rhodopseudomonas palustris CGA009]
 gi|192287367|gb|ACF03748.1| two component transcriptional regulator, winged helix family
           [Rhodopseudomonas palustris TIE-1]
          Length = 237

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +E+ GY       G +A    ++  PD++++D  L  +S
Sbjct: 1   MAARILVVEDEEALTTLLRYNLESEGYEVETVARGDDADTRMKERIPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|288561544|ref|YP_003428950.1| response regulator receiver protein [Bacillus pseudofirmus OF4]
 gi|288548176|gb|ADC52058.1| response regulator receiver protein [Bacillus pseudofirmus OF4]
          Length = 231

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 63/123 (51%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D      L R  +   GY  ++  NG EAL+  + H   +II+D+ + E+ 
Sbjct: 1   MDTKILIVDDEWNMRNLIRIHLSKQGYNIVEAVNGKEALKEMKCHSFQLIILDVMMPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++++    +P++ +TA     D+ +    G + Y++KP      +  +   +
Sbjct: 61  GWEVCEEIRKENLA--LPILMLTARTETTDKVKGLDIGADDYLTKPFKPEELIARVNALL 118

Query: 121 GEA 123
             A
Sbjct: 119 RRA 121


>gi|56477139|ref|YP_158728.1| phosphate regulon transcriptional regulatory protein phoB
           [Aromatoleum aromaticum EbN1]
 gi|56313182|emb|CAI07827.1| Phosphate regulon transcriptional regulatory protein phoB
           [Aromatoleum aromaticum EbN1]
          Length = 235

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  ++  +  EA +  R   PD++++D  L  ++
Sbjct: 1   MPANILLVEDELAIQELIAASLSRAGHRVVRASDAEEAAQRLRDALPDLVLLDWMLPGMT 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  ++++ D   +EIP+I +TA   + D+    + G + YI+KP S       I   +
Sbjct: 61  GIEFARRLRGDERTREIPIIMLTARGEEQDKVAGLESGADDYITKPFSPRELAARITAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|317404463|gb|EFV84875.1| response regulator [Achromobacter xylosoxidans C54]
          Length = 232

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAELPDLILLDWMLPGTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + ++++ D   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLAMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|254432209|ref|ZP_05045912.1| regulatory protein, LuxR:Response regulator receiver [Cyanobium sp.
           PCC 7001]
 gi|197626662|gb|EDY39221.1| regulatory protein, LuxR:Response regulator receiver [Cyanobium sp.
           PCC 7001]
          Length = 273

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 55/119 (46%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D        +  +E  G+      +G E  E A++  PDV+I D+ +    G  
Sbjct: 47  RLLLVDDEPGLRTAVKAYLEDEGFAVTTANDGEEGWEKAQELLPDVVISDVMMPCCDGYG 106

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++ D  L   PVI +TA  M  D     + GC+ YI KP      +  ++  +  
Sbjct: 107 LLRKLRADERLGGTPVIFLTAKGMTADRIAGFQAGCDDYIPKPFDPDELVARVRNAVRR 165


>gi|312622321|ref|YP_004023934.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202788|gb|ADQ46115.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 223

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++++D+    ++ +  +E  G+  +   NGM+ + + +   P+++I+DI L +  G E
Sbjct: 2   KILVIDDDVKICEVIKLYLEKEGFEVVIAHNGMDGIAMFKNEMPNLVILDIMLPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++++   +  IP+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 62  VCRELRK---ISNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRR 117


>gi|15614143|ref|NP_242446.1| two-component response regulator [Bacillus halodurans C-125]
 gi|10174197|dbj|BAB05299.1| two-component response regulator [Bacillus halodurans C-125]
          Length = 238

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+++V+D +    L +  +E   Y   +  +G EALE A     DVI++D+ + E+ G+
Sbjct: 5   AKILVVDDEDRIRNLLKMYLEREAYDVEEASDGKEALEKALAFDYDVILLDLMMPEMDGI 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  
Sbjct: 65  EVCQKLRKQ---KATPIIMLTAKGEEANRVQGFEVGTDDYIVKPFSPREVVLRVKALLRR 121

Query: 123 A 123
           +
Sbjct: 122 S 122


>gi|168182895|ref|ZP_02617559.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|237794337|ref|YP_002861889.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
 gi|182673952|gb|EDT85913.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|229263491|gb|ACQ54524.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
          Length = 233

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K  K+++V+D    + + +  +E  GY  +   +G EA++L ++    ++I+D+ L +
Sbjct: 1   MKKLFKILVVDDEVRILDVVKAYLEKEGYEVITAMDGEEAIKLFKEISFHLVILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +SG E+  +I+E S    +P+I +TA   + ++      G + Y++KP S+   +  +K 
Sbjct: 61  LSGEEVCSKIRESS---NVPIIMLTAKVEEEEKLEGLSIGADDYLTKPFSVRELVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|153871532|ref|ZP_02000680.1| adenylate/guanylate cyclase [Beggiatoa sp. PS]
 gi|152071998|gb|EDN69316.1| adenylate/guanylate cyclase [Beggiatoa sp. PS]
          Length = 594

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 67/117 (57%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+DN +N+K+    ++ + +  +  +NG  A+   +  KPD+I++DI +  + G E
Sbjct: 7   KVLIVDDNSVNLKILSRFLKKAHFEVIMAKNGESAITQVKNLKPDIILLDIMMPGMDGFE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             + +K + E ++IPVI +TA     D+ +  K G   YI+KP+ +   +  +  ++
Sbjct: 67  TCRCLKANEESKDIPVIFMTALESTPDKVKGFKIGAIDYITKPVQMEEVLARVNTHL 123


>gi|81427690|ref|YP_394688.1| two-component system, response regulator [Lactobacillus sakei
           subsp. sakei 23K]
 gi|4104602|gb|AAD10263.1| putative response regulator [Lactobacillus sakei subsp. sakei 23K]
 gi|78609330|emb|CAI54376.1| Two-component system, response regulator [Lactobacillus sakei
           subsp. sakei 23K]
          Length = 237

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +   GY      +G EAL+   +  PD+I++D+ L ++ 
Sbjct: 1   MAKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVEEVVPDLILLDLMLPKVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +Q+++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVARQVRKS---HDMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|47565258|ref|ZP_00236300.1| DNA-binding response regulator VicR [Bacillus cereus G9241]
 gi|208742147|ref|YP_002267599.1| two component transcriptional regulator [Bacillus cereus]
 gi|47557612|gb|EAL15938.1| DNA-binding response regulator VicR [Bacillus cereus G9241]
          Length = 237

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++I+ED E   ++ +  +E   Y      NG E  EL   H+PD+II+D+ + + +
Sbjct: 1   MKKRILIIEDEENIREVCKQYLEREEYEVYTAVNGKEGWELFLTHQPDLIILDLMMPQKN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ ++I++ S    +P+I +TA   + +       G + Y++KP S    +  I+   
Sbjct: 61  GWELCEEIRQKS---NVPIIMLTAKGEERNRILGLTIGADDYLTKPFSPHELVLRIQIIF 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|166364957|ref|YP_001657230.1| OmpR family two-component response regulator [Microcystis
           aeruginosa NIES-843]
 gi|166087330|dbj|BAG02038.1| two-component response regulator OmpR subfamily [Microcystis
           aeruginosa NIES-843]
          Length = 246

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R  +PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALETFRTAEPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|24379907|ref|NP_721862.1| putative response regulator CovR; VicR-like protein [Streptococcus
           mutans UA159]
 gi|290580113|ref|YP_003484505.1| putative response regulator [Streptococcus mutans NN2025]
 gi|14600271|gb|AAK71319.1|AF393849_1 responder protein CovR [Streptococcus mutans]
 gi|24377886|gb|AAN59168.1|AE014984_3 putative response regulator CovR; VicR-like protein [Streptococcus
           mutans UA159]
 gi|254997012|dbj|BAH87613.1| putative response regulator [Streptococcus mutans NN2025]
          Length = 235

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EAL    +  PD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLAKEGYDTITAFDGREALSKYEEENPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+++++S    +P+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRKNS---HVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|317484883|ref|ZP_07943773.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316923865|gb|EFV45061.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 228

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
              ++IVED +   +L    +E  GY  +Q  +G E LELAR  KPD+I++D+ L ++ G
Sbjct: 5   SATILIVEDEQDIRELLAYNLEKEGYATVQAADGKEGLELARSRKPDLILLDLMLPKMDG 64

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + ++++ DS    IP+I +TA     D     + G + Y+ KP ++   +  I+  + 
Sbjct: 65  LAVCRELERDSGTVRIPIIMLTARGEDVDRILGFELGADDYVVKPFNIRELLLRIRAILR 124

Query: 122 E 122
            
Sbjct: 125 R 125


>gi|300869112|ref|ZP_07113711.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
 gi|300332881|emb|CBN58907.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
          Length = 247

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL+  R   PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTFRNTDPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|297530901|ref|YP_003672176.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
 gi|297254153|gb|ADI27599.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
          Length = 226

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IV+D+    +L    +   G+   +  NG EAL++    K D++IMDI + E+ G
Sbjct: 3   MTRILIVDDDAHIRELVSHFLNLEGFTIHEAANGKEALDVLETVKVDLVIMDIMMPEMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++++   +  ++P++ +TA      + +  + G + Y+ KP      +  +K  + 
Sbjct: 63  WELCRELR---DYDDVPILMLTAKGETRQKVKGFELGADDYLVKPFDPLELVARVKALLK 119

Query: 122 E 122
            
Sbjct: 120 R 120


>gi|296501980|ref|YP_003663680.1| two-component response regulator [Bacillus thuringiensis BMB171]
 gi|296323032|gb|ADH05960.1| two-component response regulator [Bacillus thuringiensis BMB171]
          Length = 223

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|315646392|ref|ZP_07899510.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus vortex V453]
 gi|315278035|gb|EFU41355.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus vortex V453]
          Length = 238

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D E   +L +  +E  GY   +  +G  AL  A      ++I+D+ L  + G+E
Sbjct: 7   RILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRKASSEDYGLVILDVMLPGMDGVE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++   ++  P++ +TA   + +  +  + G + Y+ KP S    +  +K  +  +
Sbjct: 67  VCTRLRQ---VKSTPILMLTAKGEEINRVQGFEVGADDYVVKPFSPREVIYRVKAILRRS 123


>gi|331656451|ref|ZP_08357413.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA206]
 gi|315299630|gb|EFU58878.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 16-3]
 gi|331054699|gb|EGI26708.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA206]
          Length = 229

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIIKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|119511035|ref|ZP_01630155.1| Two component Transcriptional regulator, Winged helix family
           protein [Nodularia spumigena CCY9414]
 gi|119464286|gb|EAW45203.1| Two component Transcriptional regulator, Winged helix family
           protein [Nodularia spumigena CCY9414]
          Length = 242

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+ +PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKSEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|330831636|ref|YP_004394588.1| winged helix family two component transcriptional regulator
           [Aeromonas veronii B565]
 gi|328806772|gb|AEB51971.1| Two component transcriptional regulator, winged helix family
           [Aeromonas veronii B565]
          Length = 240

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IV+D++   +L  + +  +G+  L    G E  +   QH PD+II+DI +    
Sbjct: 3   MSKQLLIVDDDQEIRELLNEYLTRAGFQVLTAAEGNEMRQQLAQHSPDLIILDIMMPGED 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + +QI+ DS+   +P+I +TA + + D     + G + YI+KP S       IK  +
Sbjct: 63  GFTLCQQIRRDSQ---VPIIMLTAASDEADRVIGLELGADDYIAKPFSPRELQARIKALL 119

Query: 121 GEA 123
             A
Sbjct: 120 RRA 122


>gi|289643472|ref|ZP_06475591.1| two component transcriptional regulator, winged helix family
           [Frankia symbiont of Datisca glomerata]
 gi|289506724|gb|EFD27704.1| two component transcriptional regulator, winged helix family
           [Frankia symbiont of Datisca glomerata]
          Length = 290

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D+    ++    +  +G+   +  +G+ AL +A    PD++++D+ L  I G+E
Sbjct: 54  RVLVVDDDPTVAEVVDRYLRNAGFDVDRAADGLTALRMAETTVPDLVVLDLMLPGIDGIE 113

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++E    + +PVI +TA   + D     + G + Y++KP S       ++  +  A
Sbjct: 114 VCRRLREQ---RPVPVIMLTARGEEADRVAGLETGADDYVTKPFSPRELTLRVRSVLRRA 170


>gi|113474756|ref|YP_720817.1| two component transcriptional regulator [Trichodesmium erythraeum
           IMS101]
 gi|110165804|gb|ABG50344.1| two component transcriptional regulator, winged helix family
           [Trichodesmium erythraeum IMS101]
          Length = 243

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE      PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFHNTTPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|240146374|ref|ZP_04744975.1| DNA-binding response regulator YycF [Roseburia intestinalis L1-82]
 gi|257201483|gb|EEU99767.1| DNA-binding response regulator YycF [Roseburia intestinalis L1-82]
 gi|291535777|emb|CBL08889.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Roseburia intestinalis
           M50/1]
          Length = 230

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E  G       +G EAL++A ++  D++++DI L ++ 
Sbjct: 1   MAKKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEALKMATENAYDMVLLDIMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ + I+E      +P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFEVCQHIRE---FSNMPIVMLTAKGDDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|310642600|ref|YP_003947358.1| two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
 gi|309247550|gb|ADO57117.1| Two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
          Length = 238

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IV+D E   +L R  +E  GY   +  +G  AL+ A      +I++D+ L  + G+E
Sbjct: 7   RILIVDDEERIRRLLRMYLEKEGYEIEEAEDGEIALQKATASDYSIILLDVMLPGMDGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++    +  PVI +TA   + +  +  + G + Y+ KP S    +  +K  +  +
Sbjct: 67  VCTRLRQ---TKSTPVIMLTAKGEEVNRVQGFEVGADDYVVKPFSPREVIYRVKAILRRS 123


>gi|170757153|ref|YP_001780676.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
 gi|169122365|gb|ACA46201.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
          Length = 233

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K  K+++V+D E  + + +  +E   Y  +   +G EA++L ++    +II+D+ L +
Sbjct: 1   MKKLFKILVVDDEERILDVVKAYLEKEDYEVITAMDGEEAIKLFKETSFHLIILDLMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           +SG E+  +I+E S    +P+I +TA   + D+      G + Y++KP S+   +  +K 
Sbjct: 61  LSGEEVCSKIRESS---NVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRKLVARVKA 117

Query: 119 YIGEA 123
            I  A
Sbjct: 118 LIRRA 122


>gi|75908099|ref|YP_322395.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|75701824|gb|ABA21500.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 242

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKSDPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|224823455|ref|ZP_03696564.1| two component transcriptional regulator PhoB, winged helix family
           [Lutiella nitroferrum 2002]
 gi|224603910|gb|EEG10084.1| two component transcriptional regulator PhoB, winged helix family
           [Lutiella nitroferrum 2002]
          Length = 229

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+      AL L +   PD++++D  L   S
Sbjct: 1   MPANILLVEDEPAIQELIAFNLTQAGHHVLRASTAEAALMLVKNALPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K+++ D   +++P+I +TA + + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GIDIAKRLRADERTRQVPIIMLTARSDEQDKIVGLETGADDYITKPFSPRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|154505270|ref|ZP_02042008.1| hypothetical protein RUMGNA_02784 [Ruminococcus gnavus ATCC 29149]
 gi|153794468|gb|EDN76888.1| hypothetical protein RUMGNA_02784 [Ruminococcus gnavus ATCC 29149]
          Length = 230

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E    L RD +E SG+      +G   L  A + + D+II+D+ L  + 
Sbjct: 1   MSKRILIVEDEESIADLERDYLELSGFQVEVANDGETGLNKAMKEEFDLIILDLMLPGVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G EI ++++     +  P+I V+A     D+ R    G + Y++KP S S  +  +K ++
Sbjct: 61  GFEICREVRSQ---KNTPIIMVSAKKDDIDKIRGLGLGADDYMTKPFSPSELVARVKAHL 117

Query: 121 GE 122
             
Sbjct: 118 SR 119


>gi|293603146|ref|ZP_06685580.1| phosphate regulon response regulator [Achromobacter piechaudii ATCC
           43553]
 gi|292818540|gb|EFF77587.1| phosphate regulon response regulator [Achromobacter piechaudii ATCC
           43553]
          Length = 232

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 61/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAELPDLILLDWMLPGTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + ++++ D   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLAMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|311032627|ref|ZP_07710717.1| two-component response regulator [Bacillus sp. m3-13]
          Length = 227

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D     ++    ++   Y  L   NG EAL++   H+ D+II+D+ + ++ G   
Sbjct: 7   VLVVDDEAEMREMLGMYLQKENYQVLHAENGEEALDMLYDHEVDLIILDVMMPDMDGFTA 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            K+I+E      +P++ +TA + + D+ R  K G + Y+ KP S    +  ++  +  +
Sbjct: 67  CKKIREKYM---MPILMLTAKSDELDKVRGLKLGADDYVMKPFSPKELLARVEALLRRS 122


>gi|160934780|ref|ZP_02082166.1| hypothetical protein CLOLEP_03655 [Clostridium leptum DSM 753]
 gi|156866233|gb|EDO59605.1| hypothetical protein CLOLEP_03655 [Clostridium leptum DSM 753]
          Length = 229

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 66/119 (55%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+M+V+D++   +L R  +E  GY  +   +G EA+EL  +  P++I++DI L ++ G +
Sbjct: 5   KIMVVDDDKNICELLRLYLEKEGYQVVIANDGKEAVELNEKEDPELILLDIMLPQLDGWQ 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++ S+   +P+I +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 65  VCREIRKKSQ---VPIIMLTAKGEVFDKVLGLELGADDYIVKPFETKEVVARIKAVLRR 120


>gi|205375565|ref|ZP_03228353.1| YycF [Bacillus coahuilensis m4-4]
          Length = 236

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY      +G EA+++A + +PD+I++DI L +  
Sbjct: 1   MDKKILVVDDEKPIADILQFNLKKEGYTVYCAYDGEEAIKMAEEVQPDMILLDIMLPKRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++  E   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCRELRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|56965856|ref|YP_177590.1| two-component response regulator [Bacillus clausii KSM-K16]
 gi|56912102|dbj|BAD66630.1| two-component response regulator [Bacillus clausii KSM-K16]
          Length = 236

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++V+D +    + +  +E  G+      +G EALE  ++ KPD++++DI L    
Sbjct: 1   MDKHILVVDDEKSIADILKFNLEKEGFDVTCAYDGNEALERVKERKPDLMLLDIMLPYKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y+ KP S    +  +K  +
Sbjct: 61  GMEVCREVRKQ---YDLPIIMLTAKDSEIDKVLGLELGADDYVIKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|23100907|ref|NP_694374.1| two-component response regulator [Oceanobacillus iheyensis HTE831]
 gi|22779141|dbj|BAC15408.1| two-component response regulator [Oceanobacillus iheyensis HTE831]
          Length = 233

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +    + +  +E  GY  +   +G  A+ELA   KP++I++DI L    
Sbjct: 1   MSQKILVVDDEQPIADILQFNLEKEGYQVVVANDGDTAIELAESEKPNLILLDIMLPGKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +++++    Q IPVI +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GNEVLREVRK---TQNIPVIMLTAKDAEIDKVLGLELGADDYVTKPFSNRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|15924683|ref|NP_372217.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927271|ref|NP_374804.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus N315]
 gi|57650564|ref|YP_186577.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87162022|ref|YP_494334.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88195500|ref|YP_500304.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148268173|ref|YP_001247116.1| two component transcriptional regulator [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150394240|ref|YP_001316915.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151221798|ref|YP_001332620.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156980010|ref|YP_001442269.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509907|ref|YP_001575566.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|221142557|ref|ZP_03567050.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus str. JKD6009]
 gi|253317163|ref|ZP_04840376.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|253732344|ref|ZP_04866509.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734523|ref|ZP_04868688.1| response regulator [Staphylococcus aureus subsp. aureus TCH130]
 gi|255006477|ref|ZP_05145078.2| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257794078|ref|ZP_05643057.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A9781]
 gi|258415782|ref|ZP_05682053.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A9763]
 gi|258421981|ref|ZP_05684901.1| response regulator receiver [Staphylococcus aureus A9719]
 gi|258438261|ref|ZP_05689545.1| response regulator receiver [Staphylococcus aureus A9299]
 gi|258443719|ref|ZP_05692058.1| response regulator receiver [Staphylococcus aureus A8115]
 gi|258445930|ref|ZP_05694106.1| response regulator [Staphylococcus aureus A6300]
 gi|258448389|ref|ZP_05696506.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A6224]
 gi|258451793|ref|ZP_05699815.1| two component transcriptional regulator [Staphylococcus aureus
           A5948]
 gi|258454130|ref|ZP_05702101.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A5937]
 gi|262048663|ref|ZP_06021546.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus D30]
 gi|262052264|ref|ZP_06024469.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus 930918-3]
 gi|269203311|ref|YP_003282580.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282893188|ref|ZP_06301422.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus A8117]
 gi|282920233|ref|ZP_06327958.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A9765]
 gi|282927823|ref|ZP_06335434.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus A10102]
 gi|284024741|ref|ZP_06379139.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 132]
 gi|294848714|ref|ZP_06789460.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A9754]
 gi|295406003|ref|ZP_06815811.1| two-component system [Staphylococcus aureus A8819]
 gi|296274880|ref|ZP_06857387.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MR1]
 gi|297245071|ref|ZP_06928948.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A8796]
 gi|304380716|ref|ZP_07363385.1| response regulator [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|13701489|dbj|BAB42783.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus N315]
 gi|14247465|dbj|BAB57855.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|57284750|gb|AAW36844.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus COL]
 gi|87127996|gb|ABD22510.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203058|gb|ABD30868.1| two-component response regulator, putative [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|147741242|gb|ABQ49540.1| two component transcriptional regulator, winged helix family
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946692|gb|ABR52628.1| response regulator receiver [Staphylococcus aureus subsp. aureus
           JH1]
 gi|150374598|dbj|BAF67858.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156722145|dbj|BAF78562.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368716|gb|ABX29687.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253723866|gb|EES92595.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727464|gb|EES96193.1| response regulator [Staphylococcus aureus subsp. aureus TCH130]
 gi|257788050|gb|EEV26390.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A9781]
 gi|257839375|gb|EEV63848.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A9763]
 gi|257842025|gb|EEV66454.1| response regulator receiver [Staphylococcus aureus A9719]
 gi|257848305|gb|EEV72296.1| response regulator receiver [Staphylococcus aureus A9299]
 gi|257851125|gb|EEV75068.1| response regulator receiver [Staphylococcus aureus A8115]
 gi|257855172|gb|EEV78111.1| response regulator [Staphylococcus aureus A6300]
 gi|257858357|gb|EEV81242.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A6224]
 gi|257860505|gb|EEV83331.1| two component transcriptional regulator [Staphylococcus aureus
           A5948]
 gi|257863582|gb|EEV86339.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus A5937]
 gi|259159865|gb|EEW44904.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus 930918-3]
 gi|259163310|gb|EEW47869.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus D30]
 gi|262075601|gb|ACY11574.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|269941173|emb|CBI49560.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus TW20]
 gi|282590333|gb|EFB95412.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus A10102]
 gi|282594581|gb|EFB99566.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A9765]
 gi|282764506|gb|EFC04632.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus A8117]
 gi|285817376|gb|ADC37863.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus 04-02981]
 gi|294824740|gb|EFG41163.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A9754]
 gi|294969000|gb|EFG45021.1| two-component system [Staphylococcus aureus A8819]
 gi|297178151|gb|EFH37399.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus A8796]
 gi|302751519|gb|ADL65696.1| response regulator OmpR [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304340715|gb|EFM06646.1| response regulator [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312830071|emb|CBX34913.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315130673|gb|EFT86659.1| response regulator [Staphylococcus aureus subsp. aureus CGS03]
 gi|315198610|gb|EFU28938.1| response regulator [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140428|gb|EFW32282.1| response regulator receiver domain protein [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143967|gb|EFW35736.1| response regulator receiver domain protein [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|329314365|gb|AEB88778.1| Two component transcriptional regulator, winged helix family
           [Staphylococcus aureus subsp. aureus T0131]
 gi|329727125|gb|EGG63581.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus 21172]
 gi|329728426|gb|EGG64863.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus 21189]
 gi|329733213|gb|EGG69550.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus 21193]
          Length = 234

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D    + L +  +ET+GY  +   +G EALE     +PD+II+D+ L +  
Sbjct: 1   MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVESEQPDLIILDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K ++ +  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIDVCKTVRTNKNL--VPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|239995182|ref|ZP_04715706.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           ATCC 27126]
          Length = 229

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + V++VED     ++ + ++E SG+  ++  +   A E   +  PD+I++D  L   S
Sbjct: 1   MSRTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDFDIAQEKICEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +K+    ++IPVI +TA   + D+ R    G + Y++KP S    +  IK  +
Sbjct: 61  GVQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|154686557|ref|YP_001421718.1| hypothetical protein RBAM_021260 [Bacillus amyloliquefaciens FZB42]
 gi|308174102|ref|YP_003920807.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|154352408|gb|ABS74487.1| ResD [Bacillus amyloliquefaciens FZB42]
 gi|307606966|emb|CBI43337.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|328552769|gb|AEB23261.1| two-component response regulator [Bacillus amyloliquefaciens TA208]
 gi|328912433|gb|AEB64029.1| Transcriptional regulatory protein resD [Bacillus amyloliquefaciens
           LL3]
          Length = 240

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L R  +E   Y+  +  NG EA+++      D++++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLRMYLERENYVIEEAENGDEAIKMGLASDYDLVLLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +Q++E    +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 68  VCRQLREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRA 124


>gi|270292778|ref|ZP_06198989.1| DNA-binding response regulator VicR [Streptococcus sp. M143]
 gi|270278757|gb|EFA24603.1| DNA-binding response regulator VicR [Streptococcus sp. M143]
          Length = 235

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 1   MKKILVVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|318604580|emb|CBY26078.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 279

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 51  MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPYPDLVLLDWMLPGGS 110

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 111 GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 170

Query: 121 GE 122
             
Sbjct: 171 RR 172


>gi|282896672|ref|ZP_06304680.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
 gi|282900162|ref|ZP_06308118.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
 gi|281194911|gb|EFA69852.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
 gi|281198390|gb|EFA73278.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
          Length = 247

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 64/122 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQLQPDLILLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             I ++++ D    EIPV+ +TA      +      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTICQRLRRDERTAEIPVLMLTALNQTQYKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|171911993|ref|ZP_02927463.1| two component transcriptional regulator, winged helix family
           protein [Verrucomicrobium spinosum DSM 4136]
          Length = 235

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 2/125 (1%)

Query: 1   MLKK--VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M  K  ++I +D E   +L    +  +GY  ++  +G++ L   R+ KPD I++D+ +  
Sbjct: 1   MSDKSLILIADDEEDVRELVGMNLRRAGYDTVEAADGLQTLAQVRRRKPDAIVLDVMMPG 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
             G  + ++++ED   + IPVI +TA     D     + G + Y+SKP S    +  ++ 
Sbjct: 61  RDGFGVCQELREDESTRHIPVIMLTAKGQTQDRIAGLERGADDYLSKPFSPKELVLRVQA 120

Query: 119 YIGEA 123
            +  A
Sbjct: 121 LLRRA 125


>gi|332707455|ref|ZP_08427504.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
 gi|332353806|gb|EGJ33297.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
          Length = 236

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 66/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D++  + L +  +E  GY   Q  +G EALE   ++ PD+++ D+ + E+ G
Sbjct: 1   MKKILVVDDDKTLLTLLKRYLEHRGYQVEQVCSGTEALEACVKNPPDLVVSDVLMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE  ++++     + +P I +++ A   D       G + Y++KP++       I+  + 
Sbjct: 61  LEFCRRLRNIPNGRLMPFIFLSSKAELEDRINGHSMGADDYLTKPVAPRELEAKIEALLE 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|159030857|emb|CAO88536.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 246

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY      +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILVIDDDPAIAELVSINLEMAGYDVNPAEDGIKGQALAVQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTSDIPILMMTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|172038915|ref|YP_001805416.1| two-component response regulator [Cyanothece sp. ATCC 51142]
 gi|171700369|gb|ACB53350.1| two-component response regulator [Cyanothece sp. ATCC 51142]
          Length = 243

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL++  +  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIFHEAVPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|219850003|ref|YP_002464436.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
 gi|219544262|gb|ACL26000.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
          Length = 1352

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 74/119 (62%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
              +V++ EDNE+N+ +  + ++  GY     RNG EAL++A + +PD+IIMDIQ+ E+ G
Sbjct: 1227 SARVLVAEDNEMNLMVLSEYLQAYGYEVCVARNGREALQVAAEWRPDLIIMDIQMPELDG 1286

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            LE  +Q++  +     P+IAVTA AM GD E+    G   Y++KPISL      I++ +
Sbjct: 1287 LEAIRQLRAQAAYATTPIIAVTALAMPGDREQCLLAGATDYLTKPISLRRLARHIERLL 1345



 Score = 91.3 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 3/114 (2%)

Query: 6    MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
            +I+E + +  +     +       +    G  A+E     +PD+I++ +++ + SG EI 
Sbjct: 1100 LIIESSAVVAEQLARYLAEQNIQPVVWLYGNGAVEQVAAMRPDLIVLSVEIPDRSGWEIL 1159

Query: 66   KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              ++ D EL+ IPVI V+        ER    G  AY+ KPI+ ++  + + + 
Sbjct: 1160 ADLQRDPELRRIPVIVVSVVDEP---ERGFTAGAAAYLVKPINRAMLQQALSQI 1210


>gi|116670002|ref|YP_830935.1| two component transcriptional regulator [Arthrobacter sp. FB24]
 gi|116610111|gb|ABK02835.1| two component transcriptional regulator, winged helix family
           [Arthrobacter sp. FB24]
          Length = 247

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++VED +    + RD +  +G+      +G  AL LA +  PD++++D  L  + G+
Sbjct: 16  RRILLVEDEQTIAGVVRDYLVQAGFQVDLAADGFTALRLAAERHPDLVLLDRMLPGLDGV 75

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++      +PVI +TA   + D     + G + YI+KP S    +  ++  +  
Sbjct: 76  EVCRRLRQ---TMSVPVIMLTALGTEDDRILGLEVGADDYITKPFSPRELVLRVRSVLRR 132

Query: 123 A 123
           +
Sbjct: 133 S 133


>gi|226310588|ref|YP_002770482.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093536|dbj|BAH41978.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 239

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%), Gaps = 4/123 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQ-HKPDVIIMDIQLQEI 59
           M   ++IV+DN   ++L  D++E  G+      +G +AL L  Q  +P++I++DI +  +
Sbjct: 1   MKDHILIVDDNLEIIELLEDILENEGFSVSSAESGEDALSLLSQGERPNLILLDIMMPNM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SG E+  QI+ +    ++P++ ++A     D+    + G + YI+KP      +  I+ +
Sbjct: 61  SGYELCSQIRREW---DLPILFLSAKGKAVDKVVGFEIGADDYITKPFDTEELLARIRAH 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|261856844|ref|YP_003264127.1| PhoB family transcriptional regulator [Halothiobacillus
           neapolitanus c2]
 gi|261837313|gb|ACX97080.1| two component transcriptional regulator PhoB, winged helix family
           [Halothiobacillus neapolitanus c2]
          Length = 230

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 63/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IVED +   ++    +  +GY  ++  +  EA E      PD++++D  L   SG+
Sbjct: 4   KTILIVEDEKPIREMVTFALGRAGYDLIEASDVSEAFEQLSHKLPDLVLLDWMLPGASGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E  +++K D   +++P++ +TA   + D+    + G + YI+KP S    M  IK  +  
Sbjct: 64  EFARRMKRDEITRDVPIVMLTARGEEEDKVSGLEAGADDYITKPFSPRELMARIKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|328555724|gb|AEB26216.1| Transcriptional regulatory protein WalR [Bacillus amyloliquefaciens
           TA208]
          Length = 235

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L    
Sbjct: 1   MDKKILVVDDEKPIADILEFNLRKEGYDVHCAYDGNEAVEMVEELQPDLILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|284929471|ref|YP_003421993.1| winged helix family two component transcriptional regulator
           [cyanobacterium UCYN-A]
 gi|284809915|gb|ADB95612.1| two component transcriptional regulator, winged helix family
           [cyanobacterium UCYN-A]
          Length = 243

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE+     PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEIFYDSVPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|227364325|ref|ZP_03848418.1| DNA-binding response regulator [Lactobacillus reuteri MM2-3]
 gi|227543739|ref|ZP_03973788.1| DNA-binding response regulator [Lactobacillus reuteri CF48-3A]
 gi|300908804|ref|ZP_07126267.1| response regulator [Lactobacillus reuteri SD2112]
 gi|325683524|ref|ZP_08163040.1| DNA-binding response regulator [Lactobacillus reuteri MM4-1A]
 gi|227070638|gb|EEI08968.1| DNA-binding response regulator [Lactobacillus reuteri MM2-3]
 gi|227186307|gb|EEI66378.1| DNA-binding response regulator [Lactobacillus reuteri CF48-3A]
 gi|300894211|gb|EFK87569.1| response regulator [Lactobacillus reuteri SD2112]
 gi|324977874|gb|EGC14825.1| DNA-binding response regulator [Lactobacillus reuteri MM4-1A]
          Length = 241

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY  +   +G  ALE      PD+II+D+ L +I 
Sbjct: 7   MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAYDGEAALEQVEAENPDLIILDLMLPKID 66

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++       +P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 67  GLEVAKRVRAK---HTMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 123

Query: 121 GE 122
             
Sbjct: 124 RR 125


>gi|154688139|ref|YP_001423300.1| YycF [Bacillus amyloliquefaciens FZB42]
 gi|308175750|ref|YP_003922455.1| transcriptional regulatory protein WalR [Bacillus amyloliquefaciens
           DSM 7]
 gi|154353990|gb|ABS76069.1| YycF [Bacillus amyloliquefaciens FZB42]
 gi|307608614|emb|CBI44985.1| Transcriptional regulatory protein WalR [Bacillus amyloliquefaciens
           DSM 7]
 gi|328914110|gb|AEB65706.1| Transcriptional regulatory protein yycF [Bacillus amyloliquefaciens
           LL3]
          Length = 236

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 66/123 (53%), Gaps = 4/123 (3%)

Query: 1   ML-KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+ KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L   
Sbjct: 1   MMDKKILVVDDEKPIADILEFNLRKEGYDVHCAYDGNEAVEMVEELQPDLILLDIMLPNK 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  
Sbjct: 61  DGVEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|82751281|ref|YP_417022.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus RF122]
 gi|258424109|ref|ZP_05686991.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus A9635]
 gi|282916953|ref|ZP_06324711.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus D139]
 gi|283770757|ref|ZP_06343649.1| two-component system OmpR family alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus H19]
 gi|82656812|emb|CAI81241.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus RF122]
 gi|257845730|gb|EEV69762.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus A9635]
 gi|282319440|gb|EFB49792.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus D139]
 gi|283460904|gb|EFC07994.1| two-component system OmpR family alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus H19]
 gi|298694963|gb|ADI98185.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus ED133]
 gi|302333358|gb|ADL23551.1| response regulator OmpR [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|323440763|gb|EGA98472.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus O11]
 gi|323442918|gb|EGB00541.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus O46]
          Length = 234

 Score =  169 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D    + L +  +ET+GY  +   +G EALE     +PD+II+D+ L +  
Sbjct: 1   MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVENEQPDLIILDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K ++ +  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIDVCKTVRTNKNL--VPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|89895322|ref|YP_518809.1| hypothetical protein DSY2576 [Desulfitobacterium hafniense Y51]
 gi|89334770|dbj|BAE84365.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 230

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++++D E    L R  +E  GY   +  NG EALE  ++    ++I+D+ + EI G ++
Sbjct: 4   ILVIDDEERIRHLVRMYLEREGYEVDEAGNGREALEKFQKQDYALLIVDLMMPEIDGWKV 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            + ++E S   +IP+I +TA   + D     + G + Y+ KP S    +  +K  +  +
Sbjct: 64  CRDVRERS---DIPIIMLTARGEEFDRVLGFELGADDYLVKPFSTKELVARVKALLRRS 119


>gi|219669756|ref|YP_002460191.1| transcriptional regulator [Desulfitobacterium hafniense DCB-2]
 gi|219540016|gb|ACL21755.1| two component transcriptional regulator, winged helix family
           [Desulfitobacterium hafniense DCB-2]
          Length = 230

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++++D E    L R  +E  GY   +  NG EALE  ++    ++I+D+ + EI G ++
Sbjct: 4   ILVIDDEERIRHLVRMYLEREGYEVDEAGNGREALEKFQKQDYALLIVDLMMPEIDGWKV 63

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            + ++E S   +IP+I +TA   + D     + G + Y+ KP S    +  +K  +  +
Sbjct: 64  CRDVRERS---DIPIIMLTARGEEFDRVLGFELGADDYLVKPFSTKELVARVKALLRRS 119


>gi|95930319|ref|ZP_01313056.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133571|gb|EAT15233.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans
           DSM 684]
          Length = 1152

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 67/121 (55%), Gaps = 2/121 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D  +N+++  + +  + Y      +G +AL+L  +  PD+I++DI +  ++G E+
Sbjct: 719 ILVVDDEPVNLQVLVNQLHVARYRVRIANSGQQALDLVEEETPDLILLDIMMPHMTGYEV 778

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK--YIGE 122
            ++++      ++PVI +TA +   D  +  + G   Y++KP S  I +  ++    +G 
Sbjct: 779 CQRLRRTYNAAQLPVIMLTARSRVSDVVQGFQAGANDYVAKPFSRDILLARVRTQLQLGR 838

Query: 123 A 123
           A
Sbjct: 839 A 839


>gi|291551175|emb|CBL27437.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus torques
           L2-14]
          Length = 230

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IVED E    L +D +E SG+      +G   L+   + + D+II+D+ L  + 
Sbjct: 1   MSKRILIVEDEESIADLEKDYLELSGFEVEVANDGEIGLKKGLEGEFDLIILDLMLPGVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G EI +QI+     +  P+I V+A     D+ R    G + Y++KP S S  +  +K ++
Sbjct: 61  GFEICRQIRSQ---KNTPIIMVSAKKDDIDKIRGLGLGADDYMTKPFSPSELVARVKAHL 117

Query: 121 GE 122
             
Sbjct: 118 AR 119


>gi|323340909|ref|ZP_08081158.1| DNA-binding response regulator [Lactobacillus ruminis ATCC 25644]
 gi|323091571|gb|EFZ34194.1| DNA-binding response regulator [Lactobacillus ruminis ATCC 25644]
          Length = 235

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY      +G EAL+   +  PD+II+D+ L +I G
Sbjct: 1   MKKILVVDDEKPISDIIKFNLTKEGYDVHTAYDGEEALKQVEEVSPDLIILDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---THDMPIIMVTAKDAEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|85713650|ref|ZP_01044640.1| phosphate regulon transcriptional regulatory protein phoB
           [Nitrobacter sp. Nb-311A]
 gi|85699554|gb|EAQ37421.1| phosphate regulon transcriptional regulatory protein phoB
           [Nitrobacter sp. Nb-311A]
          Length = 234

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +E +GY       G EA    ++  PD++I+D  L  +S
Sbjct: 1   MGARILVVEDEEALTTLLRYNLEAAGYEVETVARGDEADTGLKERIPDLLILDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +E+P+I +TA   + +  R    G + Y+ KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKELPIIMLTARGEESERVRGLATGADDYVVKPFSVPELLARVKSLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|158338202|ref|YP_001519379.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158308443|gb|ABW30060.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
          Length = 249

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D     ++    +   GY  +   +G+EALE     KPD+I++D+ +  ++GL+
Sbjct: 6   KILIVDDEATIRRILATRLSMVGYEIVVAADGVEALEQFEAEKPDLIVLDVMMPRMNGLQ 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + ++E +    +P+I +TA     D  +  + G + Y+ KP S       I+  +  
Sbjct: 66  VCQTLRESTG---VPIIMLTALGEVSDRIKGLELGADDYLPKPFSPKELESRIQAILRR 121


>gi|253575382|ref|ZP_04852720.1| multi-component transcriptional regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251845379|gb|EES73389.1| multi-component transcriptional regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 248

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D      L R  +   G+   +  NG EALE+A  H  D+I++D+ L ++ G ++
Sbjct: 16  VLVVDDEWNMRNLLRIYLTREGFEVKEATNGNEALEMAANHHFDIILLDLMLPDMDGWQV 75

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            K+I+E      + ++ +TA +   D+      G + Y++KP      +  +   I  +
Sbjct: 76  CKKIREKD---HVAILMLTARSETKDKVYGLGIGADDYLTKPFEPEELLARVYSLIRRS 131


>gi|206891156|ref|YP_002249147.1| two-component hybrid sensor and regulator [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206743094|gb|ACI22151.1| two-component hybrid sensor and regulator [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 356

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 63/120 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+DN   ++L R  ++  GY   +  +G EAL+   +  PD+II+D+ + ++ G 
Sbjct: 6   QTILIVDDNIDTVELLRKRLKAEGYNTEEAYDGEEALKKVYEVYPDLIILDVMMPKMDGY 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D   + IP+I +TA +    + +    G + Y+ KP         ++  I  
Sbjct: 66  EVCQRLKTDDRTKFIPIIMLTAKSDVESKVKGFDIGADDYVPKPFDYRELSARVRSLITR 125


>gi|94499897|ref|ZP_01306433.1| two-component response regulator PhoB [Oceanobacter sp. RED65]
 gi|94428098|gb|EAT13072.1| two-component response regulator PhoB [Oceanobacter sp. RED65]
          Length = 232

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 62/120 (51%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK++IV+D     ++    +E +GY  ++  N  +A  L     P++I++D  L   SGL
Sbjct: 6   KKILIVDDEASIREMIAVALEMAGYECIEASNTQDAYSLIIDEHPEMILLDWMLPGTSGL 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E  +++K D    E+P+I +TA   + ++    + G + YI+KP S    +  +K  +  
Sbjct: 66  EFARRLKRDDRTNEVPIIMLTAKGEEDNKVLGLEAGADDYITKPFSPRELVARLKAVLRR 125


>gi|260776661|ref|ZP_05885556.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607884|gb|EEX34149.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|261406013|ref|YP_003242254.1| winged helix family two component transcriptional regulator
           [Paenibacillus sp. Y412MC10]
 gi|329929811|ref|ZP_08283487.1| transcriptional regulatory protein ResD [Paenibacillus sp. HGF5]
 gi|261282476|gb|ACX64447.1| two component transcriptional regulator, winged helix family
           [Paenibacillus sp. Y412MC10]
 gi|328935789|gb|EGG32250.1| transcriptional regulatory protein ResD [Paenibacillus sp. HGF5]
          Length = 238

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D E   +L +  +E  GY   +  +G  AL  A      ++I+D+ L  + G+E
Sbjct: 7   RILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRKASSEDYGLVILDVMLPGMDGVE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++   ++  P++ +TA   + +  +  + G + Y+ KP S    +  +K  +  +
Sbjct: 67  VCTRLRQ---VKSTPILMLTAKGEEINRVQGFEVGADDYVVKPFSPREVIYRVKAILRRS 123


>gi|194467421|ref|ZP_03073408.1| two component transcriptional regulator, winged helix family
           [Lactobacillus reuteri 100-23]
 gi|194454457|gb|EDX43354.1| two component transcriptional regulator, winged helix family
           [Lactobacillus reuteri 100-23]
          Length = 235

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY  +   +G  ALE      PD+II+D+ L +I 
Sbjct: 1   MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAYDGEVALEQVEAENPDLIILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K+++       +P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAKRVRAK---HTMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|46810476|gb|AAT01619.1| PhoB [Pseudomonas stutzeri]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 64/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IV+D     ++    +E +GY  L+  N  +A  L    KPD+I++D  L   SG+
Sbjct: 4   KSILIVDDEAPIREMIVVALEMAGYDCLEAENTQQAHALIIDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    + P+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTADTPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|315127525|ref|YP_004069528.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
 gi|315016039|gb|ADT69377.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D     ++   ++E +G+ A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMVEPYPDMVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K+ K++   ++IP+I +TA   + D+ R  + G + Y++KP S    M  IK  I
Sbjct: 61  GIQIAKKFKQNEHTRQIPIIMLTARGEEEDKIRGLEVGADDYVTKPFSPKELMARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|257865288|ref|ZP_05644941.1| transcriptional regulator [Enterococcus casseliflavus EC30]
 gi|257871616|ref|ZP_05651269.1| transcriptional regulator [Enterococcus casseliflavus EC10]
 gi|257874888|ref|ZP_05654541.1| transcriptional regulator [Enterococcus casseliflavus EC20]
 gi|325571477|ref|ZP_08146977.1| DNA-binding response regulator [Enterococcus casseliflavus ATCC
           12755]
 gi|257799222|gb|EEV28274.1| transcriptional regulator [Enterococcus casseliflavus EC30]
 gi|257805780|gb|EEV34602.1| transcriptional regulator [Enterococcus casseliflavus EC10]
 gi|257809054|gb|EEV37874.1| transcriptional regulator [Enterococcus casseliflavus EC20]
 gi|325155953|gb|EGC68149.1| DNA-binding response regulator [Enterococcus casseliflavus ATCC
           12755]
          Length = 237

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +    + +  +   GY      +G EALE   +  PD+I++D+ L ++ GL
Sbjct: 5   KKILVVDDEKPISDIVKFNLTKEGYEVYTAYDGEEALEKVAEVDPDLILLDLMLPKMDGL 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 65  EVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 121


>gi|125974309|ref|YP_001038219.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum ATCC 27405]
 gi|256003472|ref|ZP_05428462.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 2360]
 gi|281418364|ref|ZP_06249384.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum JW20]
 gi|125714534|gb|ABN53026.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum ATCC 27405]
 gi|255992496|gb|EEU02588.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 2360]
 gi|281409766|gb|EFB40024.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum JW20]
 gi|316941457|gb|ADU75491.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 1313]
          Length = 310

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 67/120 (55%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++++D E   KL  D++   GY  +   NG + +E+ R  KPD++++D+ + ++ G 
Sbjct: 4   KKILVIDDTEFMTKLISDVLMNEGYEVVTASNGRQGIEMVRIEKPDLVLLDVVMPDMDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ + ++ED     +P+I +TA   + D+    + G + YI+KP +    +  ++  +  
Sbjct: 64  EVCRILREDEGNNLMPIIMLTAQDNEDDKLTGLELGADDYITKPFNTRELVSRVRNTLRR 123


>gi|297583655|ref|YP_003699435.1| winged helix family two component transcriptional regulator
           [Bacillus selenitireducens MLS10]
 gi|297142112|gb|ADH98869.1| two component transcriptional regulator, winged helix family
           [Bacillus selenitireducens MLS10]
          Length = 238

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++IV+D E  + L +  ++ +G+  +   +G  A +LA     D+I++D+ L E+ 
Sbjct: 1   MTQRILIVDDEESILTLLQYNLDQAGFETVTAEDGKTAYDLAADDSFDLIVLDLMLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ K +++       P++ +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GLEVCKSLRQLKV--STPILMLTAKDDEFDKVLGLELGADDYLTKPFSPREVVARVRAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|83588943|ref|YP_428952.1| two component transcriptional regulator [Moorella thermoacetica
           ATCC 39073]
 gi|83571857|gb|ABC18409.1| two component transcriptional regulator, winged helix family
           [Moorella thermoacetica ATCC 39073]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 67/124 (54%), Gaps = 5/124 (4%)

Query: 1   MLK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M+K  K+++V+D    ++L +  +E +G+  +   +G EAL+ A   KPD+II+D+ L +
Sbjct: 1   MIKLPKILVVDDEPAIVELVKFNLEQAGFTTITASDGAEALQKAEAEKPDLIILDVMLPK 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G E+ + ++       +P++ +TA   + D     + G + Y++KP S    +  ++ 
Sbjct: 61  VDGFEVCRSLRARG---SMPILMLTARREEVDRVLGLELGADDYLTKPFSPRELVARVRA 117

Query: 119 YIGE 122
            +  
Sbjct: 118 ILRR 121


>gi|260771433|ref|ZP_05880358.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           furnissii CIP 102972]
 gi|260613559|gb|EEX38753.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           furnissii CIP 102972]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|170077923|ref|YP_001734561.1| two-component response regulator [Synechococcus sp. PCC 7002]
 gi|169885592|gb|ACA99305.1| two-component response regulator [Synechococcus sp. PCC 7002]
          Length = 249

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 66/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I++D+    +L    +E +GY   +  +G++   LA Q +PD++++D+ L ++ G
Sbjct: 1   MPRILIIDDDPAIAELVAINLEMAGYDVSRAEDGIKGQALAVQLQPDLVMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++I+ +    +IP++ +TA     D+      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRIRREERTADIPILMLTALGQTQDKVDGFNAGADDYLTKPFEVEEMLVRVRALLR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|49483935|ref|YP_041159.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257425808|ref|ZP_05602232.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257428474|ref|ZP_05604872.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257431108|ref|ZP_05607485.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433791|ref|ZP_05610149.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257436707|ref|ZP_05612751.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus M876]
 gi|282904264|ref|ZP_06312152.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus C160]
 gi|282906089|ref|ZP_06313944.1| two-component system OmpR family alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909004|ref|ZP_06316822.1| phosphate regulon transcriptional regulatory protein PhoB
           [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282911320|ref|ZP_06319122.1| phosphate regulon transcriptional regulatory protein PhoB
           [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282914489|ref|ZP_06322275.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus M899]
 gi|282919458|ref|ZP_06327193.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus subsp. aureus C427]
 gi|282924835|ref|ZP_06332501.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus C101]
 gi|283958444|ref|ZP_06375895.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus A017934/97]
 gi|293503567|ref|ZP_06667414.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293510582|ref|ZP_06669287.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus subsp. aureus M809]
 gi|293537124|ref|ZP_06671804.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus M1015]
 gi|295428264|ref|ZP_06820893.1| two-component system [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297590773|ref|ZP_06949411.1| response regulator [Staphylococcus aureus subsp. aureus MN8]
 gi|49242064|emb|CAG40763.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257271502|gb|EEV03648.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275315|gb|EEV06802.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278056|gb|EEV08704.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281884|gb|EEV12021.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257284058|gb|EEV14181.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus M876]
 gi|282313201|gb|EFB43597.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus C101]
 gi|282317268|gb|EFB47642.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus subsp. aureus C427]
 gi|282321670|gb|EFB51995.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus M899]
 gi|282325015|gb|EFB55325.1| phosphate regulon transcriptional regulatory protein PhoB
           [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327268|gb|EFB57563.1| phosphate regulon transcriptional regulatory protein PhoB
           [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282331381|gb|EFB60895.1| two-component system OmpR family alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595882|gb|EFC00846.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus C160]
 gi|283470960|emb|CAQ50171.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Staphylococcus aureus subsp. aureus ST398]
 gi|283790593|gb|EFC29410.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus A017934/97]
 gi|290919969|gb|EFD97037.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus aureus subsp. aureus M1015]
 gi|291095233|gb|EFE25498.1| two-component system, OmpR family, alkaline phosphatase synthesis
           response regulator PhoP [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466473|gb|EFF08994.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Staphylococcus aureus subsp. aureus M809]
 gi|295127664|gb|EFG57301.1| two-component system [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297575659|gb|EFH94375.1| response regulator [Staphylococcus aureus subsp. aureus MN8]
 gi|312437849|gb|ADQ76920.1| response regulator [Staphylococcus aureus subsp. aureus TCH60]
 gi|315195597|gb|EFU25984.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus aureus subsp. aureus CGS00]
          Length = 233

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D    + L +  +ET+GY  +   +G EALE     +PD+II+D+ L +  
Sbjct: 1   MSQKVLVVDDEHSIVTLLKYNLETAGYEVVVAFDGDEALEKVENEQPDLIILDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K ++ +  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIDVCKTVRTNKNL--VPILMLTAKNDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|91203277|emb|CAJ72916.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 238

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 68/120 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++ +D   N+KL R ++    Y  ++  +G EAL  AR   PD+I++DI + +I+G
Sbjct: 1   MAKILVADDITQNVKLLRVILTAFKYEVIEAYDGEEALNKARTENPDLILLDIMMPKITG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+++ D   + IP+I +TA     D  +  + G + +ISKP + +  +  +K  + 
Sbjct: 61  YEVCKKLRADEATKNIPIIMITALHEMDDRIKGIEAGADDFISKPFNKTELLARVKSLLR 120


>gi|253990976|ref|YP_003042332.1| phosphate regulon transcriptional regulatory protein phob
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782426|emb|CAQ85590.1| phosphate regulon transcriptional regulatory protein phob
           [Photorhabdus asymbiotica]
          Length = 229

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  ++  +   AL    +  PD++++D  +   S
Sbjct: 1   MTRRILVVEDETPIREMVCFVLEKNGYQPVEAEDYDSALACLSEPYPDLVLLDWMIPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+I KQ+K D+ +++IPV+ +TA   + D  R  + G + YI+KP S    +  +K  +
Sbjct: 61  GLQIIKQMKRDNNVRDIPVMMLTARGEEEDRVRGLEIGADDYITKPFSPKELVARVKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|83859329|ref|ZP_00952850.1| phosphate regulon response regulator PhoB [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852776|gb|EAP90629.1| phosphate regulon response regulator PhoB [Oceanicaulis alexandrii
           HTCC2633]
          Length = 228

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VED +   +L    ++  G+      +G EA+ L  + +PDV+++D  L +IS
Sbjct: 1   MQPHVLVVEDEDALSELLSYNLKKEGFRVSLAADGEEAMMLVEERQPDVVVLDWMLPKIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E + +P+I +TA   + D  R    G + YI KP  +      ++  +
Sbjct: 61  GIEVCRRLRSRHETRNLPIIMLTARGEEADRIRGLDTGADDYIVKPFLMKELFARVRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|159027454|emb|CAO89419.1| ycf27 [Microcystis aeruginosa PCC 7806]
          Length = 246

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R  +PD++++D+ + ++ G  
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALETFRTAEPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|29830959|ref|NP_825593.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29608073|dbj|BAC72128.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 249

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +V++V+D+    ++    ++ +GY+  +  +G  AL  A  H PD++++D+ L  + GL
Sbjct: 21  ARVLVVDDDPTVAEVVSGYLDRAGYVVDRAEDGPTALARAAAHWPDLVVLDLMLPGMDGL 80

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 81  EVCRRMRGRGP---VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRR 137


>gi|319779219|ref|YP_004130132.1| Two-component system response regulator OmpR [Taylorella
           equigenitalis MCE9]
 gi|317109243|gb|ADU91989.1| Two-component system response regulator OmpR [Taylorella
           equigenitalis MCE9]
          Length = 247

 Score =  169 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D+    +L +  +   GY      +G E  +  ++   ++I++DI L    GL
Sbjct: 9   KKILVVDDDPRLRELLKKYLTEQGYTVTAVEDGKEMSKACQRENFNIIVLDIMLPGEDGL 68

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            I ++++  +++   P+I +TA +   D     + G + YI KP +    +  I   +  
Sbjct: 69  SICRRLRATNDM--TPIIMLTAKSEDIDRIIGLEMGADDYIVKPFNPRELLARINAVLRR 126


>gi|125973803|ref|YP_001037713.1| two component transcriptional regulator [Clostridium thermocellum
           ATCC 27405]
 gi|125714028|gb|ABN52520.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum ATCC 27405]
 gi|316940004|gb|ADU74038.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 1313]
          Length = 228

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++++D+    +L R  +E  G+  +   NG +ALE+ R   P+++I+DI L    G +
Sbjct: 6   KVLVIDDDVNICELIRLYMEKEGFEVVTVYNGSKALEVFRNEAPNIVILDIMLPGADGWQ 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   +  IPVI ++A     D+    + G + Y+ KP      +  +K  +  
Sbjct: 66  VCREIRK---ISNIPVIMLSAKGETFDKVLGLELGADDYLVKPFEPKELVARVKAVLRR 121


>gi|27363935|ref|NP_759463.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           vulnificus CMCP6]
 gi|37678907|ref|NP_933516.1| DNA-binding response regulator PhoB [Vibrio vulnificus YJ016]
 gi|320157317|ref|YP_004189696.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio vulnificus MO6-24/O]
 gi|27360052|gb|AAO08990.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           vulnificus CMCP6]
 gi|37197648|dbj|BAC93487.1| DNA-binding response regulator PhoB [Vibrio vulnificus YJ016]
 gi|319932629|gb|ADV87493.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio vulnificus MO6-24/O]
          Length = 229

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|307706668|ref|ZP_07643474.1| response regulator [Streptococcus mitis SK321]
 gi|307617912|gb|EFN97073.1| response regulator [Streptococcus mitis SK321]
          Length = 235

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQYEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|229825123|ref|ZP_04451192.1| hypothetical protein GCWU000182_00474 [Abiotrophia defectiva ATCC
           49176]
 gi|229790495|gb|EEP26609.1| hypothetical protein GCWU000182_00474 [Abiotrophia defectiva ATCC
           49176]
          Length = 229

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +L +K  R  +E  G       +G EALE+ +    D+I++D+ L +++
Sbjct: 1   MARKILVVDDEKLIVKGIRFGLEQDGMEVDAAYDGEEALEMVKSCAYDIILLDLMLPKMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +QI+E     ++P+I +TA     D+    + G + Y++KP ++      IK  +
Sbjct: 61  GFEVCQQIRE---FSDVPIIMLTAKGEDIDKIMGLEYGADDYMTKPFNILEVKARIKAIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|57235029|ref|YP_180885.1| DNA-binding response regulator [Dehalococcoides ethenogenes 195]
 gi|57225477|gb|AAW40534.1| DNA-binding response regulator [Dehalococcoides ethenogenes 195]
          Length = 230

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED+    +L    +   GY      +G++AL + R+ KP ++I+D+ L  + G E
Sbjct: 5   KILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALGMYRRFKPSLVILDVMLPGMDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + + I+ +S    +P++ +TA + + D+    + G + Y+SKP  +   +  ++  +  +
Sbjct: 65  LCRLIRAES---SVPILMLTARSSETDKVNGLEVGADDYLSKPFGMKELLARMRALLRRS 121


>gi|308233471|ref|ZP_07664208.1| two component transcriptional regulator, winged helix family
           protein [Atopobium vaginae DSM 15829]
 gi|328943477|ref|ZP_08240942.1| DNA-binding response regulator [Atopobium vaginae DSM 15829]
 gi|327491446|gb|EGF23220.1| DNA-binding response regulator [Atopobium vaginae DSM 15829]
          Length = 241

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VED +         +E  GY      +G  ALE   +H  D+II+D+ L ++SG 
Sbjct: 6   KRILLVEDEKTIRDAVAAYLEREGYFVRSVGDGQSALEEFEKHSFDLIILDLMLPKLSGE 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + + ++E      +P+I +TA     D     + G + Y+ KP S    +  ++  +  
Sbjct: 66  RVCRAVRE---TSNVPIIMLTAKGEVEDRIIGLELGADDYLIKPFSPRELVARVRALLRR 122

Query: 123 A 123
           A
Sbjct: 123 A 123


>gi|218896331|ref|YP_002444742.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|218540658|gb|ACK93052.1| DNA-binding response regulator [Bacillus cereus G9842]
          Length = 223

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|30019451|ref|NP_831082.1| two-component response regulator [Bacillus cereus ATCC 14579]
 gi|218236073|ref|YP_002366082.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|29894995|gb|AAP08283.1| Two-component response regulator [Bacillus cereus ATCC 14579]
 gi|218164030|gb|ACK64022.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|326939022|gb|AEA14918.1| two-component response regulator [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 223

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K +V++V+D     +L    ++  GY   +  NG EAL+       D +++DI + E+
Sbjct: 1   MNKYRVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|186685833|ref|YP_001869029.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186468285|gb|ACC84086.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 242

 Score =  169 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+ +PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKTEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|149181689|ref|ZP_01860182.1| ResD [Bacillus sp. SG-1]
 gi|148850667|gb|EDL64824.1| ResD [Bacillus sp. SG-1]
          Length = 238

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D +   KL R  +E   Y+  +  +G  ALELA  ++ D I++D+ +  + G+E
Sbjct: 6   KVLIVDDEDRIRKLLRMYLERENYVIEEAEDGESALELALNNEYDCILLDLMMPGMDGIE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + K++++    +  PVI +TA   + +  +  + G + YI KP S    +  +K  +  +
Sbjct: 66  VCKELRQK---KSTPVIMLTAKGEEANRVQGFEVGTDDYIVKPFSPREVVLRVKALLRRS 122


>gi|114566483|ref|YP_753637.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337418|gb|ABI68266.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 239

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+++V+D    ++L +  +E  GY      +G  ALE+ +   PD+I++DI L ++ GL
Sbjct: 4   AKILVVDDETHIVELVKFNLEKEGYRVAVAYDGQCALEMVKDAPPDLILLDIMLPQMDGL 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ + +K+ SE + IP+I +TA   + D     + G + YI KP S    +  +K  + 
Sbjct: 64  EVCRTLKQHSEYKTIPIIMLTAKGEEIDTILGLEMGADDYIKKPFSPREMVARVKARLR 122


>gi|115526874|ref|YP_783785.1| two component transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115520821|gb|ABJ08805.1| two component transcriptional regulator, winged helix family
           [Rhodopseudomonas palustris BisA53]
          Length = 234

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  ++  GY       G +A    ++  PD++++D  L  +S
Sbjct: 1   MSARILVVEDEEALSTLLRYNLDAEGYDVETVARGDDADTRLKERTPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|311897404|dbj|BAJ29812.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 249

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 62/122 (50%), Gaps = 4/122 (3%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D     +L    +  SG+       G EAL+     +PD++++D+ L ++ G  + 
Sbjct: 18  LVVDDEPNIRELLSASLRFSGFRVASAATGQEALDAVAAERPDLVVLDVMLPDLDGFTVV 77

Query: 66  KQIKEDSELQ----EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +++++ ++       +PV+ +TA    GD+ +    G + Y++KP SL   +  I+  + 
Sbjct: 78  RRLRDQTQWPQSPEHVPVLFLTAKDGTGDKVQGLAVGADDYVTKPFSLEELIARIRAILR 137

Query: 122 EA 123
            A
Sbjct: 138 RA 139


>gi|303232491|ref|ZP_07319179.1| putative Sensory transduction protein regX3 [Atopobium vaginae
           PB189-T1-4]
 gi|302481415|gb|EFL44487.1| putative Sensory transduction protein regX3 [Atopobium vaginae
           PB189-T1-4]
          Length = 240

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++VED +   +     +E  GY      +G  ALE   +H  D+II+D+ L ++SG 
Sbjct: 6   KRILLVEDEKTIREAVSAYLEREGYFVRGVGDGQNALEEFEKHSFDLIILDLMLPKLSGE 65

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + + ++E      +P+I +TA     D     + G + Y+ KP S    +  ++  +  
Sbjct: 66  RVCRAVRE---TSNVPIIMLTAKGEVEDRIIGLELGADDYLIKPFSPRELVARVRALLRR 122

Query: 123 A 123
           A
Sbjct: 123 A 123


>gi|157692813|ref|YP_001487275.1| response regulator [Bacillus pumilus SAFR-032]
 gi|157681571|gb|ABV62715.1| response regulator [Bacillus pumilus SAFR-032]
          Length = 240

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L +  +E   Y   +  NG EA++   Q   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLKMYLERENYEIDEAENGDEAIQKGLQSDYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  QI+   + +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  +
Sbjct: 68  VCNQIR---DKKATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRS 124


>gi|313112755|ref|ZP_07798403.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624954|gb|EFQ08261.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 331

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IV+D     +L R+ ++ SGYI  +  +G  AL        D++I+D+ +  + G
Sbjct: 104 MAKILIVDDEPRIRELIREHLQYSGYICEEAADGTAALTQLSGGAFDLVILDLMMPFMDG 163

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +   ++++        PVI +TA   + D+    + G + Y+ KP S    +  +K  + 
Sbjct: 164 MTCLREMRA--RHINTPVIILTARGEEYDKLAGLESGADDYVVKPFSPRELVARVKAVLN 221

Query: 122 E 122
            
Sbjct: 222 R 222


>gi|322375301|ref|ZP_08049814.1| DNA-binding response regulator VicR [Streptococcus sp. C300]
 gi|321279564|gb|EFX56604.1| DNA-binding response regulator VicR [Streptococcus sp. C300]
          Length = 235

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMAKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKAIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|226312004|ref|YP_002771898.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226094952|dbj|BAH43394.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 238

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++V+D E   +L +  +E   ++  +  NG +A+E+A     D+I++D+ L  + G
Sbjct: 4   MARILVVDDEERIRRLLKMYLERENFLIDEADNGEQAVEMAVGSDYDIILLDLMLPGMDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ ++++E    +  P+I +TA   + +     + G + Y+ KP S    M  +K  + 
Sbjct: 64  IEVCQRVRE---FKATPIIMLTAKGEETNRVHGFEAGVDDYVVKPFSPREVMYRVKAILR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|27468287|ref|NP_764924.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus epidermidis ATCC 12228]
 gi|57867182|ref|YP_188829.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis RP62A]
 gi|242242958|ref|ZP_04797403.1| response regulator [Staphylococcus epidermidis W23144]
 gi|251811087|ref|ZP_04825560.1| response regulator [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875886|ref|ZP_06284753.1| response regulator receiver domain protein [Staphylococcus
           epidermidis SK135]
 gi|293366360|ref|ZP_06613039.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis M23864:W2(grey)]
 gi|27315833|gb|AAO04968.1|AE016748_202 alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus epidermidis ATCC 12228]
 gi|57637840|gb|AAW54628.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis RP62A]
 gi|242233559|gb|EES35871.1| response regulator [Staphylococcus epidermidis W23144]
 gi|251805384|gb|EES58041.1| response regulator [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294911|gb|EFA87438.1| response regulator receiver domain protein [Staphylococcus
           epidermidis SK135]
 gi|291319485|gb|EFE59852.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis M23864:W2(grey)]
 gi|319401007|gb|EFV89226.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Staphylococcus epidermidis FRI909]
 gi|329724661|gb|EGG61167.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis VCU144]
 gi|329733744|gb|EGG70070.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis VCU045]
 gi|329737321|gb|EGG73575.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Staphylococcus epidermidis VCU028]
          Length = 236

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K+++V+D +  + L +  +ET+GYI     +G EAL+     +P++I++D+ L +  
Sbjct: 1   MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALKKVETEQPELIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|126658619|ref|ZP_01729765.1| two-component response regulator [Cyanothece sp. CCY0110]
 gi|126620056|gb|EAZ90779.1| two-component response regulator [Cyanothece sp. CCY0110]
          Length = 243

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL++  +  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIFHEAIPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|319651063|ref|ZP_08005197.1| DNA-binding response regulator [Bacillus sp. 2_A_57_CT2]
 gi|317397233|gb|EFV77937.1| DNA-binding response regulator [Bacillus sp. 2_A_57_CT2]
          Length = 236

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY  +   +G +AL+   + KPD+I++DI L +  
Sbjct: 1   MDKKILVVDDEKPIADILQFNLKKEGYEVVCAYDGNDALDKVEEIKPDLILLDIMLPQRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|218782319|ref|YP_002433637.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
 gi|218763703|gb|ACL06169.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 301

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 61/120 (50%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++++D+ L   + ++++   G+      NG E LE     KPD+I++D+ +  + G
Sbjct: 1   MANILVIDDSRLIAHVAKNMLTARGHEVTVATNGEEGLEAVATIKPDLILLDLIMPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++IK      +IPVI +T+ A   D+ R  + G   Y++KP      +  +  ++ 
Sbjct: 61  YAVCEKIKGSPATADIPVIMLTSKAETADKVRGLEAGASDYVTKPFEEGELVARVNTHLR 120


>gi|312884258|ref|ZP_07743967.1| response regulator [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368031|gb|EFP95574.1| response regulator [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|33591409|ref|NP_879053.1| phosphate regulon transcriptional regulatory protein [Bordetella
           pertussis Tohama I]
 gi|33603443|ref|NP_891003.1| phosphate regulon transcriptional regulatory protein [Bordetella
           bronchiseptica RB50]
 gi|33571051|emb|CAE40539.1| phosphate regulon transcriptional regulatory protein [Bordetella
           pertussis Tohama I]
 gi|33577567|emb|CAE34832.1| phosphate regulon transcriptional regulatory protein [Bordetella
           bronchiseptica RB50]
 gi|332380810|gb|AEE65657.1| phosphate regulon transcriptional regulatory protein [Bordetella
           pertussis CS]
          Length = 232

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L R   PD+I++D  L   S
Sbjct: 1   MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGAS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + ++++++   + +PVI +TA   + D+    + G + YI+KP S    M  IK  +
Sbjct: 61  GLSLARKLRDEERTRAVPVIMLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|293365512|ref|ZP_06612221.1| DNA-binding response regulator [Streptococcus oralis ATCC 35037]
 gi|307703470|ref|ZP_07640412.1| response regulator [Streptococcus oralis ATCC 35037]
 gi|291315880|gb|EFE56324.1| DNA-binding response regulator [Streptococcus oralis ATCC 35037]
 gi|307622877|gb|EFO01872.1| response regulator [Streptococcus oralis ATCC 35037]
          Length = 235

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMAKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKAIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|170077600|ref|YP_001734238.1| two-component DNA binding response regulator [Synechococcus sp. PCC
           7002]
 gi|169885269|gb|ACA98982.1| Two-component DNA binding response regulator [Synechococcus sp. PCC
           7002]
          Length = 242

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EAL    +  PD++++D+ + ++ G  
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYEVVTAADGEEALATFDEADPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|282898613|ref|ZP_06306601.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
 gi|281196481|gb|EFA71390.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
          Length = 242

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKADPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|116493525|ref|YP_805260.1| DNA-binding response regulator [Pediococcus pentosaceus ATCC 25745]
 gi|116103675|gb|ABJ68818.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Pediococcus pentosaceus ATCC 25745]
          Length = 233

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +  ++  GY  +   +G EAL    + KPD+I++D+ L +I G
Sbjct: 1   MPKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALAQVEEEKPDLILLDLMLPKIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +Q++       IP+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVARQVRAK---HNIPIIMVTAKDSELDKVVGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|194016744|ref|ZP_03055357.1| transcriptional regulatory protein ResD [Bacillus pumilus ATCC
           7061]
 gi|194011350|gb|EDW20919.1| transcriptional regulatory protein ResD [Bacillus pumilus ATCC
           7061]
          Length = 240

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L +  +E   Y   +  NG EA++   Q   D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLKMYLERENYEIDEAENGDEAIQKGLQTDYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  QI+   + +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  +
Sbjct: 68  VCNQIR---DKKATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRRS 124


>gi|22298806|ref|NP_682053.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294987|dbj|BAC08815.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 226

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 58/122 (47%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D     +     +E SG+      N   ALE    H PDVII DI + ++ 
Sbjct: 1   MTAKLLLVDDEPGVREAVSAYLEDSGFEVTAVANAQAALEYLETHVPDVIITDIMMPQMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    + +++   L  IPVI +TA  M  D  +    GC+AY++KP      +  IK  +
Sbjct: 61  GYAFLETVRQQPHLSHIPVIFLTARGMTRDRIQGYDAGCDAYLAKPFDPDELVAIIKNLL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|332140178|ref|YP_004425916.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550200|gb|AEA96918.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + V++VED     ++ + ++E SG+  ++  +   A E   +  PD+I++D  L   S
Sbjct: 1   MSRTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDYDIAQEKICEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +K+    ++IPVI +TA   + D+ R    G + Y++KP S    +  IK  +
Sbjct: 61  GVQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|295706850|ref|YP_003599925.1| two-component response regulator PhoP [Bacillus megaterium DSM 319]
 gi|294804509|gb|ADF41575.1| two-component response regulator PhoP [Bacillus megaterium DSM 319]
          Length = 238

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    L +  ++ +G+      +G E    A + KPD+I++D+ L ++ 
Sbjct: 1   MSKKLLVVDDEQSISTLLQYNLQQAGFTVETAEDGEEGYNKALEGKPDLIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K++++   +   P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKKLRQQKVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|302879699|ref|YP_003848263.1| two component transcriptional regulator PhoB, winged helix family
           [Gallionella capsiferriformans ES-2]
 gi|302582488|gb|ADL56499.1| two component transcriptional regulator PhoB, winged helix family
           [Gallionella capsiferriformans ES-2]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IVED     +L    +  +G++AL+  +  EA +  R + PD+I++D  L   S
Sbjct: 1   MSAKILIVEDEPAIQELLVFNVTQAGFVALRASDAEEAWQQIRDYAPDLILLDWMLPSTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + KQ++ ++  +++P+I +TA   + D+    + G + YI+KP S    M  I+  +
Sbjct: 61  GVVLAKQLRSEARTKDVPIIMLTARGDERDKVLGLESGADDYITKPFSPRELMARIRAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|149371968|ref|ZP_01891287.1| two-component response regulator [unidentified eubacterium SCB49]
 gi|149355108|gb|EDM43669.1| two-component response regulator [unidentified eubacterium SCB49]
          Length = 239

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 3/125 (2%)

Query: 1   MLKK---VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQ 57
           M KK   +++V+D    +++    +   GY  +   NG E +E A++ KP +II+D+ + 
Sbjct: 13  MKKKDIKILLVDDEPDILEIVGYNLSNEGYQVITAENGREGVEKAKKEKPHLIILDVMMP 72

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           E+ G+E  ++I+   EL E  +  +TA      +      G + YI+KPI   I +  +K
Sbjct: 73  EMDGIEACEKIRSIPELSETVITFLTARGEDYSQVAGFDAGADDYITKPIKPKILLSKVK 132

Query: 118 KYIGE 122
             +  
Sbjct: 133 ALLRR 137


>gi|152974825|ref|YP_001374342.1| two component transcriptional regulator [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023577|gb|ABS21347.1| two component transcriptional regulator, winged helix family
           [Bacillus cytotoxicus NVH 391-98]
          Length = 223

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K KV++V+D     +L    ++  GY   +  NG EAL    +   D +I+DI + E+
Sbjct: 1   MNKYKVLLVDDESDMRQLVGMYLDNFGYEWDEAENGKEALLKLEEAHYDFVILDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+ + K+I++     +IP+I +TA   + +     + G + Y+ KP S    +  ++  
Sbjct: 61  DGIAVCKEIRK---TSDIPIIFLTAKGEEWNRVNGLRNGADDYVVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|317122420|ref|YP_004102423.1| transcriptional regulator [Thermaerobacter marianensis DSM 12885]
 gi|315592400|gb|ADU51696.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter marianensis DSM 12885]
          Length = 235

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D      L R  +E  G+   +  +G EALE  R  +PD++++DI L  I G  
Sbjct: 2   RILVVDDEAPMRALLRLFLEQHGFAVSEAEDGYEALERVRTERPDLVLLDIMLPGIDGWA 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + ++ +S   ++PVI +TA     D     + G + Y+ KP +    +  I+  +  
Sbjct: 62  VCRILRRES---DVPVIMLTARDDVRDRVSGLEAGADDYLVKPFAEEELLARIRAVLRR 117


>gi|294501502|ref|YP_003565202.1| two-component response regulator PhoP [Bacillus megaterium QM
           B1551]
 gi|294351439|gb|ADE71768.1| two-component response regulator PhoP [Bacillus megaterium QM
           B1551]
          Length = 238

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    L +  ++ +G+      +G E    A + KPD+I++D+ L ++ 
Sbjct: 1   MSKKLLVVDDEQSISTLLQYNLQQAGFTVETAEDGEEGYNKALEGKPDLIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K++++   +   P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKKLRQQKVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|167769138|ref|ZP_02441191.1| hypothetical protein ANACOL_00461 [Anaerotruncus colihominis DSM
           17241]
 gi|167668778|gb|EDS12908.1| hypothetical protein ANACOL_00461 [Anaerotruncus colihominis DSM
           17241]
          Length = 230

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++ +D+    +L R  +E  GY      +G EAL       PD+I++DI + ++ G +
Sbjct: 5   KILVCDDDRNICELLRLYLEKDGYTVSIANDGEEALAKFTAEAPDLILLDIMMPKLDGWQ 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I++ S   + P+I +TA     D+    + G + Y+ KP      +  +K  +  A
Sbjct: 65  VCREIRKKS---DCPIIMITAKGETFDKVLGLELGSDDYVVKPFDPKEIVARVKAIMRRA 121


>gi|146280822|ref|YP_001170975.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri A1501]
 gi|145569027|gb|ABP78133.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri A1501]
 gi|327479090|gb|AEA82400.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri DSM 4166]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 64/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IV+D     ++    +E +GY  L+  N  +A  L    KPD+I++D  L   SG+
Sbjct: 4   KSILIVDDEAPIREMIVVALEMAGYDCLEAENTQQAHALIIDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    + P+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTADTPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|291538269|emb|CBL11380.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Roseburia intestinalis
           XB6B4]
          Length = 230

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E  G       +G EAL++A ++  D++++DI L ++ 
Sbjct: 1   MAKKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEALKMATENAYDMVLLDIMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ + I+E      +P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFEVCQHIRE---FSNMPIVMLTAKGDDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|261252149|ref|ZP_05944722.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           orientalis CIP 102891]
 gi|260935540|gb|EEX91529.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           orientalis CIP 102891]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|319789306|ref|YP_004150939.1| two component transcriptional regulator, winged helix family
           [Thermovibrio ammonificans HB-1]
 gi|317113808|gb|ADU96298.1| two component transcriptional regulator, winged helix family
           [Thermovibrio ammonificans HB-1]
          Length = 223

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 69/122 (56%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V++VED++   +L    ++  GY     ++G+EA EL +  K D+I++D+ L  ++G
Sbjct: 1   MARVLLVEDDDSIGELVTYYLKNKGYDVEWVQDGLEARELLKSRKYDIIVLDLMLPGVNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++ ++++     ++ P+I +TA   +  +    + G + Y++KP S+   +  I+  + 
Sbjct: 61  LDLCREVRLRGINKDTPIIVLTAIGDEDTKVHGLEAGADDYVTKPFSIKELLARIEAVLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|298490023|ref|YP_003720200.1| winged helix family two component transcriptional regulator
           ['Nostoc azollae' 0708]
 gi|298231941|gb|ADI63077.1| two component transcriptional regulator, winged helix family
           ['Nostoc azollae' 0708]
          Length = 242

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EALE  R+ +PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKAEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|117925402|ref|YP_866019.1| Cache sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
 gi|117609158|gb|ABK44613.1| Cache sensor hybrid histidine kinase [Magnetococcus sp. MC-1]
          Length = 1361

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 71/119 (59%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
             ++ V+D+  N+ +    +E +G    +  NG++ALE+ +QH  D+I+MDI + E++G E
Sbjct: 1241 TILAVDDDPRNLFVLTASLEQNGAEVHKALNGLKALEILKQHSVDLILMDIMMPEMNGYE 1300

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
               +I+ +    EIP+IA+TA A+K D+++    G   Y+SKP+   I +  ++ +I  
Sbjct: 1301 AIHEIRANPSYCEIPIIALTAKALKEDKQKCLDAGANDYLSKPVDYEILINMVQTWIKR 1359



 Score =  102 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            K+++++D+ L ++    + +  G   L   +G E L +A+ H P  II+D+ L ++ G E
Sbjct: 977  KILVIDDDLLFVENISYINQAQGLDTLSAHDGREGLRVAKSHHPVGIILDLGLPDMRGEE 1036

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIR-KGGCEAYISKPISLSIFMETIKKYI 120
            + +Q+K   EL+ IPV  ++A     D++R     G   ++ KP++ +      +  +
Sbjct: 1037 VLEQLKRSPELRHIPVYIISAK----DKQRALVDQGAIGFLQKPVNDAQIATAQRTLL 1090



 Score = 43.6 bits (103), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/77 (16%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 15   MKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSEL 74
              L  +    +G   L  +   E L     H  D+ + D  ++ ++ +E+ +Q+++    
Sbjct: 1110 QDLIAEKAMNAGMQQLVVQKPEEVLAKTAGHPFDLFLTDYDIEGMTCVELCQQVRQHQ-- 1167

Query: 75   QEIPVIAVTAFAMKGDE 91
             E+P+I  ++ ++   +
Sbjct: 1168 PELPIIIYSSRSLNEQQ 1184


>gi|196231912|ref|ZP_03130768.1| two component transcriptional regulator, winged helix family
           [Chthoniobacter flavus Ellin428]
 gi|196224034|gb|EDY18548.1| two component transcriptional regulator, winged helix family
           [Chthoniobacter flavus Ellin428]
          Length = 234

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 70/121 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++ +D    ++L    ++ +GY  L+  +G+ ALE ARQ  P +I++D+ L E+SGL
Sbjct: 8   KRILVADDEPDVLQLVSTNLKNAGYNVLKAEDGLSALEQARQTSPALIVLDLMLPEMSGL 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K +K ++    IPVI +TA A + D     + G + Y++KP S    +  +K  +  
Sbjct: 68  EVCKVLKRETATNRIPVIMLTAKAEEVDRIVGLELGADDYMTKPFSPRELVLRVKSVLRR 127

Query: 123 A 123
           A
Sbjct: 128 A 128


>gi|331266318|ref|YP_004325948.1| DNA-binding response regulator, OmpR family [Streptococcus oralis
           Uo5]
 gi|326682990|emb|CBZ00607.1| DNA-binding response regulator, OmpR family [Streptococcus oralis
           Uo5]
          Length = 235

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMAKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKAIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|312864518|ref|ZP_07724749.1| transcriptional regulatory protein WalR [Streptococcus downei
           F0415]
 gi|311099645|gb|EFQ57858.1| transcriptional regulatory protein WalR [Streptococcus downei
           F0415]
          Length = 235

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV++V+D +    + +  +   GY  +   +G EAL+      PD+II+D  L E+ G
Sbjct: 1   MKKVLVVDDEKPISDIIKFNLIKEGYEVVTAFDGKEALKQFEDENPDLIILDWMLPELEG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K+I++ S    +P+I ++A   + D+    + G + Y++KP S    +  IK ++ 
Sbjct: 61  LEVAKEIRKSS---HVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|256004535|ref|ZP_05429514.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281417959|ref|ZP_06248979.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
 gi|255991540|gb|EEU01643.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281409361|gb|EFB39619.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
          Length = 230

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++++D+    +L R  +E  G+  +   NG +ALE+ R   P+++I+DI L    G +
Sbjct: 8   KVLVIDDDVNICELIRLYMEKEGFEVVTVYNGSKALEVFRNEAPNIVILDIMLPGADGWQ 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   +  IPVI ++A     D+    + G + Y+ KP      +  +K  +  
Sbjct: 68  VCREIRK---ISNIPVIMLSAKGETFDKVLGLELGADDYLVKPFEPKELVARVKAVLRR 123


>gi|163741992|ref|ZP_02149381.1| two-component response regulator [Phaeobacter gallaeciensis 2.10]
 gi|161384713|gb|EDQ09093.1| two-component response regulator [Phaeobacter gallaeciensis 2.10]
          Length = 230

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 71/123 (57%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IV+D+   + +    +E +GY  L   +G+ AL+ +RQ  PD+I++DI L E+ 
Sbjct: 1   MPARILIVDDDPDILDVTGFAVEKAGYETLFASDGLNALKASRQQLPDLIVLDIGLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ S   ++P++ +TA   + D     + G + Y++KP S    +  IK  +
Sbjct: 61  GLEVCREIRKSS---DVPILFLTARDDEIDRIVGLEIGADDYLTKPFSPRELVARIKAIL 117

Query: 121 GEA 123
             +
Sbjct: 118 KRS 120


>gi|270307586|ref|YP_003329644.1| DNA-binding response regulator, two-component system, OmpR family
           [Dehalococcoides sp. VS]
 gi|270153478|gb|ACZ61316.1| DNA-binding response regulator, two-component system, OmpR family
           [Dehalococcoides sp. VS]
          Length = 256

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED+    +L    +   GY      +G++AL   R  KP ++I+D+ L  I G E
Sbjct: 31  KILVVEDDATLRELLCYNLAKEGYTLECAEDGLKALGTYRLFKPSLVILDVMLPGIDGFE 90

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + + I+ +S    +P++ +TA + + D+    + G + Y+SKP  +   +  +K  +  +
Sbjct: 91  LCRLIRTES---SVPILMLTARSSESDKVNGLEAGADDYLSKPFGMRELLARMKALLRRS 147


>gi|220929311|ref|YP_002506220.1| transcriptional regulator [Clostridium cellulolyticum H10]
 gi|219999639|gb|ACL76240.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulolyticum H10]
          Length = 228

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D+    +L    +E  GY  L   NG+ A++  +   P ++++DI L  I G +
Sbjct: 6   KVLIVDDDRNICELIGLYLEKEGYEVLYAYNGLNAVDTFKIQTPSLVVLDIMLPGIDGWQ 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   +  IP+I +TA     D+    + G + Y+ KP      +  +K  +  
Sbjct: 66  VCREIRK---VSSIPIIMLTAKGETFDKVLGLELGADDYMVKPFEPKELVARVKAVLRR 121


>gi|311032226|ref|ZP_07710316.1| two-component response regulator WalR [Bacillus sp. m3-13]
          Length = 233

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  ++  GY      +G EA+    + +PD+I++DI L +  
Sbjct: 1   MEKKILVVDDEKPIADILKFNLQKEGYEVYCAYDGEEAVNKVEEVRPDLILLDIMLPQRD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++  E   +P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|218247106|ref|YP_002372477.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 8801]
 gi|257060175|ref|YP_003138063.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8802]
 gi|218167584|gb|ACK66321.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8801]
 gi|256590341|gb|ACV01228.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8802]
          Length = 243

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL+   +  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTFHKADPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|56461211|ref|YP_156492.1| positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           loihiensis L2TR]
 gi|56180221|gb|AAV82943.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           loihiensis L2TR]
          Length = 228

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++IVED     ++   ++E  GY A++  +   A++   +  PD++++D  L   S
Sbjct: 1   MSRRILIVEDEAPIREMLSFVMEQHGYQAVEANDFDAAVDKIAEPYPDMVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ K+IK D   + IP+I +TA   + D+ +  + G + YI+KP S    M  ++   
Sbjct: 61  GLQLAKKIKGDDFTRNIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELMARMRAVF 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|163847561|ref|YP_001635605.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222525411|ref|YP_002569882.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163668850|gb|ABY35216.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222449290|gb|ACM53556.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 246

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D    +   R  +E  G       NG EA+E  R+  PD++++DI +  + G E 
Sbjct: 9   VLVVDDEPRMITFMRMNLELEGMRVTTATNGREAVEKVREEMPDIVLLDIMMPVMDGFEA 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            ++I+      ++PVI +TA   + D  R  + G + Y+ KP S    +  I+  +  
Sbjct: 69  LRRIRS---FSQVPVIILTAKDEEEDRVRGLELGADDYVGKPFSQRELVSRIRAVLRR 123


>gi|332994441|gb|AEF04496.1| putative DNA-binding response regulator PhoB [Alteromonas sp. SN2]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + V++VED     ++ + ++E SG+  ++  +   A E   +  PD+I++D  L   S
Sbjct: 1   MSRTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDYDIAQEKICEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +K+    ++IPVI +TA   + D+ R    G + Y++KP S    +  IK  +
Sbjct: 61  GVQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELIARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|259909297|ref|YP_002649653.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia pyrifoliae Ep1/96]
 gi|224964919|emb|CAX56442.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia pyrifoliae Ep1/96]
 gi|283479352|emb|CAY75268.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           pyrifoliae DSM 12163]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+K++++VED     ++   ++E + Y  ++  +   A+ L  +  PD+I++D  L   S
Sbjct: 1   MVKRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDRAVNLLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLEAGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|158339404|ref|YP_001520581.1| two component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158309645|gb|ABW31262.1| two component transcriptional regulator, winged helix family
           [Acaryochloris marina MBIC11017]
          Length = 238

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 68/123 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IVED +   +L R+++ET G+I     NG +AL +    +PD++I+D+ L  + 
Sbjct: 1   MKPTILIVEDEKEIAQLVRNMLETEGFICETLSNGADALRVVTVLQPDLVILDLMLPGLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+  +I++ S  ++  ++ +TA A + D       G + Y++KP S    +  ++  +
Sbjct: 61  GLEVCTRIRQQSLAKDPYILMLTARAEELDRIIGLTTGADDYLTKPFSPRELIARVRALL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|17231314|ref|NP_487862.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17132956|dbj|BAB75521.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 242

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL+  R+  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALDTFRKSDPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|219848942|ref|YP_002463375.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219543201|gb|ACL24939.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 247

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+D    +   R  +E  G       NG EA+E  R+  PD++++D+ +  + G E 
Sbjct: 9   VLVVDDEPRMIAFMRMNLELEGMRVTTATNGREAVEKVREEMPDIVLLDVMMPVMDGFEA 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            ++I+      ++PVI +TA   + D  R  + G + Y+ KP S    +  I+  +  
Sbjct: 69  LRRIRS---FSQVPVIILTAKDEEEDRVRGLELGADDYVGKPFSQRELISRIRAVLRR 123


>gi|170760192|ref|YP_001788883.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407181|gb|ACA55592.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 228

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+D+E   ++ +  +E SGY      NG EA E   ++KPD++++DI L  I G++
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYNGKEAQEGFLEYKPDLVLLDIMLPHIDGVD 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I++DS    IP+I +TA     D+    + G + YI KP      +  +K  +  
Sbjct: 67  VLKWIRKDS---TIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122


>gi|148980999|ref|ZP_01816248.1| DNA-binding response regulator PhoB [Vibrionales bacterium SWAT-3]
 gi|145961039|gb|EDK26361.1| DNA-binding response regulator PhoB [Vibrionales bacterium SWAT-3]
          Length = 229

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLCEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GVNFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|318081143|ref|ZP_07988475.1| two-component system response regulator [Streptomyces sp. SA3_actF]
          Length = 327

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++V+D+    ++    +  +G    +  +G  AL  A  H+PD++++D+ L  + GLE
Sbjct: 18  HVLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTHRPDLVVLDLMLPGMDGLE 77

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++E      +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 78  VCRRMRERHP---VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRR 133


>gi|148381483|ref|YP_001256024.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|153931315|ref|YP_001385858.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           19397]
 gi|153937839|ref|YP_001389265.1| DNA-binding response regulator [Clostridium botulinum A str. Hall]
 gi|153940381|ref|YP_001392897.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|168181012|ref|ZP_02615676.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
 gi|168183623|ref|ZP_02618287.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|170755568|ref|YP_001783183.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
 gi|226950999|ref|YP_002806090.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|237797004|ref|YP_002864556.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
 gi|148290967|emb|CAL85103.1| two-component response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|152927359|gb|ABS32859.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           19397]
 gi|152933753|gb|ABS39252.1| DNA-binding response regulator [Clostridium botulinum A str. Hall]
 gi|152936277|gb|ABS41775.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|169120780|gb|ACA44616.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
 gi|182668045|gb|EDT80024.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
 gi|182673177|gb|EDT85138.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|226841937|gb|ACO84603.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|229261601|gb|ACQ52634.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
 gi|295320874|gb|ADG01252.1| DNA-binding response regulator [Clostridium botulinum F str.
           230613]
 gi|322807868|emb|CBZ05443.1| response regulator (CheY-like receiver domain and HTH-type
           DNA-binding domain) [Clostridium botulinum H04402 065]
          Length = 228

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+D+E   ++ +  +E SGY      NG EA E   ++KPD++++DI L  I G++
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYNGKEAQEGFLEYKPDLVLLDIMLPHIDGVD 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I++DS    IP+I +TA     D+    + G + YI KP      +  +K  +  
Sbjct: 67  VLKWIRKDS---TIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122


>gi|332982066|ref|YP_004463507.1| winged helix family two component transcriptional regulator
           [Mahella australiensis 50-1 BON]
 gi|332699744|gb|AEE96685.1| two component transcriptional regulator, winged helix family
           [Mahella australiensis 50-1 BON]
          Length = 228

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++I++D++   +L        G+      NG E +     + P+++I+DI L    G +
Sbjct: 6   KILIIDDDKNICQLLNLYFTKEGFEVDIANNGKEGMSHFSNNPPNIVILDIMLPGKDGWD 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           I ++I+  S   +IP+I +TA +   D+    + G + Y+ KP      +  +K  +  
Sbjct: 66  ICREIRRMS---DIPIIMLTAKSETFDKVLGLELGADDYVVKPFDPKELIARVKAVLRR 121


>gi|82703349|ref|YP_412915.1| two component transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82411414|gb|ABB75523.1| two component transcriptional regulator, winged helix family
           [Nitrosospira multiformis ATCC 25196]
          Length = 234

 Score =  169 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  + +    T+N  EA+++     PD++++D  L  +S
Sbjct: 1   MAATILVVEDEPAIQELISYSLRQAKHTVSSTKNAEEAMKIINHTLPDLVLLDWMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G +  + ++  +  ++IP+I +TA A + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GADFARMLRRAARTKDIPIIMLTARADESDKVTGLESGADDYITKPFSPRELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|302338300|ref|YP_003803506.1| two component transcriptional regulator, winged helix family
           [Spirochaeta smaragdinae DSM 11293]
 gi|301635485|gb|ADK80912.1| two component transcriptional regulator, winged helix family
           [Spirochaeta smaragdinae DSM 11293]
          Length = 242

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 67/120 (55%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++V+D E  +KL    + + GY  L    G E LE AR H PD+II+D+ L  I G+
Sbjct: 10  KTILVVDDEEHVVKLLSMNLTSRGYDCLCAYTGEEGLEQARSHHPDLIILDVMLPGIDGI 69

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ + +K D   Q IPV+ ++A +   D+    +GG + YI+KP SL      ++  + +
Sbjct: 70  EVCRLLKSDPRTQLIPVLMLSAKSEGIDKIHGLEGGADDYITKPFSLRELFLRVEASLRQ 129


>gi|153834652|ref|ZP_01987319.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           harveyi HY01]
 gi|156973339|ref|YP_001444246.1| response regulator [Vibrio harveyi ATCC BAA-1116]
 gi|269962450|ref|ZP_06176800.1| DNA-binding response regulator PhoB [Vibrio harveyi 1DA3]
 gi|148868964|gb|EDL68018.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           harveyi HY01]
 gi|156524933|gb|ABU70019.1| hypothetical protein VIBHAR_01026 [Vibrio harveyi ATCC BAA-1116]
 gi|269832946|gb|EEZ87055.1| DNA-binding response regulator PhoB [Vibrio harveyi 1DA3]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|91225176|ref|ZP_01260398.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 12G01]
 gi|254228694|ref|ZP_04922118.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|262395154|ref|YP_003287008.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|269965135|ref|ZP_06179269.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 40B]
 gi|91190119|gb|EAS76390.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 12G01]
 gi|151938873|gb|EDN57707.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|262338748|gb|ACY52543.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|269830121|gb|EEZ84348.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 40B]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|67921096|ref|ZP_00514615.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
 gi|67857213|gb|EAM52453.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
          Length = 243

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL++  +  PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIFHEAIPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|300864882|ref|ZP_07109729.1| two component LuxR family transcriptional regulator [Oscillatoria
           sp. PCC 6506]
 gi|300337124|emb|CBN54879.1| two component LuxR family transcriptional regulator [Oscillatoria
           sp. PCC 6506]
          Length = 234

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 1/124 (0%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D     +  +  +E S +      NG E  EL +++ PD++I DI + ++ 
Sbjct: 5   MSARLLLVDDEPGLREAVQAYLEDSNFNVDVASNGREGWELLQKNPPDLVISDIMMPQVD 64

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G +   Q++ED   + +PV+ +TA  M  D  +  + GC+AYISKP      +  +   +
Sbjct: 65  GYQFLSQMREDPRFKAMPVVFLTAKGMTTDRIQGYQAGCDAYISKPFDPDELVAIVTNLL 124

Query: 121 -GEA 123
              A
Sbjct: 125 VRRA 128


>gi|256830427|ref|YP_003159155.1| winged helix family two component transcriptional regulator
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579603|gb|ACU90739.1| two component transcriptional regulator, winged helix family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 231

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++++ED      L    +++ GY     R+G + L+L +  +PD++++D+ L  +S
Sbjct: 1   MAHKIVVIEDEPDIANLLAFHLKSGGYDCFVARDGKKGLQLVQSERPDLVLLDLMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ K +K   E   IP+I +TA   + D     + G + Y+ KP S    M  IK  +
Sbjct: 61  GTDVCKAVKGSPECAHIPIIMLTARGDEVDRILGFELGADDYVIKPFSPRELMLRIKTVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|78043342|ref|YP_361360.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995457|gb|ABB14356.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 236

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K++IV+D    + + +  +   GY  +   NG EAL    + KPD+I++D  + E+S
Sbjct: 1   MARKILIVDDEPKIVTMVKSYLLKEGYEVITAFNGREALNSFYKEKPDLIVLDWMMPEMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I++ S+   IP+I +TA   + D+    + G + Y+ KP SL      IK  +
Sbjct: 61  GIEVLREIRKKSQ---IPIIMLTAKTEEVDKLIGFEFGVDDYVVKPFSLRELSARIKTIL 117

Query: 121 GE 122
             
Sbjct: 118 KR 119


>gi|116494441|ref|YP_806175.1| DNA-binding response regulator [Lactobacillus casei ATCC 334]
 gi|191637826|ref|YP_001986992.1| Putative response regulator [Lactobacillus casei BL23]
 gi|227535595|ref|ZP_03965644.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|239631190|ref|ZP_04674221.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301065951|ref|YP_003787974.1| OmpR family DNA-binding response regulator [Lactobacillus casei
           str. Zhang]
 gi|116104591|gb|ABJ69733.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei ATCC 334]
 gi|190712128|emb|CAQ66134.1| Putative response regulator [Lactobacillus casei BL23]
 gi|227186725|gb|EEI66792.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|239525655|gb|EEQ64656.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438358|gb|ADK18124.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei str. Zhang]
 gi|327381892|gb|AEA53368.1| VicR protein [Lactobacillus casei LC2W]
 gi|327385053|gb|AEA56527.1| VicR protein [Lactobacillus casei BD-II]
          Length = 235

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D    + L +  +E   Y      +G EAL+  R    D II+D+ L  +SG
Sbjct: 1   MKKILIVDDEPAILTLLQYNLEAEHYQVETATDGQEALDKVRNEPFDFIILDLMLPSLSG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++T++I+ED    + P++ +TA   + D+    + G + Y++KP S    +  IK    
Sbjct: 61  LDVTRKIREDKI--QTPIMILTAKDNETDKIVGLELGADDYVTKPFSPREIIARIKAIER 118

Query: 122 EA 123
            +
Sbjct: 119 RS 120


>gi|146277961|ref|YP_001168120.1| two component transcriptional regulator [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145556202|gb|ABP70815.1| two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 230

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E+ G+  +Q   G EAL L  +  PDVI++D  L  +SG+E+
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGTGDEALMLVEETGPDVIVLDWMLPSVSGIEV 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q+K     + +P+I ++A + + D  R  + G + Y+ KP S+   M  ++  +  A
Sbjct: 69  CRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127


>gi|222152735|ref|YP_002561912.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Streptococcus uberis 0140J]
 gi|222113548|emb|CAR41347.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Streptococcus uberis 0140J]
          Length = 240

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K +++V+D E  ++L    ++  GY      +G  AL+LA     D I++DI L ++ 
Sbjct: 1   MKKHILLVDDEEHILRLLDYHLKKEGYETDLAEDGRTALKLAESEHYDFILLDIMLPQLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K+I+  S+  + P++ V+A   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKRIR--SKGNKTPIMMVSAKGEEFDKVLALELGADDYMTKPFSPRELIARLKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|187777475|ref|ZP_02993948.1| hypothetical protein CLOSPO_01043 [Clostridium sporogenes ATCC
           15579]
 gi|187774403|gb|EDU38205.1| hypothetical protein CLOSPO_01043 [Clostridium sporogenes ATCC
           15579]
          Length = 228

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++V+D+E   ++ +  +E SGY      +G EA E   ++KPD++++DI L  I G++
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYDGKEAQEGFLEYKPDLVLLDIMLPHIDGVD 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I++DS    IP+I +TA     D+    + G + YI KP      +  +K  +  
Sbjct: 67  VLKWIRKDS---TIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122


>gi|3282774|gb|AAC25063.1| response regulator homolog PhoB [Vibrio cholerae]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINLIKHMKREEMTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|304569547|ref|NP_441728.2| OmpR subfamily [Synechocystis sp. PCC 6803]
          Length = 243

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EA+    +  PD++++D+ + ++ G  
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYEVVTAADGEEAIATFHESDPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|326201972|ref|ZP_08191842.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
 gi|325987767|gb|EGD48593.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
          Length = 228

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV+IV+D+    +L    +E  GY  L   NG+ A++  +   P ++++DI L  I G +
Sbjct: 6   KVLIVDDDRNICELIGLYLEKEGYEVLYAYNGLNAVDTFKIQTPSLVVLDIMLPGIDGWQ 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++I++   +  IP+I +TA     D+    + G + Y+ KP      +  +K  +  
Sbjct: 66  VCREIRK---VSSIPIIMLTAKGETFDKVLGLELGADDYMVKPFEPKELVARVKAVLRR 121


>gi|332160707|ref|YP_004297284.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664937|gb|ADZ41581.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862470|emb|CBX72627.1| phosphate regulon transcriptional regulatory protein phoB [Yersinia
           enterocolitica W22703]
          Length = 279

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 51  MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPYPDLVLLDWMLPGGS 110

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +   ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 111 GIQFIKHMKREVLTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 170

Query: 121 GE 122
             
Sbjct: 171 RR 172


>gi|323701215|ref|ZP_08112890.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533817|gb|EGB23681.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D E   ++    +   GY   +  +G EAL   R    D+II+D+ + ++ G+ 
Sbjct: 5   RVLVVDDEEKIRQVIGIYLTNEGYRVEEAVDGEEALRKFRAESWDLIILDVMMPKMDGIA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I+    + ++P+I +TA   + D     + G + Y+ KP S    +  IK  +  A
Sbjct: 65  VCQEIR---RVSKVPIIMLTAKNEEVDRILGLEFGADDYMGKPFSPRELVARIKAVMRRA 121


>gi|222151606|ref|YP_002560762.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Macrococcus caseolyticus JCSC5402]
 gi|222120731|dbj|BAH18066.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Macrococcus caseolyticus JCSC5402]
          Length = 237

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +E SG+  +   +G E L       PD++++D+ L ++ 
Sbjct: 1   MSQKVLVVDDEQSIVTLLQYNLEQSGFEVITAFDGEEGLSKIFSEDPDIVVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K ++  SE  ++P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GVEVCKAVR--SEKNQVPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVTARLKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|77359551|ref|YP_339126.1| transcriptional regulator [Pseudoalteromonas haloplanktis TAC125]
 gi|76874462|emb|CAI85683.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D     ++   ++E +G+ A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMVEPYPDMVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++I K+ K++   + IP+I +TA   + D+ R  + G + Y++KP S    M  IK  I
Sbjct: 61  GIQIAKKFKQNEYTRAIPIIMLTARGEEEDKVRGLEVGADDYVTKPFSPKELMARIKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|28897343|ref|NP_796948.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838075|ref|ZP_01990742.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ3810]
 gi|260364511|ref|ZP_05777132.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus K5030]
 gi|260876305|ref|ZP_05888660.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AN-5034]
 gi|260898576|ref|ZP_05907072.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus Peru-466]
 gi|260903268|ref|ZP_05911663.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ4037]
 gi|28805552|dbj|BAC58832.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748542|gb|EDM59401.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ3810]
 gi|308086888|gb|EFO36583.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus Peru-466]
 gi|308092989|gb|EFO42684.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AN-5034]
 gi|308107972|gb|EFO45512.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ4037]
 gi|308114699|gb|EFO52239.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus K5030]
 gi|328472632|gb|EGF43495.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus 10329]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|332709113|ref|ZP_08429081.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
 gi|332352119|gb|EGJ31691.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
          Length = 242

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL   R  +PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALNTFRDTEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|255326659|ref|ZP_05367735.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Rothia mucilaginosa ATCC 25296]
 gi|283457339|ref|YP_003361914.1| response regulator [Rothia mucilaginosa DY-18]
 gi|255295876|gb|EET75217.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Rothia mucilaginosa ATCC 25296]
 gi|283133329|dbj|BAI64094.1| response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Rothia mucilaginosa
           DY-18]
          Length = 234

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 64/121 (52%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            K+++V+D    ++L    +  +G+  +   NG EALE A    PD+I++D+ +  + G 
Sbjct: 5   AKLLVVDDEFNILELLATSLRFAGFEVVTAGNGREALEKAHAENPDLIVLDVMMPGMDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+T++++E+      PV+ +TA     D+      G + Y++KP SL   +  I+  +  
Sbjct: 65  EVTRRLRENGTT--TPVLFLTAKDATEDKVTGLGAGGDDYVTKPFSLDEVIARIRAILRR 122

Query: 123 A 123
           +
Sbjct: 123 S 123


>gi|254506701|ref|ZP_05118841.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus 16]
 gi|323499854|ref|ZP_08104813.1| response regulator [Vibrio sinaloensis DSM 21326]
 gi|219550282|gb|EED27267.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus 16]
 gi|323315095|gb|EGA68147.1| response regulator [Vibrio sinaloensis DSM 21326]
          Length = 229

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|89092214|ref|ZP_01165168.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oceanospirillum sp. MED92]
 gi|89083302|gb|EAR62520.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oceanospirillum sp. MED92]
          Length = 231

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K V+IV+D     ++    +E +GY  L+  N  +A  L    KPD++++D  +   SG
Sbjct: 4   SKSVLIVDDEAPIREMIAVALEMAGYQCLEAENANQAHGLIVDDKPDMVLLDWMMPGASG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E  +++++D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  + 
Sbjct: 64  IEFARRLRKDETTADIPIIMLTAKGDEDNKIKGLEAGVDDYITKPFSPRELVARLKAVLR 123

Query: 122 E 122
            
Sbjct: 124 R 124


>gi|313904351|ref|ZP_07837729.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
 gi|313470901|gb|EFR66225.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
          Length = 236

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 56/120 (46%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    +      +G EAL       PD+I++D+ L  + G 
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFECTIVNDGEEALRAVSSFSPDLILLDLMLPGMDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++  S    +P+I ++A     D+    + G + Y+ KP      +  +K  +  
Sbjct: 65  EVCREVRHKS---NVPIIMLSAKGEVFDKVLGLEMGADDYMIKPFDSKELVARVKAVLRR 121


>gi|288941366|ref|YP_003443606.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
 gi|288896738|gb|ADC62574.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
          Length = 228

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 66/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++++D     ++ R  +E+S +  ++  +  EA +L     PD+I++D  L   SG
Sbjct: 1   MTTILVIDDEPDIREVMRFALESSDFRVMEAGHADEARKLLSNETPDLILLDWMLPGRSG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +Q+K++ + + IP+I ++A   + D  +    G + YI+KP S    +  +K  + 
Sbjct: 61  LELAQQLKQNPKTKSIPIIMISARGEEEDRVKGLDTGADDYIAKPFSPREMVARVKAVLR 120

Query: 122 EA 123
            A
Sbjct: 121 RA 122


>gi|160880093|ref|YP_001559061.1| two component transcriptional regulator [Clostridium
           phytofermentans ISDg]
 gi|160428759|gb|ABX42322.1| two component transcriptional regulator, winged helix family
           [Clostridium phytofermentans ISDg]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E  G       +G EAL  A+Q + DVI++D+ L  ++
Sbjct: 1   MSKKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEALVFAKQKEYDVILLDVMLPRMN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ +QI+E      +PVI +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFEVCQQIRE---FSNMPVIMLTAKGDDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|163939206|ref|YP_001644090.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|163861403|gb|ABY42462.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
          Length = 223

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  V++V+D     +L    ++  GY   +  NG EAL        D +++DI + E+
Sbjct: 1   MSKYNVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALRKLETDHYDFVVLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GL + K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  
Sbjct: 61  DGLSVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|163802439|ref|ZP_02196332.1| recombination associated protein [Vibrio sp. AND4]
 gi|159173740|gb|EDP58555.1| recombination associated protein [Vibrio sp. AND4]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|22536883|ref|NP_687734.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R]
 gi|25010796|ref|NP_735191.1| DNA-binding response regulator [Streptococcus agalactiae NEM316]
 gi|76786877|ref|YP_329467.1| DNA-binding response regulator [Streptococcus agalactiae A909]
 gi|76798183|ref|ZP_00780434.1| VicR protein [Streptococcus agalactiae 18RS21]
 gi|77406409|ref|ZP_00783468.1| DNA-binding response regulator [Streptococcus agalactiae H36B]
 gi|77408360|ref|ZP_00785101.1| DNA-binding response regulator [Streptococcus agalactiae COH1]
 gi|77410786|ref|ZP_00787144.1| DNA-binding response regulator [Streptococcus agalactiae CJB111]
 gi|77413081|ref|ZP_00789282.1| DNA-binding response regulator [Streptococcus agalactiae 515]
 gi|22533733|gb|AAM99606.1|AE014224_9 DNA-binding response regulator [Streptococcus agalactiae 2603V/R]
 gi|23095150|emb|CAD46385.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76561934|gb|ABA44518.1| DNA-binding response regulator [Streptococcus agalactiae A909]
 gi|76586446|gb|EAO62953.1| VicR protein [Streptococcus agalactiae 18RS21]
 gi|77160874|gb|EAO71984.1| DNA-binding response regulator [Streptococcus agalactiae 515]
 gi|77163165|gb|EAO74118.1| DNA-binding response regulator [Streptococcus agalactiae CJB111]
 gi|77173041|gb|EAO76169.1| DNA-binding response regulator [Streptococcus agalactiae COH1]
 gi|77174973|gb|EAO77783.1| DNA-binding response regulator [Streptococcus agalactiae H36B]
 gi|319744748|gb|EFV97090.1| DNA-binding response regulator [Streptococcus agalactiae ATCC
           13813]
          Length = 236

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY      +G EAL    + +PD+II+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETATAFDGREALVQYAEFQPDLIILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K++++      IP+I ++A   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  LEVAKEVRK---TSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|292487424|ref|YP_003530296.1| phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora CFBP1430]
 gi|292898668|ref|YP_003538037.1| phosphate regulon two-component response regulator [Erwinia
           amylovora ATCC 49946]
 gi|291198516|emb|CBJ45624.1| phosphate regulon two-component response regulator [Erwinia
           amylovora ATCC 49946]
 gi|291552843|emb|CBA19888.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora CFBP1430]
 gi|312171528|emb|CBX79786.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora ATCC BAA-2158]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   AL L  +  PD+I++D  L   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDSALSLLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|82502198|gb|ABB80126.1| SubR [Bacillus subtilis]
          Length = 238

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+I +D +    L +  ++   Y      +G +AL L  Q+   ++I+D+ + +I G+E
Sbjct: 5   RVLIADDEKEIRDLLKTYLKRECYEVDVAVDGEDALRLFEQNHYHLVILDVMMPKIDGIE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++  +    +P++ +TA  ++GD+      G + YI+KP S++  +  IK  +  
Sbjct: 65  VCRRMRNHT---NVPILMLTAKDLEGDKILGLSIGADDYITKPFSVNEVLARIKAMLRR 120


>gi|254421179|ref|ZP_05034897.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
 gi|196188668|gb|EDX83632.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
          Length = 242

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EAL+  R   PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTFRNTIPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|302535811|ref|ZP_07288153.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. C]
 gi|302444706|gb|EFL16522.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. C]
          Length = 244

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +++++V+D     +  R  +   GY      +G++AL+ A  + PD+I++DIQ+  + GL
Sbjct: 9   QRILVVDDEPAVREALRRSLAFEGYEVRTAVDGLDALDQAAAYAPDLIVLDIQMPRMDGL 68

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++++    +   PV+ +TA    GD       G + Y+ KP  L      ++  +  
Sbjct: 69  TAARRLRASGSV--TPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRR 126

Query: 123 A 123
           +
Sbjct: 127 S 127


>gi|146297039|ref|YP_001180810.1| two component transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410615|gb|ABP67619.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 232

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 67/121 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++IV+D    ++L +  ++  GY   +  NG  AL++ + +K D++I+DI + +  G
Sbjct: 1   MKNILIVDDEPHIVELIKFNLQKEGYNTFEAENGNTALDIIKNNKIDLVILDIMMSDKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I+ +   + +PVI ++A + + D     + G + YI+KP S+   +  +K    
Sbjct: 61  YEVLKEIRFNKGTRNLPVILLSAKSEEIDRILGLELGADDYITKPFSVKELVARVKALFR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|261212177|ref|ZP_05926463.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC341]
 gi|262402893|ref|ZP_06079454.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC586]
 gi|260838785|gb|EEX65436.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC341]
 gi|262351675|gb|EEZ00808.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC586]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINLIKHMKREEVTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|227810120|ref|ZP_03989033.1| two-component system transcriptional regulator [Acidaminococcus sp.
           D21]
 gi|226904700|gb|EEH90618.1| two-component system transcriptional regulator [Acidaminococcus sp.
           D21]
          Length = 232

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + V+I +D     ++     +  G+  ++  +G EAL   +  KPD+I++DI +  + G 
Sbjct: 5   QTVLIADDEAQIREILSLYFKKEGFKVIEAADGAEALVQIQAGKPDIILLDIMMPVLDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ KQ+++   + ++P+I +TA     D     + G + YI+KP +    +  +K  +  
Sbjct: 65  EVCKQVRK---ISDVPIIMLTAKDFDDDRILGLEMGADDYIAKPFNTREVVARVKAVLRR 121

Query: 123 A 123
           +
Sbjct: 122 S 122


>gi|197301860|ref|ZP_03166929.1| hypothetical protein RUMLAC_00586 [Ruminococcus lactaris ATCC
           29176]
 gi|197299090|gb|EDY33621.1| hypothetical protein RUMLAC_00586 [Ruminococcus lactaris ATCC
           29176]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +L +K     +E  G       +G EALE A++ + D++++D+ L ++ 
Sbjct: 1   MSKKILVVDDEKLIVKGICFSLEQEGMEVDCAYDGEEALEYAKKCEYDLVLLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ +QI+E     ++PV+ +TA +   D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFQVCQQIRE---FSDMPVVMLTAKSEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|315639590|ref|ZP_07894730.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus italicus DSM 15952]
 gi|315484551|gb|EFU75007.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus italicus DSM 15952]
          Length = 235

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D    + L    +E  GY      +G EALE+A     D I++D+ L  + G
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYQVTSATDGQEALEIALMQSFDFILLDVMLPHMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +EITK+++++     IP+I +TA     D     + G + Y+SKP S    +  IK    
Sbjct: 61  IEITKRLRQEKV--NIPIIILTAKDDPIDRILGLEIGADDYLSKPFSPREVIARIKAIAR 118

Query: 122 E 122
            
Sbjct: 119 R 119


>gi|172040160|ref|YP_001799874.1| two-component system response regulator MtrA [Corynebacterium
           urealyticum DSM 7109]
 gi|171851464|emb|CAQ04440.1| two-component system response regulator MtrA [Corynebacterium
           urealyticum DSM 7109]
          Length = 226

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D+    ++   +++T G+  +   +G +A+  A++H PD+I++D+ L  +S
Sbjct: 1   MTPKILVVDDDPAISEMLTIVLQTEGFDTVVVGDGNDAVTAAQEHDPDLILLDVMLPGMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ + ++E      +P++ +TA     D     + G + YI+KP      +  ++  +
Sbjct: 61  GIDVCRTVRE---FSTVPIVMLTARTDTVDVVLGLESGADDYITKPFKPKELIARVRARL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|331268334|ref|YP_004394826.1| winged helix family two component transcriptional regulator
           [Clostridium botulinum BKT015925]
 gi|329124884|gb|AEB74829.1| two component transcriptional regulator, winged helix family
           [Clostridium botulinum BKT015925]
          Length = 228

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           ML K++I++D+E   ++ +  +E+SGY      +G  A     ++KPD++++D+ L  + 
Sbjct: 4   MLGKILIIDDDENICEIIKMYLESSGYSTEICYDGKSAQSAFFEYKPDLVLLDVMLPHMD 63

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K I++DSE    PVI +TA     D+    + G + YI KP      +  IK  +
Sbjct: 64  GIDVLKWIRKDSET---PVIMLTAKGETFDKVLALELGADDYIVKPFEPKELIARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|316936256|ref|YP_004111238.1| winged helix family two component transcriptional regulator
           [Rhodopseudomonas palustris DX-1]
 gi|315603970|gb|ADU46505.1| two component transcriptional regulator, winged helix family
           [Rhodopseudomonas palustris DX-1]
          Length = 237

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 65/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  +E+ GY       G +A    ++  PD++++D  L  +S
Sbjct: 1   MAARILVVEDEEALTTLLRYNLESEGYEVEAVARGDDADTRMKERIPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|238919113|ref|YP_002932627.1| phosphate regulon transcriptional regulatory protein PhoB,
           [Edwardsiella ictaluri 93-146]
 gi|238868681|gb|ACR68392.1| phosphate regulon transcriptional regulatory protein PhoB, putative
           [Edwardsiella ictaluri 93-146]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED      +   ++E +GY  L+  +   AL    +  PD+I++D  L   S
Sbjct: 1   MTIRILVVEDETPIRDMVSFVLEQNGYQPLEAESYDGALSQLCEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K +   ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLIKQLKREPATRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|197283966|ref|YP_002149838.1| phosphate regulon transcriptional regulator [Proteus mirabilis
           HI4320]
 gi|194681453|emb|CAR40291.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis HI4320]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   AL       PD++++D  +   S
Sbjct: 1   MARRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLIDPYPDLVLLDWMIPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K ++  ++IP+I +TA   + D+ +  + G + Y+ KP S    +  +K  +
Sbjct: 61  GIQVIKQMKRENNTRDIPIIMLTAKGEEEDKVKGLETGADDYVIKPFSPKELVARVKAIL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|16329558|ref|NP_440286.1| OmpR subfamily [Synechocystis sp. PCC 6803]
 gi|1652041|dbj|BAA16966.1| OmpR subfamily [Synechocystis sp. PCC 6803]
          Length = 245

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 63/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IVED++   +L R+ +E   +  + T +G   L + ++  PD+I++D+ L ++ G
Sbjct: 11  MPNILIVEDDQEIAQLIRETLEREQFTCIVTNDGETGLRIFQEQVPDLIVLDLMLPKLDG 70

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+  +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  + 
Sbjct: 71  LEVCTRIRQQPGSKDPYILMLTAKGEEIDRIIGLSTGADDYLVKPFSPRELVARVRALLR 130

Query: 122 E 122
            
Sbjct: 131 R 131


>gi|154244160|ref|YP_001415118.1| two component transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154158245|gb|ABS65461.1| two component transcriptional regulator, winged helix family
           [Xanthobacter autotrophicus Py2]
          Length = 233

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 63/123 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IVED E    L R  +E+ GY       G EA    R+  PD++I+D  L  +S
Sbjct: 1   MPAHILIVEDEEPLTLLLRYNLESEGYGVESVGRGDEAETRLRESVPDLVILDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E + +PVI +TA   + +  R    G + Y+ KP S+   +  ++  +
Sbjct: 61  GIELCRRLRTRPETERLPVIMLTARGEETERVRGLATGADDYVVKPFSVPELLARVRALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|323491596|ref|ZP_08096775.1| DNA-binding response regulator PhoB [Vibrio brasiliensis LMG 20546]
 gi|323314172|gb|EGA67257.1| DNA-binding response regulator PhoB [Vibrio brasiliensis LMG 20546]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY  ++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQTVEAEDYDTAVTKLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+   K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|312127464|ref|YP_003992338.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777483|gb|ADQ06969.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 232

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 72/121 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++IV+D +  ++L +  +   GY   +  +G++ALE+ + +K D++I+DI + +  G
Sbjct: 1   MKSILIVDDEQHILELLKFNLRKEGYNTFEADSGLQALEILKHNKVDLVILDIMMSDKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I+ + + + +PVI ++A + + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 61  YEVLKEIRFNKDTKNLPVILLSAKSEEIDKILGLELGADDYITKPFSVKELVVRVKALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|149914856|ref|ZP_01903385.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. AzwK-3b]
 gi|149811044|gb|EDM70881.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. AzwK-3b]
          Length = 229

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 65/119 (54%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E  G+      NG EAL L  +  PD+I++D  L  +SG+E+
Sbjct: 8   VLLVEDEPAQREVLSYNLEADGFRVTTAENGEEALLLVDEAAPDIIVLDWMLPNVSGIEV 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            +Q+K  ++ + +P++ ++A + + D  R  + G + Y+ KP S+   M  ++  +  +
Sbjct: 68  CRQLKTRADTRNVPILMLSARSEEVDRVRGLETGADDYVVKPYSVIELMARVRALLRRS 126


>gi|320162273|ref|YP_004175498.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319996127|dbj|BAJ64898.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 225

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++I+ED+E  +++ +  +   GY+      G   L+LAR+H+PD+II+D  L  + 
Sbjct: 1   MKERILIIEDDEGIVRVLKRALTYEGYLVESALEGETGLQLAREHRPDLIILDWMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++++    L   P++ +TA     D  +    G + Y++KP  L   +  I+  +
Sbjct: 61  GLEVCQRLR---TLCNAPILMLTAKDTLQDRVQGLDAGADDYMTKPFELEELLARIRALL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|295707319|ref|YP_003600394.1| two-component response regulator WalR [Bacillus megaterium DSM 319]
 gi|294804978|gb|ADF42044.1| two-component response regulator WalR [Bacillus megaterium DSM 319]
          Length = 235

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY      +G+EALE   + +P++I++DI L +  
Sbjct: 1   MDKRILVVDDEKPIADILKFNLQKEGYEVFCAYDGVEALEKVEEVQPEMILLDIMLPQKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|294501968|ref|YP_003565668.1| two-component response regulator WalR [Bacillus megaterium QM
           B1551]
 gi|294351905|gb|ADE72234.1| two-component response regulator WalR [Bacillus megaterium QM
           B1551]
          Length = 235

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +    + +  ++  GY      +G+EALE   + +P++I++DI L +  
Sbjct: 1   MDKRILVVDDEKPIADILKFNLQKEGYEVFCAYDGVEALEKVEEVQPEMILLDIMLPQKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|254831885|ref|ZP_05236540.1| hypothetical protein Lmon1_11050 [Listeria monocytogenes 10403S]
          Length = 237

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +    + +  +   G+      +G EALEL  + +PD+I++DI L    G+
Sbjct: 4   KKILVVDDEKTIADIVKFNLNKEGFDVYCAYDGDEALELVEEVQPDLILLDIMLPGRDGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 64  EVCREVRKK---YDMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELIARVKANLRR 120


>gi|138895267|ref|YP_001125720.1| two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266780|gb|ABO66975.1| Two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
          Length = 223

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+D +  + L    +   GY  ++  +G+ A++    +K D++++DI + E+ G
Sbjct: 1   MYTILLVDDEKRMLDLLDLYLSPKGYHCVKCESGLAAIQYLENNKVDLVLLDIMMPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E  K+I+E      +P+I VTA     D  +  K G + YI+KP   S  +  I+  + 
Sbjct: 61  WETCKRIRE---FSNVPIIMVTARDQTTDIVQGLKIGADDYITKPFDESELLARIEAVLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|300021830|ref|YP_003754441.1| two component transcriptional regulator PhoB, winged helix family
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523651|gb|ADJ22120.1| two component transcriptional regulator PhoB, winged helix family
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 234

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 68/123 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++VED    ++L +  +++ GY  +   +G EA  L  +   D+ I+D  + +IS
Sbjct: 1   MAAKIIVVEDEAPLVELLKYNLQSEGYDVVHAADGEEAELLLAEQSYDLAILDWMIPKIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++  +E Q +P+I +TA   + D  R    G + Y++KP S+   M  IK  +
Sbjct: 61  GIELCRRLRNRTETQNLPIILLTARGEEADRVRGLTTGADDYVTKPFSVQELMARIKALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|116332709|ref|YP_794236.1| DNA-binding response regulator [Lactobacillus brevis ATCC 367]
 gi|116098056|gb|ABJ63205.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus brevis ATCC 367]
          Length = 238

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    + +  +E  GY      +G  A++   +  PD++I+D+ L +I 
Sbjct: 1   MPKKILVVDDEKPISDIMKFNLEKEGYEVAVAYDGEAAVQAVEEDVPDLVILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GLEVAREIRKK---HDMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|114569034|ref|YP_755714.1| two component transcriptional regulator [Maricaulis maris MCS10]
 gi|114339496|gb|ABI64776.1| two component transcriptional regulator, winged helix family
           [Maricaulis maris MCS10]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VED +    L +  +E  GY     R+G +AL  A +  PD++++D  L ++S
Sbjct: 1   MKAHVLVVEDEDALATLLQYNLEKEGYSVAVARDGEDALMQAEETTPDLVMVDWMLPKVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E   +P+I +TA   + D  R    G + Y+ KP S++     I+  +
Sbjct: 61  GIEVCRRLRGRQETANVPIIMLTARGEETDRVRGLDTGADDYVVKPFSMTELFARIRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|147676383|ref|YP_001210598.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146272480|dbj|BAF58229.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 232

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 67/125 (53%), Gaps = 6/125 (4%)

Query: 2   LKK--VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE- 58
           +K+  ++IV+D    ++L +  +  SGY+     +G  A+E+      D++I+DI L   
Sbjct: 1   MKRKTILIVDDEPRLVRLVKVNLLASGYVVDTAADGKTAIEMLESSGYDLLILDIMLPGP 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           ++G E+ K+I+E     +IP+I +T  A + D  R    G + Y++KP S+   +  +K 
Sbjct: 61  LNGFEVCKRIRE---FSDIPIIMLTGRAREQDRIRGFDAGADDYVTKPFSVEELLLRVKA 117

Query: 119 YIGEA 123
            +  +
Sbjct: 118 ILRRS 122


>gi|73662382|ref|YP_301163.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
 gi|72494897|dbj|BAE18218.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
          Length = 236

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +E +GYI     +G EALE      P++I++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLEQAGYIVEVAYDGEEALEKVNATNPELIVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKSIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|28872582|ref|NP_795201.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968546|ref|ZP_03396689.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato T1]
 gi|301383518|ref|ZP_07231936.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato Max13]
 gi|302062568|ref|ZP_07254109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato K40]
 gi|302130235|ref|ZP_07256225.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855837|gb|AAO58896.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926834|gb|EEB60386.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato T1]
 gi|330878107|gb|EGH12256.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330967971|gb|EGH68231.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017829|gb|EGH97885.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  ++  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|253752080|ref|YP_003025221.1| response regulator protein [Streptococcus suis SC84]
 gi|251816369|emb|CAZ52000.1| response regulator protein [Streptococcus suis SC84]
          Length = 234

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EALE+     PD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAEFPDIVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVARTIRK---TSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|260590120|ref|ZP_05856033.1| DNA-binding response regulator VicR [Blautia hansenii DSM 20583]
 gi|331084377|ref|ZP_08333481.1| hypothetical protein HMPREF0992_02405 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260539632|gb|EEX20201.1| DNA-binding response regulator VicR [Blautia hansenii DSM 20583]
 gi|330401641|gb|EGG81222.1| hypothetical protein HMPREF0992_02405 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+V++V+D +L +K  R  +E  G       +G EALE A++ + D+I++DI L +++
Sbjct: 1   MSKRVLVVDDEKLIVKGIRFSLEQEGMEVDCAYDGEEALEKAKEKEYDMILLDIMLPKLT 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ +QI+E      +P+I +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GLEVCQQIRE---FSSVPIIMLTAKGEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|158425656|ref|YP_001526948.1| phosphate regulon transcriptional regulatory protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332545|dbj|BAF90030.1| phosphate regulon transcriptional regulatory protein [Azorhizobium
           caulinodans ORS 571]
          Length = 233

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++I+ED E    L R  +E+ GY       G EA    R+  PD++I+D  L  +S
Sbjct: 1   MPARILIIEDEEPLTLLLRYNLESEGYAVDNVGRGDEAETRLRESVPDLVILDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E + +PVI +TA   + +  R    G + Y+ KP S+   +  ++  +
Sbjct: 61  GIELCRRLRTRPETERLPVIMLTARGEETERVRGLATGADDYVVKPFSVPELLARVRALL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|304311894|ref|YP_003811492.1| Phosphatase regulon transcriptional regulatory protein [gamma
           proteobacterium HdN1]
 gi|301797627|emb|CBL45848.1| Phosphatase regulon transcriptional regulatory protein [gamma
           proteobacterium HdN1]
          Length = 228

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   ++IV+D     +L    +E +G+      +G EA     +  PD++++D  L   S
Sbjct: 1   MKANILIVDDEIAICELLTLALEQAGFTVQAAYDGKEAWIKLAEQAPDLLLLDWMLPGTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I++   L+ +P+I ++A + + ++    + G + YI+KP S    +  IK  +
Sbjct: 61  GIELARRIRQTDNLRTLPIIMLSAKSEEDNKITGLEIGADDYITKPFSTRELISRIKALL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|317128715|ref|YP_004094997.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
 gi|315473663|gb|ADU30266.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
          Length = 234

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           KV++ +D+    ++    ++ + Y  ++  NG EA+ L    KPD+I++DI + +I G E
Sbjct: 5   KVLVADDDPNVCEIISLYLKQNQYDVVEANNGKEAISLFESSKPDIILLDIMMPDIDGYE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+I++      +P+I +TA   + D     + G + Y++KP S    +  IK     
Sbjct: 65  VCKEIRKK---ANVPIIMLTAKDEELDRVLGLEIGADDYVTKPFSPREVVARIKAIFRR 120


>gi|307154473|ref|YP_003889857.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7822]
 gi|306984701|gb|ADN16582.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7822]
          Length = 234

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 62/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED     +L R+ +E   +     R G++ALE   Q +PDVI++DI L E+ GLE+
Sbjct: 3   ILIVEDEPEIAQLIRETLERENFTCHIARTGLQALEFFGQLQPDVIVLDIMLPELDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CTRIRQKPGTKDPYILMLTARGEEIDRIIGLSTGADDYLVKPFSPIELVARVRALLRRS 121


>gi|126736258|ref|ZP_01752000.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. CCS2]
 gi|126714079|gb|EBA10948.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. CCS2]
          Length = 228

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V+IVED     ++    +E  G+   +  NG E L    ++ PDVI++D  +  +SG+E
Sbjct: 6   HVLIVEDEAAQREVLAYNLEAEGFRVTRAENGDEGLLCVEENAPDVIVLDWMMPNLSGIE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++K   E + IP+I ++A + + D+ R  + G + Y+ KP S+S  M  ++  +  
Sbjct: 66  VCRRLKIKPETRSIPIIMLSARSEEVDKVRGLETGADDYVVKPYSVSELMARVRTQLRR 124


>gi|170719341|ref|YP_001747029.1| two component transcriptional regulator [Pseudomonas putida W619]
 gi|169757344|gb|ACA70660.1| two component transcriptional regulator, winged helix family
           [Pseudomonas putida W619]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|126700252|ref|YP_001089149.1| two-component response regulator [Clostridium difficile 630]
 gi|254976231|ref|ZP_05272703.1| two-component response regulator [Clostridium difficile QCD-66c26]
 gi|255093618|ref|ZP_05323096.1| two-component response regulator [Clostridium difficile CIP 107932]
 gi|255101806|ref|ZP_05330783.1| two-component response regulator [Clostridium difficile QCD-63q42]
 gi|255307673|ref|ZP_05351844.1| two-component response regulator [Clostridium difficile ATCC 43255]
 gi|255315366|ref|ZP_05356949.1| two-component response regulator [Clostridium difficile QCD-76w55]
 gi|255518031|ref|ZP_05385707.1| two-component response regulator [Clostridium difficile QCD-97b34]
 gi|255651147|ref|ZP_05398049.1| two-component response regulator [Clostridium difficile QCD-37x79]
 gi|255656615|ref|ZP_05402024.1| two-component response regulator [Clostridium difficile QCD-23m63]
 gi|260684213|ref|YP_003215498.1| two-component response regulator [Clostridium difficile CD196]
 gi|260687872|ref|YP_003219006.1| two-component response regulator [Clostridium difficile R20291]
 gi|296449929|ref|ZP_06891693.1| response regulator [Clostridium difficile NAP08]
 gi|296878311|ref|ZP_06902319.1| response regulator [Clostridium difficile NAP07]
 gi|306520997|ref|ZP_07407344.1| two-component response regulator [Clostridium difficile QCD-32g58]
 gi|115251689|emb|CAJ69524.1| Two-component response regulator [Clostridium difficile]
 gi|260210376|emb|CBA64753.1| two-component response regulator [Clostridium difficile CD196]
 gi|260213889|emb|CBE05918.1| two-component response regulator [Clostridium difficile R20291]
 gi|296261199|gb|EFH08030.1| response regulator [Clostridium difficile NAP08]
 gi|296430609|gb|EFH16448.1| response regulator [Clostridium difficile NAP07]
          Length = 230

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 70/122 (57%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  KV++++D    ++L +  +E S Y    + +G +    A++ KPD+I++D  L  IS
Sbjct: 1   MNTKVLVIDDEMHIVELLKFNLEVSNYEVSYSYDGFDGFIKAKEIKPDLILLDWMLPNIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++I+ D +L+ IPVI +TA  M+ D+    + G + YI+KP S+   +  I   +
Sbjct: 61  GIEVLRKIRSDKDLKNIPVIMLTAKNMENDKVEGLEIGADDYITKPFSIKELLARISSVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|85703117|ref|ZP_01034221.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. 217]
 gi|85672045|gb|EAQ26902.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. 217]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++    ++  G+  L   NG EAL +  +  PD+I++D  +  +SG+E
Sbjct: 7   TVLLVEDEPAQREVLGYNLQADGFHVLTASNGEEALLMVSEMPPDIIVLDWMMPNVSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +Q+K  SE + IP+I ++A + + D  R  + G + Y+ KP SL   M  ++  +  
Sbjct: 67  VCRQLKTRSETRGIPIIMLSARSEEVDRVRGLETGADDYVIKPYSLVELMARVRAQLRR 125


>gi|302390526|ref|YP_003826347.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
 gi|302201154|gb|ADL08724.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 71/120 (59%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D +  + L ++ +E  G+      +G+EAL+L  + K D++++DI + E+SG +
Sbjct: 5   RILVVDDEDKLLDLIKNFLEKEGFAVTCADSGVEALKLLEKRKFDLVVLDIMMPEVSGFD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I+E  +   IPVI +TA A + D+    + G + YI+KP SL      I+  +  A
Sbjct: 65  VLRRIREKIQ---IPVIFLTARAEEPDKLLGLELGGDDYITKPFSLRELAARIRAVLRRA 121


>gi|308069543|ref|YP_003871148.1| transcriptional regulatory protein resD [Paenibacillus polymyxa
           E681]
 gi|305858822|gb|ADM70610.1| Transcriptional regulatory protein resD [Paenibacillus polymyxa
           E681]
          Length = 238

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +++IV+D E   +L R  +E  GY+  +  +G  AL+ A      +I++D+ L  + G+E
Sbjct: 7   RILIVDDEERIRRLLRMYLEKEGYVIDEAEDGEIALQKATASDYSIILLDVMLPGMDGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++    +  PVI +TA   + +  +  + G + Y+ KP S    +  +K  +  +
Sbjct: 67  VCTRLRQ---TKATPVIMLTAKGEEVNRVQGFEVGADDYVVKPFSPREVIYRVKAILRRS 123


>gi|172057053|ref|YP_001813513.1| two component transcriptional regulator [Exiguobacterium sibiricum
           255-15]
 gi|171989574|gb|ACB60496.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sibiricum 255-15]
          Length = 238

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++V+D E   +L +  +E   +   +  NG  ALE+A + + DVI++D+ + ++ G+
Sbjct: 5   ARILVVDDEERIRRLLKMYLERENFTIEEADNGETALEMALETEYDVILLDLMMPKLDGM 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ +++++    +  P++ +TA   + +     + G + YI KP S    +  +K  +  
Sbjct: 65  QVCEELRK---TKATPIVMLTAKGEETNRVHGFEMGADDYIVKPFSPREVVLRVKAILRR 121

Query: 123 A 123
           A
Sbjct: 122 A 122


>gi|322391842|ref|ZP_08065307.1| DNA-binding response regulator [Streptococcus peroris ATCC 700780]
 gi|321145322|gb|EFX40718.1| DNA-binding response regulator [Streptococcus peroris ATCC 700780]
          Length = 234

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    KPD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEKPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|167766653|ref|ZP_02438706.1| hypothetical protein CLOSS21_01159 [Clostridium sp. SS2/1]
 gi|317499486|ref|ZP_07957752.1| response regulator receiver domain-containing protein
           [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711776|gb|EDS22355.1| hypothetical protein CLOSS21_01159 [Clostridium sp. SS2/1]
 gi|291558666|emb|CBL37466.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [butyrate-producing
           bacterium SSC/2]
 gi|316893260|gb|EFV15476.1| response regulator receiver domain-containing protein
           [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++KV++V+D +L +K  +  +E          +G EALE A++++ D+I++D+ L  ++G
Sbjct: 1   MRKVLVVDDEKLIVKGIKFSLEQDEMQVDCAYDGEEALEKAKENQYDIILLDVMLPGLTG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ + I+E      +P+I +TA     D+    + G + YI+KP ++      IK  + 
Sbjct: 61  FEVCQAIRE---FSSVPIIMLTAKGEDMDKILGLEYGADDYITKPFNILEVKARIKAILR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|284052014|ref|ZP_06382224.1| two component transcriptional regulator [Arthrospira platensis str.
           Paraca]
 gi|291569758|dbj|BAI92030.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 243

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D     ++    +   GY  +   +G EALE  R  +PD++++D+ + ++ G  
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRLTEPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   +IP+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|257129263|gb|ACV42481.1| putative adenylate/guanylate cyclase [Lyngbya majuscula 19L]
          Length = 1156

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-KPDVIIMDIQLQEISGL 62
           K++IV+D  +N ++  + +    Y      NG+EALE+     +PD+I++D+ +  ++G 
Sbjct: 746 KILIVDDEPVNRQVISNYLSMENYAIATATNGLEALEMLSTGFQPDLILLDVMMPRMTGY 805

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+  +I++     E+PVI +TA     D       G   Y++KP S    +  IK ++ 
Sbjct: 806 EVCAKIRQKFLPSELPVIMLTANNQISDLVEGFTFGVNDYLTKPCSKHELLARIKSHLR 864


>gi|85711170|ref|ZP_01042230.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           baltica OS145]
 gi|85695083|gb|EAQ33021.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           baltica OS145]
          Length = 228

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++IVED     ++   ++E  GY A++ ++    L    +  PD++++D  L   S
Sbjct: 1   MPRRILIVEDEAPIREMLSFVMEQHGYQAVEAKDYDSGLAKIAEPYPDMVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K+IK D   + IP+I +TA   + D+ R  + G + YI+KP S    M  ++   
Sbjct: 61  GIQLAKKIKSDDFTRNIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARMRAVF 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|300715551|ref|YP_003740354.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia billingiae Eb661]
 gi|299061387|emb|CAX58497.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia billingiae Eb661]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   A+ L  +  PD+I++D  L   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVNLLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|158338214|ref|YP_001519391.1| PAS/PAC sensor signal transduction histidine kinase [Acaryochloris
           marina MBIC11017]
 gi|158308455|gb|ABW30072.1| PAS/PAC sensor signal transduction histidine kinase [Acaryochloris
           marina MBIC11017]
          Length = 545

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 62/116 (53%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +M+V+D   N+++  + + ++GY      +G  AL+    H P +I++DIQ+  + G E+
Sbjct: 7   IMVVDDTPANLEVISETLSSAGYRVAAAISGERALKRLHTHPPALILLDIQMPVMDGFEV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +QIK ++    IP+I +TA +         + G   YISKP   +  +  ++ ++
Sbjct: 67  CRQIKANAATANIPIIFITARSDTQSILHGFEMGAVDYISKPFQEAELLARVRTHL 122


>gi|148653957|ref|YP_001281050.1| two component transcriptional regulator [Psychrobacter sp. PRwf-1]
 gi|148573041|gb|ABQ95100.1| two component transcriptional regulator, winged helix family
           [Psychrobacter sp. PRwf-1]
          Length = 240

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 67/126 (53%), Gaps = 4/126 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQE 58
           M K+++++ED+    +L  D +  + Y       G E L++  A++   D+II+D+ L +
Sbjct: 1   MSKQILLIEDDPDLAELISDYLAMNYYEVHHAPTGQEGLDILDAKERAIDLIILDLMLPD 60

Query: 59  ISGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           + G+++ ++I+  ++S+  ++P++ +TA     D     + G + YISKP      +  I
Sbjct: 61  MDGMQVCQKIRGGKNSQTNKVPIVMLTAKGDTTDRVLGLEMGADDYISKPFEPRELLARI 120

Query: 117 KKYIGE 122
           +  +  
Sbjct: 121 RAVLRR 126


>gi|86605678|ref|YP_474441.1| response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554220|gb|ABC99178.1| response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 374

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 56/120 (46%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  ++IV+D+     + +  +E  GY       G+E LE A    P +II D  + ++ G
Sbjct: 1   MTAILIVDDDPTIRLVLKRSLERQGYTVEMASGGLEGLEKAHLLTPGLIICDWMMPDMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++IK D +      I +TA     D  +    G + ++SKPI  +     ++  + 
Sbjct: 61  LEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVRAGLR 120


>gi|329576541|gb|EGG58048.1| putative transcriptional regulatory protein WalR [Enterococcus
           faecalis TX1467]
          Length = 159

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +   ++ +  +   GY      +G EALE   + +PD+II+D+ L ++ G
Sbjct: 1   MKKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVEEVEPDLIILDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVAREVRK---THDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|307152445|ref|YP_003887829.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306982673|gb|ADN14554.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1566

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 58/117 (49%), Gaps = 1/117 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++ +DN       + L+    Y      +G+  LE   +  PD+++ D+ +  + G E
Sbjct: 397 RILLADDNADMRDYIKRLLTDL-YEVETVSDGIAVLEALARELPDLVLTDVMMPGLDGFE 455

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + ++++ +   ++IP+I ++A A +       K G + Y+ KP S    +  ++ ++
Sbjct: 456 LLRELRANPNTRQIPIILLSARAGEPSRVEGLKAGADDYLIKPFSARELLARVETHL 512



 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++V+D+         L+  +G   +   +  EAL++    KPDV++ DI + EI G  +
Sbjct: 1447 ILVVDDDADTRDFLGFLLREAGAKVVTLASATEALQVLAGSKPDVLLCDIGMPEIDGYML 1506

Query: 65   TKQIK---EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFM 113
             KQ++     S  + I  IA+TA+A   + E+  K G + +ISKPI     +
Sbjct: 1507 IKQVRIWENQSGEKPILAIALTAYAGDLNHEKALKAGFQHHISKPIKPEELL 1558


>gi|332712429|ref|ZP_08432355.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
 gi|332348724|gb|EGJ28338.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
          Length = 1156

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-KPDVIIMDIQLQEISGL 62
           K++IV+D  +N ++  + +    Y      NG+EALE+     +PD+I++D+ +  ++G 
Sbjct: 746 KILIVDDEPVNRQVISNYLSMENYAIATATNGLEALEMLSTGFQPDLILLDVMMPRMTGY 805

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+  +I++     E+PVI +TA     D       G   Y++KP S    +  IK ++ 
Sbjct: 806 EVCAKIRQKFLPSELPVIMLTANNQISDLVEGFTFGVNDYLTKPCSKHELLARIKSHLR 864


>gi|167461324|ref|ZP_02326413.1| two-component response regulator [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381342|ref|ZP_08055345.1| two-component response regulator YycG-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154918|gb|EFX47189.1| two-component response regulator YycG-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 282

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D +    + +  +E  GY  +   +G  A+ELA   KPD+I++D+ L    
Sbjct: 44  MQRRILVVDDEQPIADILKFNLEKEGYEVICAYDGGTAVELAFSEKPDLILLDLMLPVKD 103

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ ++++        P+I +TA   + D+    + G + Y++KP      +  +K ++
Sbjct: 104 GMDVCREVRGKL---NTPIIMLTAKDTEIDKVLGLEMGADDYVTKPFGTRELLARVKAHL 160

Query: 121 GE 122
             
Sbjct: 161 RR 162


>gi|78101053|pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain
 gi|78101054|pdb|1ZES|B Chain B, Bef3- Activated Phob Receiver Domain
 gi|78101055|pdb|1ZES|C Chain C, Bef3- Activated Phob Receiver Domain
          Length = 125

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|114332048|ref|YP_748270.1| two component transcriptional regulator, winged helix family
           protein [Nitrosomonas eutropha C91]
 gi|114309062|gb|ABI60305.1| two component transcriptional regulator, winged helix family
           [Nitrosomonas eutropha C91]
          Length = 240

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 61/123 (49%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VED     +L    +  + YI +   +  +A+    +  PD+I++D  L   S
Sbjct: 1   MSATVLVVEDEPAIQELIAYNLRNANYIVVCVNSAEQAVVKINEILPDLILLDWMLLGKS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E  + ++ D   + IPVI +TA   +GD+    + G + YI+KP S    +  IK  +
Sbjct: 61  GIEFARSLRRDPRTRSIPVIMLTARVEEGDKVSGLEAGADDYITKPFSPRELIARIKAVL 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|295107994|emb|CBL21947.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus obeum
           A2-162]
          Length = 233

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    +      +G +AL+      PD+I++D+ L  I G 
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFETKIVNDGEQALKEFNTFHPDLILLDLMLPGIDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ ++I+ +S   ++P+I ++A     D+    + G + YI KP      +  ++  +  
Sbjct: 65  QVCREIRHNS---DVPIIMLSAKGETFDKVLGLELGADDYIIKPFDTKELVARVRAVLRR 121


>gi|229918113|ref|YP_002886759.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
 gi|229469542|gb|ACQ71314.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++ +D E    L    +E  GY  +   NG+EA+E  ++    ++++D+ + E+ G
Sbjct: 5   MFRILVTDDEEQMRDLLVSNLEKEGYETVTASNGLEAIERLKEETFHLVLLDVMMPELDG 64

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L    +I+E      +P+I +TA + + D     K G + YI+KP S    +  I+  + 
Sbjct: 65  LTACMRIRE---FSNVPIILLTARSEELDRIHGLKIGADDYITKPFSPRELLARIEATLR 121

Query: 122 E 122
            
Sbjct: 122 R 122


>gi|148657836|ref|YP_001278041.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148569946|gb|ABQ92091.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 231

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 68/122 (55%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D+   ++L    +E +G+  L   +G  AL LAR  +PD++++D+ L ++ 
Sbjct: 1   MPQRILVVDDDRQIVRLVSAYLEHAGFQTLTAYDGAAALRLARTERPDLMVLDLMLPDVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++T+ I+ D  L  +P+I +TA     D     + G + YI+KP +    +  ++  +
Sbjct: 61  GADLTRTIRADPHLASMPIIMLTARVDDTDRIVGLELGADDYITKPFNPREVVARVRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|15640738|ref|NP_230368.1| DNA-binding response regulator PhoB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121590901|ref|ZP_01678224.1| DNA-binding response regulator PhoB [Vibrio cholerae 2740-80]
 gi|121728615|ref|ZP_01681635.1| DNA-binding response regulator PhoB [Vibrio cholerae V52]
 gi|147674650|ref|YP_001216209.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|153216130|ref|ZP_01950285.1| DNA-binding response regulator PhoB [Vibrio cholerae 1587]
 gi|153803530|ref|ZP_01958116.1| DNA-binding response regulator PhoB [Vibrio cholerae MZO-3]
 gi|153818850|ref|ZP_01971517.1| DNA-binding response regulator PhoB [Vibrio cholerae NCTC 8457]
 gi|153823136|ref|ZP_01975803.1| DNA-binding response regulator PhoB [Vibrio cholerae B33]
 gi|153827132|ref|ZP_01979799.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MZO-2]
 gi|153831184|ref|ZP_01983851.1| DNA-binding response regulator PhoB [Vibrio cholerae 623-39]
 gi|227080898|ref|YP_002809449.1| DNA-binding response regulator PhoB [Vibrio cholerae M66-2]
 gi|229505665|ref|ZP_04395175.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae BX 330286]
 gi|229510663|ref|ZP_04400142.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae B33]
 gi|229513140|ref|ZP_04402606.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TMA 21]
 gi|229517785|ref|ZP_04407229.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC9]
 gi|229523456|ref|ZP_04412863.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TM 11079-80]
 gi|229525367|ref|ZP_04414772.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae bv. albensis VL426]
 gi|229530150|ref|ZP_04419540.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae 12129(1)]
 gi|229608683|ref|YP_002879331.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MJ-1236]
 gi|254224992|ref|ZP_04918606.1| DNA-binding response regulator PhoB [Vibrio cholerae V51]
 gi|254285442|ref|ZP_04960406.1| DNA-binding response regulator PhoB [Vibrio cholerae AM-19226]
 gi|254847860|ref|ZP_05237210.1| DNA-binding response regulator PhoB [Vibrio cholerae MO10]
 gi|255744531|ref|ZP_05418482.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholera CIRS 101]
 gi|258623634|ref|ZP_05718625.1| DNA-binding response regulator PhoB [Vibrio mimicus VM573]
 gi|258626940|ref|ZP_05721742.1| DNA-binding response regulator PhoB [Vibrio mimicus VM603]
 gi|262161335|ref|ZP_06030446.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae INDRE 91/1]
 gi|262168827|ref|ZP_06036522.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC27]
 gi|262172206|ref|ZP_06039884.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           mimicus MB-451]
 gi|297581122|ref|ZP_06943046.1| DNA-binding response regulator PhoB [Vibrio cholerae RC385]
 gi|298499143|ref|ZP_07008950.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MAK 757]
 gi|9655162|gb|AAF93884.1| DNA-binding response regulator PhoB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|99031006|gb|ABF61789.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|121547266|gb|EAX57389.1| DNA-binding response regulator PhoB [Vibrio cholerae 2740-80]
 gi|121629123|gb|EAX61567.1| DNA-binding response regulator PhoB [Vibrio cholerae V52]
 gi|124114445|gb|EAY33265.1| DNA-binding response regulator PhoB [Vibrio cholerae 1587]
 gi|124120940|gb|EAY39683.1| DNA-binding response regulator PhoB [Vibrio cholerae MZO-3]
 gi|125622379|gb|EAZ50699.1| DNA-binding response regulator PhoB [Vibrio cholerae V51]
 gi|126510632|gb|EAZ73226.1| DNA-binding response regulator PhoB [Vibrio cholerae NCTC 8457]
 gi|126519353|gb|EAZ76576.1| DNA-binding response regulator PhoB [Vibrio cholerae B33]
 gi|146316533|gb|ABQ21072.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|148873340|gb|EDL71475.1| DNA-binding response regulator PhoB [Vibrio cholerae 623-39]
 gi|149738998|gb|EDM53310.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MZO-2]
 gi|150424304|gb|EDN16241.1| DNA-binding response regulator PhoB [Vibrio cholerae AM-19226]
 gi|227008786|gb|ACP04998.1| DNA-binding response regulator PhoB [Vibrio cholerae M66-2]
 gi|227012543|gb|ACP08753.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|229333924|gb|EEN99410.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae 12129(1)]
 gi|229338948|gb|EEO03965.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae bv. albensis VL426]
 gi|229339819|gb|EEO04834.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TM 11079-80]
 gi|229344500|gb|EEO09474.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC9]
 gi|229350033|gb|EEO14987.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TMA 21]
 gi|229350628|gb|EEO15569.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae B33]
 gi|229357888|gb|EEO22805.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae BX 330286]
 gi|229371338|gb|ACQ61761.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MJ-1236]
 gi|254843565|gb|EET21979.1| DNA-binding response regulator PhoB [Vibrio cholerae MO10]
 gi|255737562|gb|EET92956.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholera CIRS 101]
 gi|258580764|gb|EEW05711.1| DNA-binding response regulator PhoB [Vibrio mimicus VM603]
 gi|258584085|gb|EEW08843.1| DNA-binding response regulator PhoB [Vibrio mimicus VM573]
 gi|261893282|gb|EEY39268.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           mimicus MB-451]
 gi|262022945|gb|EEY41651.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC27]
 gi|262029085|gb|EEY47738.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae INDRE 91/1]
 gi|297534438|gb|EFH73275.1| DNA-binding response regulator PhoB [Vibrio cholerae RC385]
 gi|297543476|gb|EFH79526.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MAK 757]
 gi|327483513|gb|AEA77920.1| Phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio cholerae LMA3894-4]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E  GY A++  +   A+    +  PD++++D  L   S
Sbjct: 1   MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKLAEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K +   + IPV+ +TA   + D+ R  + G + YI+KP S    +  +K  I
Sbjct: 61  GINLIKHMKREEMTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVI 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|257440003|ref|ZP_05615758.1| two-component response regulator [Faecalibacterium prausnitzii
           A2-165]
 gi|257197551|gb|EEU95835.1| two-component response regulator [Faecalibacterium prausnitzii
           A2-165]
          Length = 299

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K++IV+D     +L R+ ++ +GY+  +  +G  AL L      D++I+D+ +  + G
Sbjct: 72  MAKILIVDDEPRIRELIREHLQYAGYVCEEAGDGSAALSLLSGGGFDLVILDVMMPFMDG 131

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +   ++++        PVI +TA   + D+    +GG + Y+ KP S    +  +K  + 
Sbjct: 132 MTCLREMRA--RHINTPVIILTARGEEYDKLAGLEGGADDYVVKPFSPRELVARVKAVLN 189

Query: 122 E 122
            
Sbjct: 190 R 190


>gi|303241663|ref|ZP_07328161.1| two component transcriptional regulator, winged helix family
           [Acetivibrio cellulolyticus CD2]
 gi|302590778|gb|EFL60528.1| two component transcriptional regulator, winged helix family
           [Acetivibrio cellulolyticus CD2]
          Length = 231

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D +  + + +  +   G+  ++  +G +A+E A + KPD+I++DI L ++ 
Sbjct: 1   MNAKILIVDDEKNIVDILKFNLVKEGFQTIEANDGEQAIECALKEKPDLILLDIMLPKVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + +++++       P+I +TA   + D+    + G + YI+KP S    M  +K  +
Sbjct: 61  GFTVCRKLRQ---TISTPIIMITAKEEEVDKVLGLELGADDYITKPFSTRELMARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|269138436|ref|YP_003295136.1| phosphate regulon transcriptional regulatory protein [Edwardsiella
           tarda EIB202]
 gi|267984096|gb|ACY83925.1| phosphate regulon transcriptional regulatory protein [Edwardsiella
           tarda EIB202]
 gi|304558462|gb|ADM41126.1| Phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda FL6-60]
          Length = 229

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED      +   ++E +GY  L+  +   AL    +  PD+I++D  L   S
Sbjct: 1   MSIRILVVEDETPIRDMVSFVLEQNGYQPLEAESYDGALSQLCEPYPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K +   +EIPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQLIKQLKREPATREIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|196247939|ref|ZP_03146641.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
 gi|196212723|gb|EDY07480.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
          Length = 224

 Score =  168 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++V+D+    +L    +   G    +  NG EAL++    K D++IMDI + E+ G
Sbjct: 1   MARILVVDDDAHIRELVSHFLSLEGLTIHEAANGKEALDVLETTKVDLVIMDIMMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++++   +  ++P++ +TA     ++ +    G + Y+ KP      +  +K  + 
Sbjct: 61  WELCRELR---DYDDVPILMLTAKGETREKVKGFSLGADDYLVKPFDPLELVARVKALLK 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|304406985|ref|ZP_07388639.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
 gi|304343972|gb|EFM09812.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
          Length = 238

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D E   +L +  +E  GY   +  +G  AL +A     D+I++D+ L  I G+E
Sbjct: 7   RILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRMAAGKDYDLIMLDVMLPGIDGVE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  ++++   ++  PVI +TA   + +  +  + G + Y+ KP S    +  +K  +  +
Sbjct: 67  VCSRLRQ---VKATPVIMLTAKGEEMNRVQGFEAGADDYVVKPFSPREVIYRVKAILRRS 123


>gi|332968660|gb|EGK07713.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Psychrobacter sp. 1501(2011)]
          Length = 240

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 67/126 (53%), Gaps = 4/126 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALEL--ARQHKPDVIIMDIQLQE 58
           M K+++I+ED+    +L  D +  + Y       G E L++  A++   D+II+D+ L +
Sbjct: 1   MSKQILIIEDDPDLAELISDYLTMNYYEVHHAPTGQEGLDILDAKERAIDLIILDLMLPD 60

Query: 59  ISGLEITKQIK--EDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
           + G+++ ++I+  ++++  ++P++ +TA     D     + G + YI+KP      +  I
Sbjct: 61  MDGMQVCQKIRGGKNTQTNKVPIVMLTAKGDTTDRVLGLEMGADDYIAKPFEPRELLARI 120

Query: 117 KKYIGE 122
           +  +  
Sbjct: 121 RAVLRR 126


>gi|319651813|ref|ZP_08005938.1| PhoP protein [Bacillus sp. 2_A_57_CT2]
 gi|317396465|gb|EFV77178.1| PhoP protein [Bacillus sp. 2_A_57_CT2]
          Length = 238

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 68/122 (55%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +  + L +  ++ +GY  +   +G E  +LA   KPD+I++D+ L ++ 
Sbjct: 1   MDKKILVVDDEQSIVTLLQYNLQQAGYEVITAMDGQEGKDLAISEKPDLIVLDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++       P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKQLRQQKIA--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|269925905|ref|YP_003322528.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789565|gb|ACZ41706.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 278

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 66/119 (55%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++V+D    + L ++ +   GY      +G  AL+L R   PD++I+DI L  I G
Sbjct: 1   MSRILVVDDEPALLDLLKEHLTMEGYTVDTAPSGEYALDLMRIRPPDLVILDIMLPGIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            E+  +++ D +LQ+IPVI +TA ++  D     + G E Y++KP  +   +  I+  +
Sbjct: 61  YEVCTRMQADPKLQDIPVIMLTAKSLTSDLVAGYESGAEDYVTKPFDIDELLIRIRARL 119


>gi|299134022|ref|ZP_07027215.1| two component transcriptional regulator, winged helix family
           [Afipia sp. 1NLS2]
 gi|298590769|gb|EFI50971.1| two component transcriptional regulator, winged helix family
           [Afipia sp. 1NLS2]
          Length = 234

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  ++  GY       G +A    ++  PD++++D  L  +S
Sbjct: 1   MNARILVVEDEEALSTLLRYNLDAEGYDVETVARGDDADTRLKERVPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|149202581|ref|ZP_01879553.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. TM1035]
 gi|149143863|gb|EDM31897.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. TM1035]
          Length = 229

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++    ++  G+  L   NG EAL +  +  PD+I++D  +  +SG+E
Sbjct: 7   TVLLVEDEPAQREVLGYNLQADGFHVLTASNGEEALLMVAEMPPDIIVLDWMMPNVSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +Q+K  SE + IP+I ++A + + D  R  + G + Y+ KP SL   M  ++  +  
Sbjct: 67  VCRQLKTRSETRGIPIIMLSARSEEVDRVRGLETGADDYVIKPYSLVELMARVRAQLRR 125


>gi|330718004|ref|ZP_08312604.1| DNA-binding response regulator [Leuconostoc fallax KCTC 3537]
          Length = 235

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +  +   GY  +   +G EAL L     PD++++D  L E+ G
Sbjct: 1   MSKILVVDDEKPISDIIKFNLTKEGYDVITAADGKEALSLYSDESPDLVLLDQMLPEVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ +QI+ +    + PVI VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  IEVLRQIRSND---DTPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|323701833|ref|ZP_08113503.1| multi-sensor hybrid histidine kinase [Desulfotomaculum nigrificans
            DSM 574]
 gi|323533137|gb|EGB23006.1| multi-sensor hybrid histidine kinase [Desulfotomaculum nigrificans
            DSM 574]
          Length = 1274

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 76/116 (65%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDN+ N +L + L+  +GY      NG +ALE+  Q   D+++MD+Q+  + G E 
Sbjct: 1055 VLLVEDNQFNQRLIQHLLADNGYRVTLAENGQQALEMLNQSNFDIVLMDMQMPVMDGYET 1114

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            T+ I+ D   + +P+IA+TA AMKGD E+    GC+ Y++KP+   I ++TIKKYI
Sbjct: 1115 TRVIRSDERYKSLPIIALTAHAMKGDNEKCLAAGCDDYLAKPVKRDILIKTIKKYI 1170



 Score =  114 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 67/115 (58%), Gaps = 3/115 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++ ED     +L  + +E +GY  + T  G +AL LA+ ++PDV+++DI L ++SG E+
Sbjct: 796 VLVAEDEWTTKQLIANYLEKAGYTVVATDQGKQALTLAKIYQPDVLVLDILLPDLSGWEV 855

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
             +IK+D E Q+IPV+  +      ++ER    G   +I K +S  + +  ++K 
Sbjct: 856 LAKIKKDQETQDIPVVVCSVL---PEKERAFSLGAVDFIEKTVSEKVLVNRLQKL 907



 Score = 73.2 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISGL 62
             +++++D+++ ++    ++  +GY         EAL  +    +   II+D+ +  + G 
Sbjct: 917  HIVLIDDDKMALEFLNCIVGGAGYQTHSFMLAEEALNYIINGGQVHAIILDLLMPGMDGF 976

Query: 63   EITKQIKEDSELQEIPVIAVTAFA 86
            E    ++ D+  + IPV+  T   
Sbjct: 977  EFLDNLRADANYKSIPVLIYTGKD 1000


>gi|322387744|ref|ZP_08061353.1| DNA-binding response regulator [Streptococcus infantis ATCC 700779]
 gi|321141611|gb|EFX37107.1| DNA-binding response regulator [Streptococcus infantis ATCC 700779]
          Length = 234

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    KPD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEKPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|70726233|ref|YP_253147.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus haemolyticus JCSC1435]
 gi|68446957|dbj|BAE04541.1| alkaline phosphatase synthesis transcriptional regulatory protein
           [Staphylococcus haemolyticus JCSC1435]
          Length = 236

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV++V+D +  + L +  +ET+GYI     +G EALE   + +P+++++D+ L +  
Sbjct: 1   MSQKVLVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALEKVNEIQPELVVLDVMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K I+ D  L  +P++ +TA   + D     + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKTIRSDKNL--VPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|325294901|ref|YP_004281415.1| two component transcriptional regulator, winged helix family
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065349|gb|ADY73356.1| two component transcriptional regulator, winged helix family
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 223

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 71/119 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED+E   +L +  +E + +    T +G EALE  + +  D+II+D+ L   SGL+I
Sbjct: 3   VLLVEDDEDLGELLKYNLEKNQFKVDWTLDGKEALEKIKTNSYDLIILDLMLPGASGLDI 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            K+I+E+S  +++PVI +TA + +  + +    G + Y++KP S+   +  I+  +  A
Sbjct: 63  CKEIRENSINKDVPVIVLTALSDEDTKVKGFSIGADDYVTKPFSMKELLARIEAVLRRA 121


>gi|145593748|ref|YP_001158045.1| response regulator receiver [Salinispora tropica CNB-440]
 gi|145303085|gb|ABP53667.1| response regulator receiver [Salinispora tropica CNB-440]
          Length = 230

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 59/123 (47%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++V++V+D+     +    +  +GY      +G  AL       PD++++D+ L  + 
Sbjct: 1   MTQRVLVVDDDRTVSDVVCRYLVHAGYQVRHVGDGDSALAAVAAEPPDLVVLDLMLPGLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++++       +P+I +TA   + D     + G + Y+SKP S    +  +   +
Sbjct: 61  GLEVCRRLRTKPGG--VPIIMLTARGDEADRVLGLQLGADDYLSKPFSPRELVLRVGSVL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|220906227|ref|YP_002481538.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7425]
 gi|219862838|gb|ACL43177.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7425]
          Length = 566

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 63/118 (53%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D   N+++  D +  +G+  L   +G  AL+ A    PD+I++DI +  + G E
Sbjct: 10  TILVVDDTPTNLEVLFDFLSNAGFKVLFAEDGESALQKANYITPDLILLDILMPGMDGFE 69

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             +++K++   + IPVI +TA     D+ +    G   +I+KP+     +  ++ ++ 
Sbjct: 70  TCQRLKQNGSTRSIPVIFLTALTDTVDKVKGFALGAVDFITKPLQYEEVLARVETHLR 127


>gi|16331854|ref|NP_442582.1| OmpR subfamily [Synechocystis sp. PCC 6803]
 gi|1208484|dbj|BAA10652.1| OmpR subfamily [Synechocystis sp. PCC 6803]
          Length = 241

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 65/121 (53%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++I++D+     L    +E +GY   Q  +G++   LA Q +PD+I++D+ L ++ G
Sbjct: 1   MPRILIIDDDPAISDLVSINLEMAGYDVQQAVDGIKGQALAVQLQPDLIMLDLMLPKVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++++ D    +IPV+ +TA     D+ +    G + Y++KP  +   +  ++  + 
Sbjct: 61  FTVCQRLRRDERTADIPVLMLTALGQIQDKIQGFDSGADDYLTKPFDVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|66048256|ref|YP_238097.1| response regulator receiver:transcriptional regulatory protein,
           C-terminal [Pseudomonas syringae pv. syringae B728a]
 gi|71734112|ref|YP_277191.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485715|ref|ZP_05639756.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289628101|ref|ZP_06461055.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651289|ref|ZP_06482632.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|289677407|ref|ZP_06498297.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. syringae FF5]
 gi|298489418|ref|ZP_07007429.1| Phosphate regulon transcriptional regulatory protein phoB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302187091|ref|ZP_07263764.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. syringae 642]
 gi|63258963|gb|AAY40059.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Pseudomonas syringae pv. syringae B728a]
 gi|71554665|gb|AAZ33876.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298155992|gb|EFH97101.1| Phosphate regulon transcriptional regulatory protein phoB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320321732|gb|EFW77830.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331482|gb|EFW87422.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330870966|gb|EGH05675.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330890623|gb|EGH23284.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330937451|gb|EGH41417.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330952444|gb|EGH52704.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae Cit 7]
 gi|330970220|gb|EGH70286.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330986909|gb|EGH85012.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011999|gb|EGH92055.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 229

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  ++  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|330961382|gb|EGH61642.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 229

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  ++  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|220935638|ref|YP_002514537.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996948|gb|ACL73550.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 216

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 61/120 (50%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K V+IVED     ++    +  +G+   +  +G EA E      PD+I++D  L   SG+
Sbjct: 8   KTVLIVEDEPAIREMVSFALARAGFEVDEAVDGGEAQERIASRLPDMILLDWMLPGTSGI 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ +++K D   +++P+I +TA   + D     + G + Y++KP S    +  IK  +  
Sbjct: 68  DLARRLKRDEYTRDVPIIMLTARGEEDDRVGGLEAGVDDYVTKPFSPRELVARIKAVMRR 127


>gi|212638880|ref|YP_002315400.1| transcriptional regulator of redox response ResD (REC-wHTH)
           [Anoxybacillus flavithermus WK1]
 gi|212560360|gb|ACJ33415.1| Transcriptional regulator of redox response ResD (REC-wHTH)
           [Anoxybacillus flavithermus WK1]
          Length = 244

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D E   +L R  +E   Y+  +  NG EAL LA ++  D+I++D+ L    G+E
Sbjct: 12  KILVVDDEERIRRLLRMYLEREQYVIDEAENGEEALALALENDYDLILLDLMLPGKDGIE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + KQ++E    +  PVI +TA   + +  +  + G + YI KP S    +  +K  +  
Sbjct: 72  VCKQLREK---KATPVIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLRR 127


>gi|90426389|ref|YP_534759.1| two component transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90108403|gb|ABD90440.1| two component transcriptional regulator, winged helix family
           [Rhodopseudomonas palustris BisB18]
          Length = 234

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 64/123 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++VED E    L R  ++  GY       G +A    ++  PD++++D  L  +S
Sbjct: 1   MSARILVVEDEEALTTLLRYNLDAEGYDVETVARGDDADTRLKERIPDLVVLDWMLPGLS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++   E +++P+I +TA   + +  R    G + YI KP S+   +  +K  +
Sbjct: 61  GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL 120

Query: 121 GEA 123
             A
Sbjct: 121 RRA 123


>gi|315613222|ref|ZP_07888132.1| response regulator [Streptococcus sanguinis ATCC 49296]
 gi|315314784|gb|EFU62826.1| response regulator [Streptococcus sanguinis ATCC 49296]
          Length = 252

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   NG EA+EL    +PD+II+D+ L EI G
Sbjct: 18  MKKILIVDDEKPISDIIKFNMAKEGYEVVTAFNGREAIELFEAEQPDIIILDLMLPEIDG 77

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 78  LEVAKSIRK---TSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 134

Query: 122 E 122
            
Sbjct: 135 R 135


>gi|302871716|ref|YP_003840352.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574575|gb|ADL42366.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 232

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 72/121 (59%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K ++IV+D +  ++L +  +   GY   +  +G++ALE+ + +K D++I+DI + +  G
Sbjct: 1   MKSILIVDDEQHILELLKFNLRKEGYNTFEADSGVQALEILKNNKVDLVILDIMMSDKDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ K+I+ + + + +PVI ++A + + D+    + G + YI+KP S+   +  +K  + 
Sbjct: 61  YEVLKEIRFNRDTKNLPVILLSAKSEEIDKILGLELGADDYITKPFSVKELVVRVKALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|15600553|ref|NP_254047.1| two-component response regulator PhoB [Pseudomonas aeruginosa PAO1]
 gi|116053507|ref|YP_793834.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152987707|ref|YP_001351454.1| two-component response regulator PhoB [Pseudomonas aeruginosa PA7]
 gi|218894463|ref|YP_002443333.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           LESB58]
 gi|254237949|ref|ZP_04931272.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           C3719]
 gi|254243755|ref|ZP_04937077.1| two-component response regulator PhoB [Pseudomonas aeruginosa 2192]
 gi|296392220|ref|ZP_06881695.1| two-component response regulator PhoB [Pseudomonas aeruginosa PAb1]
 gi|313106787|ref|ZP_07793002.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           39016]
 gi|12230950|sp|P23620|PHOB_PSEAE RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|9951681|gb|AAG08745.1|AE004948_1 two-component response regulator PhoB [Pseudomonas aeruginosa PAO1]
 gi|115588728|gb|ABJ14743.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169880|gb|EAZ55391.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           C3719]
 gi|126197133|gb|EAZ61196.1| two-component response regulator PhoB [Pseudomonas aeruginosa 2192]
 gi|150962865|gb|ABR84890.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas aeruginosa PA7]
 gi|218774692|emb|CAW30509.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           LESB58]
 gi|310879504|gb|EFQ38098.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           39016]
          Length = 229

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   KTILIVDDEAPIREMIAVALEMAGYECLEAENTQQAHAVIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTVDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123


>gi|260177202|gb|ACX33925.1| putative two-component regulatory system response regulator
           [uncultured prokaryote AT5]
          Length = 234

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 66/124 (53%), Gaps = 1/124 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M+K  ++IVED E  + L R  +E  GY       G EA  L ++  PD++I+D  L  +
Sbjct: 1   MMKANILIVEDEEALVLLLRYNLEAEGYGVETVARGDEADLLLKERSPDLVILDWMLPGL 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           SG+E+ ++++  +E + +P+I +TA   + +  R    G + YI KP S+      ++  
Sbjct: 61  SGIELCRRLRARAETKRLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELSARVRAL 120

Query: 120 IGEA 123
           +  A
Sbjct: 121 LRRA 124


>gi|237808813|ref|YP_002893253.1| two component transcriptional regulator PhoB, winged helix family
           [Tolumonas auensis DSM 9187]
 gi|237501074|gb|ACQ93667.1| two component transcriptional regulator PhoB, winged helix family
           [Tolumonas auensis DSM 9187]
          Length = 229

 Score =  168 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 66/123 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +V++VED     ++   ++E  GY  ++  +  EA+ L ++  P++I++D  +   S
Sbjct: 1   MSMRVLVVEDEAPIREMLCFMLEQKGYEPVEAADFTEAVALVKEPYPELILLDWMIPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K++   + IP++ +TA   + D+ R  + G + YI+KP S       IK  +
Sbjct: 61  GIQFIKLMKQEELTRNIPIVMLTARGEEEDKVRGLEVGADDYITKPFSPKELTARIKAVM 120

Query: 121 GEA 123
             +
Sbjct: 121 RRS 123


>gi|333026940|ref|ZP_08455004.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332746792|gb|EGJ77233.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 276

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++V+D+    ++    +  +G    +  +G  AL  A  H+PD++++D+ L  + GLE
Sbjct: 18  HVLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTHRPDLVVLDLMLPGMDGLE 77

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++E      +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 78  VCRRMRERHP---VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRR 133


>gi|52786788|ref|YP_092617.1| PhoP [Bacillus licheniformis ATCC 14580]
 gi|163119589|ref|YP_080203.2| two-component response regulator [Bacillus licheniformis ATCC
           14580]
 gi|319647320|ref|ZP_08001542.1| PhoP protein [Bacillus sp. BT1B_CT2]
 gi|52349290|gb|AAU41924.1| PhoP [Bacillus licheniformis ATCC 14580]
 gi|145903099|gb|AAU24565.2| two-component response regulator [Bacillus licheniformis ATCC
           14580]
 gi|317390667|gb|EFV71472.1| PhoP protein [Bacillus sp. BT1B_CT2]
          Length = 240

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G   L  A + KPD+I++D+ L ++ 
Sbjct: 1   MSKKILVVDDEESIVTLLKYNLERSGYHVVTAMDGEAGLLKAIEEKPDLIVLDLMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K++++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 61  GIEVCKELRQKKLMY--PILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVTARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|146321223|ref|YP_001200934.1| response regulator [Streptococcus suis 98HAH33]
 gi|253753905|ref|YP_003027046.1| response regulator protein [Streptococcus suis P1/7]
 gi|253755220|ref|YP_003028360.1| response regulator protein [Streptococcus suis BM407]
 gi|330832445|ref|YP_004401270.1| response regulator [Streptococcus suis ST3]
 gi|145692029|gb|ABP92534.1| Response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Streptococcus suis
           98HAH33]
 gi|251817684|emb|CAZ55432.1| response regulator protein [Streptococcus suis BM407]
 gi|251820151|emb|CAR46488.1| response regulator protein [Streptococcus suis P1/7]
 gi|292558663|gb|ADE31664.1| Response regulator receiver: Transcriptional regulatory protein,
           C-terminal [Streptococcus suis GZ1]
 gi|319758447|gb|ADV70389.1| response regulator [Streptococcus suis JS14]
 gi|329306668|gb|AEB81084.1| response regulator [Streptococcus suis ST3]
          Length = 234

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EALE+     PD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAEFPDIVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVARTIRK---TSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|254461523|ref|ZP_05074939.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodobacterales bacterium HTCC2083]
 gi|206678112|gb|EDZ42599.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 227

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 70/118 (59%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED     ++    +E  GY  LQ  +G E L LAR++ PD+I++D  L E+SG+E+
Sbjct: 6   ILVVEDEAAQREVLSYNLEAEGYRVLQGESGDEGLLLARENVPDLIVLDWMLPEMSGIEV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +Q+K D+  + IP+I ++A +   D+ R  + G + Y++KP S+   M  +K  +  
Sbjct: 66  CRQVKSDTTTKAIPIIMLSARSEDVDKVRGLETGADDYVAKPYSVKELMARVKAQLRR 123


>gi|294495497|ref|YP_003541990.1| response regulator receiver protein [Methanohalophilus mahii DSM
           5219]
 gi|292666496|gb|ADE36345.1| response regulator receiver protein [Methanohalophilus mahii DSM
           5219]
          Length = 170

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 63/121 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++I++D    +   +  +++ GY  ++  NG   LE   +  PD+I++D+ + ++ G 
Sbjct: 48  QTILIIDDEPDAIIAAKRALQSEGYNVIEAYNGKTGLEAIEEKTPDLILLDVMMPDMDGF 107

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           EI KQ+K+D     IP+I +TA     D     + G + YI+KP +L      I+  +  
Sbjct: 108 EICKQLKKDELYNHIPIIMLTAKGEVDDRIEGIETGADDYITKPFNLRELKARIRMVLRR 167

Query: 123 A 123
           A
Sbjct: 168 A 168


>gi|325273090|ref|ZP_08139394.1| histidine kinase [Pseudomonas sp. TJI-51]
 gi|324101779|gb|EGB99321.1| histidine kinase [Pseudomonas sp. TJI-51]
          Length = 305

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 60/118 (50%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++VEDN +N  + + ++   G        G EAL    +   D+++MD  +  + G 
Sbjct: 184 ARILLVEDNPVNQLVAKGMLAKLGCQVELATQGAEALAALERQPFDLVLMDCNMPVMDGY 243

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E +++I++      +P++A+TA AM  + ER R  G   Y++KP      +  +  ++
Sbjct: 244 EASRRIRQSGRWPHLPIVALTANAMPEERERCRAAGMNDYLAKPFRREELLALVDHWV 301


>gi|332654461|ref|ZP_08420204.1| DNA-binding response regulator SrrA [Ruminococcaceae bacterium D16]
 gi|332516425|gb|EGJ46031.1| DNA-binding response regulator SrrA [Ruminococcaceae bacterium D16]
          Length = 233

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +KV+IVED+    +L    +E  G+     ++G + +E  R  +P ++++DI L  + 
Sbjct: 1   MAQKVLIVEDDSNIAELLHLYLEKEGFETKVAKDGGKGVEYFRSFQPALVLLDIMLPVMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + K+I+E+S     PVI +TA     D+    + G + YI KP  +   +  I   +
Sbjct: 61  GWTVLKKIREESAT---PVIMLTAKGETEDKVTGLESGADDYIVKPFEMKEVLARIHAVM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|189424026|ref|YP_001951203.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
 gi|189420285|gb|ACD94683.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
          Length = 1245

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 4    KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +V++VEDN++N ++  +L+ ++G       NG  A+ELA QH+ D ++MDIQ+  + G E
Sbjct: 987  RVLLVEDNDMNQQVACELLTSAGIEVTVADNGHTAVELAAQHRFDTVLMDIQMPVMDGYE 1046

Query: 64   ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             ++ I+ D   +++P+IA+TA AM  D +R  + G   Y+SKPI+      T++++ G A
Sbjct: 1047 ASRLIRADQACRDLPIIAMTAHAMPQDRQRCLESGMNDYVSKPINPQELYSTLERW-GRA 1105



 Score = 57.8 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR--QHKPDVIIMDIQLQEISG 61
           K+++++D+  +  +F  L  + G  A    +  E L      +   D++++D  L  + G
Sbjct: 838 KLLVLDDSARSRDIFEGLFYSLGCRAELAASAQEGLGCLERSEKPYDLLLLDDSLSGLDG 897

Query: 62  LEITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116
             + +Q++  S L   P +I +T +  +   +++ + G +  +++P++L    + +
Sbjct: 898 FAVARQVRRMSPLHHQPKIIMITGYGDEEAHKQVVEEGLDGCLTRPVTLRSLFDAV 953


>gi|23099620|ref|NP_693086.1| two-component response regulator [Oceanobacillus iheyensis HTE831]
 gi|22777850|dbj|BAC14121.1| two-component response regulator involved in phosphate regulation
           [Oceanobacillus iheyensis HTE831]
          Length = 231

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K+++IV+D +  + L +  +E SG+      NG EA+  A     D+I++D+ L E+ 
Sbjct: 1   MSKRILIVDDEKSIVTLLKYNMENSGFETDVAYNGQEAINKAEASMYDLIVLDLMLPEVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ + ++ +      P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMEVCRTLRMNQV--NTPILMLTAKDEEFDKVLGLEMGADDYLTKPFSPKEVIARVKAIL 118

Query: 121 GEA 123
             +
Sbjct: 119 RRS 121


>gi|168334600|ref|ZP_02692753.1| two component transcriptional regulator, winged helix family
           protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 232

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VED +    + +  +E  GY  L   +G E LE+     PD++++DI + ++ G
Sbjct: 1   MPKVVVVEDEKAISDIIKYNLEKEGYEVLVAYDGEEGLEMILTTNPDIVLLDIMMPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L + K +++    + +P+I +TA A + D+    + G + YI+KP  +   +  +K  + 
Sbjct: 61  LSVCKLVRK---TKNMPIIMLTAKAEEIDKVVGLELGADDYITKPFGMRELIARVKAQLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|114794859|pdb|2IYN|A Chain A, The Co-Factor-Induced Pre-Active Conformation In Phob
 gi|114794860|pdb|2IYN|B Chain B, The Co-Factor-Induced Pre-Active Conformation In Phob
 gi|114794861|pdb|2IYN|C Chain C, The Co-Factor-Induced Pre-Active Conformation In Phob
          Length = 124

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|219848013|ref|YP_002462446.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219542272|gb|ACL24010.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 236

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  V+IVED     +  R  +E  GY  +   +G++ L+ AR+ +PD++++DI L  + G
Sbjct: 1   MATVLIVEDETTLAETLRYNLEREGYAVIIAGDGVQGLDRARRDQPDLVVLDIMLPRLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + ++++S   ++P+I +TA   + D     + G + YISKP SL  F+  ++  + 
Sbjct: 61  FSVCRILRQES---DVPIIMLTARQDEVDRIAGLELGADDYISKPFSLGEFLARVRAILR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|138894462|ref|YP_001124915.1| two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|134265975|gb|ABO66170.1| Two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
          Length = 226

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 61/121 (50%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++V+D+    +L    +   G    +  NG EAL++    K D++IMDI + E+ G
Sbjct: 3   MARILVVDDDAHIRELVSHFLSLEGLTIHEAANGKEALDVLETTKVDLVIMDIMMPEMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++++   +  ++P++ +TA     ++ +    G + Y+ KP      +  +K  + 
Sbjct: 63  WELCRELR---DYDDVPILMLTAKGETREKVKGFSLGADDYLVKPFDPLELVARVKALLK 119

Query: 122 E 122
            
Sbjct: 120 R 120


>gi|315604878|ref|ZP_07879936.1| DNA-binding response regulator [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315313417|gb|EFU61476.1| DNA-binding response regulator [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 227

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 63/121 (52%), Gaps = 3/121 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D+    ++   +++  G+  +   +G +AL   ++H PD++++D+ L  + 
Sbjct: 1   MSSRILVVDDDLALAEMIGIVLQNEGFRVVFCGDGSQALAQFQEHHPDLVLLDVMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ + I+    + ++P++ +TA +   D     + G + Y+ KP      +  ++  +
Sbjct: 61  GFDVCRAIR---HVSDVPIVMLTARSDTSDVVTGLEAGADDYVPKPFKPKELVARVRARL 117

Query: 121 G 121
            
Sbjct: 118 R 118


>gi|56963600|ref|YP_175331.1| two-component response regulator [Bacillus clausii KSM-K16]
 gi|56909843|dbj|BAD64370.1| two-component response regulator [Bacillus clausii KSM-K16]
          Length = 238

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D E   +L R  +E   Y   +  NG EALELA   + D+I++D+ +  + G+E
Sbjct: 6   TLLVVDDEERIRRLLRMYLEREEYQIEEASNGEEALELALAKEYDLILLDVMMPGMDGVE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +++++    +  PV+ +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 66  MCQELRKK---KATPVMMLTAKGEEANRVQGFEVGADDYIVKPFSPREVVLRVKALLRRA 122


>gi|15614507|ref|NP_242810.1| two-component response regulator [Bacillus halodurans C-125]
 gi|10174562|dbj|BAB05663.1| two-component response regulator [Bacillus halodurans C-125]
          Length = 229

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 5/124 (4%)

Query: 1   MLKK--VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE 58
           M K+  ++IV+D     +L    +   G+       G EA++   Q   D++++D+ + E
Sbjct: 1   MNKRHNILIVDDELDLRELVTSYLRKEGFAVYTAETGDEAIKRLEQEPMDLVVLDVMMDE 60

Query: 59  ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + G    K+I+      +IP+I +TA   + D+    + G + YI KP S    +  I+ 
Sbjct: 61  MDGFTACKEIRA---FSQIPIIMLTARGGEDDKVMGLQIGADDYIVKPFSPRELVARIEV 117

Query: 119 YIGE 122
            +  
Sbjct: 118 ALRR 121


>gi|310766801|gb|ADP11751.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia sp. Ejp617]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+K++++VED     ++   ++E + Y  ++  +   A+ L  +  PD+I++D  L   S
Sbjct: 1   MVKRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDRAVNLLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|225574100|ref|ZP_03782711.1| hypothetical protein RUMHYD_02165 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038700|gb|EEG48946.1| hypothetical protein RUMHYD_02165 [Blautia hydrogenotrophica DSM
           10507]
          Length = 242

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 57/120 (47%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    Y      +G +AL      +PD+I++D+ L  + G 
Sbjct: 15  QKILIVDDDNNIAELIALYLTKECYDTCIVNDGEQALREFEHFRPDLILLDLMLPGMDGY 74

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ ++I+      ++P+I ++A     D+    + G + YI KP      +  +K  +  
Sbjct: 75  QVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYIIKPFDSKELVARVKAVLRR 131


>gi|29830590|ref|NP_825224.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29607702|dbj|BAC71759.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 243

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IV+D     +  +  +   GY      +G +ALE A  ++PD++++DIQ+  + GL
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKATAYQPDLVVLDIQMPRMDGL 70

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++I+        P++ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 71  TAARRIR--GAGTTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128

Query: 123 A 123
           +
Sbjct: 129 S 129


>gi|332975597|gb|EGK12487.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 234

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++VED E   +L  + +   G+      +G E   + +Q +PD++I+D  L  + G
Sbjct: 1   MSHILLVEDEERLGQLISEQLRLEGHRVTVASDGEEGYRMWKQEQPDLVILDWMLPRMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ ++I+E      +PV+ +TA   + ++    + G + Y++KP S       ++  + 
Sbjct: 61  VEVCRKIRE---TSIVPVMMLTAKGDEMEKVWGLEVGADDYMTKPFSTWELKARVRALLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|313885587|ref|ZP_07819337.1| transcriptional regulatory protein WalR [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619317|gb|EFR30756.1| transcriptional regulatory protein WalR [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 234

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    +    ++  GY  +   +G EALE   +  PD++++D+ L + +G
Sbjct: 1   MHKILVVDDEKPISDIITYTLKNEGYDIVTAFDGEEALEQFEKENPDLVLLDLMLPKKTG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I++DS    +P+I +TA   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVCREIRKDSA---VPIIMLTAKDSEIDKVVGLELGADDYVTKPFSNRELAARVKASLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|169832040|ref|YP_001718022.1| two component transcriptional regulator [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638884|gb|ACA60390.1| two component transcriptional regulator, winged helix family
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 227

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED      + R  +E  G+  +   +G +ALE      PD++I+DI L +  G  +
Sbjct: 6   ILMVEDEAAVRDVARLYLEKEGFRVVPALDGEQALEQLTAVNPDLVILDIMLPKKDGWSV 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
            ++I+  +    +P+I ++A   + D     + G + Y++KP S    +  +K  +  +
Sbjct: 66  CREIRRQTA---VPIIMLSAKGEEYDRVLGLELGADDYVTKPFSPRELVARVKAVLRRS 121


>gi|317968094|ref|ZP_07969484.1| two-component response regulator [Synechococcus sp. CB0205]
          Length = 249

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D     ++    +   GY  +   +G EALE  R   PD++++D+ + ++ G  
Sbjct: 11  TILVVDDEPSIRRILETRLSMIGYQVVTACDGQEALEAFRNTNPDLVVLDVMMPKLDGYG 70

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P++ +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 71  VCQELRKES---DVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 126


>gi|258514817|ref|YP_003191039.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778522|gb|ACV62416.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M ++++ V+D+   +K+ +  +   G+  +   +G EAL+ ARQ  PD++I+D+ +  + 
Sbjct: 1   MPQRILTVDDDPKILKILQHSLGKEGFEVITASSGEEALQKARQSSPDLVILDLMMPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E  +++K     +E+P+I ++A   + D     + G + Y +KP S +     +K  +
Sbjct: 61  GFETYQKLKAQ---REVPIIILSARTEEVDRVVGFRMGVDDYQTKPFSPTELALRVKAVL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|332977343|gb|EGK14128.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 241

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D +   +L R  +E  GY+  +  +G  AL+   +   D+I++D+ L  + G++
Sbjct: 9   RILVVDDEDRIRRLLRMYLEREGYLIDEAEDGETALKKGLEIDYDLILLDLMLPGMDGVD 68

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++     +  PVI +TA   + +     + G + Y+ KP S    +  +K  +  +
Sbjct: 69  VCRELRNK---KATPVIMLTARGEETNRVEGFEAGTDDYVVKPFSPRELVHRVKAVLRRS 125


>gi|325263883|ref|ZP_08130616.1| subtilin biosynthesis regulatory protein SpaR [Clostridium sp. D5]
 gi|324030921|gb|EGB92203.1| subtilin biosynthesis regulatory protein SpaR [Clostridium sp. D5]
          Length = 224

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 4/122 (3%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++ +D    ++L RD  E  GY      NG+EAL+    H PD+I++D+ +  I 
Sbjct: 1   MSKKILVADDEPGIVQLLRDYFEMQGYEVASASNGVEALDQ-SSHNPDLILLDVNMPGID 59

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ + I+   +    P++ +TA   + D  +    G + YI KP S+      ++ ++
Sbjct: 60  GFEVCRMIR---DHVSCPILFLTAKVEEQDRIQGLMLGGDDYILKPFSIDELGARVEAHL 116

Query: 121 GE 122
             
Sbjct: 117 RR 118


>gi|229593403|ref|YP_002875522.1| phosphate regulon two-component system response regulator
           [Pseudomonas fluorescens SBW25]
 gi|312963904|ref|ZP_07778375.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens WH6]
 gi|229365269|emb|CAY53596.1| phosphate regulon two-component system, response regulator
           [Pseudomonas fluorescens SBW25]
 gi|311281939|gb|EFQ60549.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens WH6]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|332827076|gb|EGJ99861.1| hypothetical protein HMPREF9455_03734 [Dysgonomonas gadei ATCC
            BAA-286]
          Length = 1355

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            V++VEDNE  + L  +++    Y  L   NG+EAL+  + +  D++I D+ +  + GLE+
Sbjct: 1108 VLLVEDNEELLTLIGNILSKH-YHVLTASNGVEALDRVKDNDIDIVISDVMMPRMDGLEL 1166

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             +++K+D E   IPVI +TA     D       G + YISKP  L +    I  ++
Sbjct: 1167 CRRLKKDIETSHIPVILLTAKNSADDRIECYNAGADGYISKPFELKVLEARINNFL 1222


>gi|332971704|gb|EGK10652.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 237

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V+I +D +    L +  +E   Y      NG EAL L   +K ++II+D+ + ++ G+E
Sbjct: 5   RVLIADDEKEIRDLLKKYLEKEFYKVDVAGNGEEALHLFDDNKYNLIILDLMMPKVDGIE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++  +    +P++ +TA   + D+      G + YI+KP S++  +  +K  +  
Sbjct: 65  VCRRLRNKT---NVPILMLTAKDHEVDKILGLSIGADDYITKPFSINEVVARVKALLRR 120


>gi|311031361|ref|ZP_07709451.1| two-component response regulator PhoP [Bacillus sp. m3-13]
          Length = 242

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++IV+D +  + L +  ++ +GY      +G E L  A + + D+I++D+ L +  
Sbjct: 1   MNKKILIVDDEQSIVTLLQYNLQQAGYDVSVAMDGEEGLNKAMEERFDMIVLDLMLPKKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ K++++       P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKELRQHKI--HTPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|153814218|ref|ZP_01966886.1| hypothetical protein RUMTOR_00427 [Ruminococcus torques ATCC 27756]
 gi|317500010|ref|ZP_07958245.1| DNA-binding response regulator VicR [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087760|ref|ZP_08336686.1| hypothetical protein HMPREF1025_00269 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848614|gb|EDK25532.1| hypothetical protein RUMTOR_00427 [Ruminococcus torques ATCC 27756]
 gi|316898495|gb|EFV20531.1| DNA-binding response regulator VicR [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409741|gb|EGG89177.1| hypothetical protein HMPREF1025_00269 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 228

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D +L +K  R  +E  G       +G EALE A+  + D++++D+ L ++ 
Sbjct: 1   MGKRILVVDDEKLIVKGIRFSLEQEGMEVDCAYDGEEALEYAKACEYDLVLLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ +QI+E     ++PV+ +TA +   D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFQVCQQIRE---FSDMPVVMLTAKSEDMDKILGLEYGADDYITKPFNILEVKARIKAIM 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|282601102|ref|ZP_05980740.2| DNA-binding response regulator ResD [Subdoligranulum variabile DSM
           15176]
 gi|282570663|gb|EFB76198.1| DNA-binding response regulator ResD [Subdoligranulum variabile DSM
           15176]
          Length = 271

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D      L R+ ++ +G+   +  +G  AL +  Q   D++I+DI +  + G
Sbjct: 45  MAKILVVDDEPRIRDLIREHLQYAGFTCEEAGDGAAALSILTQGGIDLVILDIMMPFMDG 104

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +   ++++    +   PVI +TA + + D+    +GG + Y+ KP S    +  +K  + 
Sbjct: 105 MTCLREMRTRKIM--TPVIMLTARSEEYDKLAGLEGGADDYVVKPFSPRELVARVKAVLA 162

Query: 122 E 122
            
Sbjct: 163 R 163


>gi|119513113|ref|ZP_01632166.1| Two Component Transcriptional Regulator, LuxR family protein
           [Nodularia spumigena CCY9414]
 gi|119462247|gb|EAW43231.1| Two Component Transcriptional Regulator, LuxR family protein
           [Nodularia spumigena CCY9414]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 63/122 (51%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D     +   D ++ SG+      N  E  +  +Q+ PD++I D+ + ++ 
Sbjct: 1   MSAQLLLVDDEPGLREAVSDYLQESGFSVQVASNAREGWDWMQQNTPDLVISDVMMPQVD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G +  KQ++ED   Q +PVI +TA  M GD  +  + G +AY+ KP      +  ++  +
Sbjct: 61  GYQFLKQLREDPRFQTVPVIFLTAKGMTGDRIQGYQAGVDAYLPKPFDPDELVAIVENLL 120

Query: 121 GE 122
             
Sbjct: 121 SR 122


>gi|117620062|ref|YP_854674.1| GltR [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561469|gb|ABK38417.1| GltR [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 244

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K+++IV+D++   +L  + +  +G+  L    G E  +L  QH PD+II+DI +    G
Sbjct: 8   SKQLLIVDDDQEIRELLNEYLTRAGFEVLTAAEGNEMRKLLAQHNPDLIILDIMMPGDDG 67

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + +QI+ DS+   +P+I +TA + + D     + G + YI+KP S       IK  + 
Sbjct: 68  FTLCQQIRRDSQ---VPIIMLTAASDEADRVIGLELGADDYITKPFSPRELQARIKALLR 124

Query: 122 EA 123
            A
Sbjct: 125 RA 126


>gi|262276591|ref|ZP_06054400.1| phosphate regulon transcriptional regulatory protein PhoB
           [Grimontia hollisae CIP 101886]
 gi|262220399|gb|EEY71715.1| phosphate regulon transcriptional regulatory protein PhoB
           [Grimontia hollisae CIP 101886]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M++++++VED     ++   ++E  GY A++  +   ALE   +  P++I+MD  L   S
Sbjct: 1   MVRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSALEKICEPYPELILMDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IP++ +TA   + D+ R  + G + YI+KP S    M  +K  +
Sbjct: 61  GINLIKHLKRDELTRQIPIVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|78484886|ref|YP_390811.1| two component transcriptional regulator [Thiomicrospira crunogena
           XCL-2]
 gi|78363172|gb|ABB41137.1| two component transcriptional regulator, winged helix family
           [Thiomicrospira crunogena XCL-2]
          Length = 230

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 60/118 (50%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED      +    +  + Y  ++  N  +  +L  +H+PD +++D  L  +SG+ +
Sbjct: 6   ILVVEDEAAIRDMLSFTLTAANYKVIEAPNAEQGWKLLLEHQPDCVLLDWMLPGVSGISL 65

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            ++I+++ +    P+I +TA   + D+ +  + G + Y+ KP S    +  +K  +  
Sbjct: 66  AQRIRQNDQTATTPIIMLTARGEENDQVQGFESGADDYVVKPFSPRALVARVKALLRR 123


>gi|223932685|ref|ZP_03624684.1| two component transcriptional regulator, winged helix family
           [Streptococcus suis 89/1591]
 gi|223898655|gb|EEF65017.1| two component transcriptional regulator, winged helix family
           [Streptococcus suis 89/1591]
          Length = 234

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   +G EALE+     PD++I+D+ L E+ G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAEFPDIVILDLMLPELDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVARTIRK---TSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|16802333|ref|NP_463818.1| hypothetical protein lmo0287 [Listeria monocytogenes EGD-e]
 gi|47096376|ref|ZP_00233971.1| DNA-binding response regulator [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498864|ref|ZP_03667213.1| hypothetical protein LmonF1_03833 [Listeria monocytogenes Finland
           1988]
 gi|224502419|ref|ZP_03670726.1| hypothetical protein LmonFR_07849 [Listeria monocytogenes FSL
           R2-561]
 gi|254828747|ref|ZP_05233434.1| DNA-binding response regulator [Listeria monocytogenes FSL N3-165]
 gi|254900524|ref|ZP_05260448.1| hypothetical protein LmonJ_11939 [Listeria monocytogenes J0161]
 gi|254913525|ref|ZP_05263537.1| DNA-binding response regulator [Listeria monocytogenes J2818]
 gi|254937894|ref|ZP_05269591.1| DNA-binding response regulator [Listeria monocytogenes F6900]
 gi|255026056|ref|ZP_05298042.1| hypothetical protein LmonocytFSL_06315 [Listeria monocytogenes FSL
           J2-003]
 gi|255029993|ref|ZP_05301944.1| hypothetical protein LmonL_14634 [Listeria monocytogenes LO28]
 gi|284800586|ref|YP_003412451.1| hypothetical protein LM5578_0333 [Listeria monocytogenes 08-5578]
 gi|284993772|ref|YP_003415540.1| hypothetical protein LM5923_0332 [Listeria monocytogenes 08-5923]
 gi|16409652|emb|CAD00814.1| lmo0287 [Listeria monocytogenes EGD-e]
 gi|47015250|gb|EAL06188.1| DNA-binding response regulator [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258601154|gb|EEW14479.1| DNA-binding response regulator [Listeria monocytogenes FSL N3-165]
 gi|258610502|gb|EEW23110.1| DNA-binding response regulator [Listeria monocytogenes F6900]
 gi|284056148|gb|ADB67089.1| hypothetical protein LM5578_0333 [Listeria monocytogenes 08-5578]
 gi|284059239|gb|ADB70178.1| hypothetical protein LM5923_0332 [Listeria monocytogenes 08-5923]
 gi|293591535|gb|EFF99869.1| DNA-binding response regulator [Listeria monocytogenes J2818]
          Length = 237

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +    + +  +   G+      +G EALEL  + +PD+I++DI L    G+
Sbjct: 4   KKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEEVQPDLILLDIMLPGRDGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 64  EVCREVRKK---YDMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELIARVKANLRR 120


>gi|229551746|ref|ZP_04440471.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|258507899|ref|YP_003170650.1| two-component response regulator [Lactobacillus rhamnosus GG]
 gi|258539145|ref|YP_003173644.1| two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|229314877|gb|EEN80850.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|257147826|emb|CAR86799.1| Two-component response regulator [Lactobacillus rhamnosus GG]
 gi|257150821|emb|CAR89793.1| Two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|259649226|dbj|BAI41388.1| two-component response regulator [Lactobacillus rhamnosus GG]
          Length = 234

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D    + L +  +E   Y      +G EAL+  R    D II+D+ L  +SG
Sbjct: 1   MKKILIVDDEPAILTLLQYNLEAEHYQVETATDGQEALDKVRSEPFDFIILDLMLPSLSG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++T++I+E+    + P++ +TA   + D+    + G + Y++KP S    +  IK    
Sbjct: 61  LDVTRKIREEKI--QTPIMILTAKDNETDKIVGLELGADDYVTKPFSPREIIARIKAIER 118

Query: 122 EA 123
            +
Sbjct: 119 RS 120


>gi|298493190|ref|YP_003723367.1| winged helix family two component transcriptional regulator
           ['Nostoc azollae' 0708]
 gi|298235108|gb|ADI66244.1| two component transcriptional regulator, winged helix family
           ['Nostoc azollae' 0708]
          Length = 247

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 64/121 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++++D+    +L    +E +GY   Q  +G++   LA Q +PD+I++D+ L  + G
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKGQALALQLQPDLIMLDLMLPRVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             I ++++ D    EIPV+ +TA +    +      G + Y++KP  +   +  ++  + 
Sbjct: 61  FTICQRLRRDERTAEIPVLMLTALSQTQYKVEGFNAGADDYLTKPFEVEEMLARVRALLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|226329135|ref|ZP_03804653.1| hypothetical protein PROPEN_03038 [Proteus penneri ATCC 35198]
 gi|225202321|gb|EEG84675.1| hypothetical protein PROPEN_03038 [Proteus penneri ATCC 35198]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   AL       PD++++D  +   S
Sbjct: 1   MARRILVVEDETAIREMICFVLEQNGFQPIEAEDYDSALSFLIDPYPDLVLLDWMIPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+I KQ+K +S  ++IP+I +TA   + D+ +  + G + Y+ KP S    +  +K  +
Sbjct: 61  GLQIIKQMKRESNTRDIPIIMLTAKGEEEDKVQGLETGADDYVIKPFSPKELVARVKAIL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|332074558|gb|EGI85032.1| response regulator [Streptococcus pneumoniae GA17545]
          Length = 234

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK++IV+D +    + +  +   GY  +   N  EALE     +PD+II+D+ L EI G
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNSREALEQFEAEQPDIIILDLMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ K I++      +P++ ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVAKTIRK---TSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|328469451|gb|EGF40397.1| putative two-component response regulator [Vibrio parahaemolyticus
           10329]
          Length = 235

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++V+DN    +   D +  +G+  L   NG    +L   H PD+II+DI +    G 
Sbjct: 4   KQILVVDDNLDLREALSDYLGRAGFEVLCAENGGAMWQLLNDHHPDLIILDIMMPGEDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + ++++++S   +IP+I +TA   + D     + G + YI+K  S    +  IK  +  
Sbjct: 64  TLCQKLRKNS---DIPIIMLTAVTEEADRVAGLEMGADDYITKSFSPRELLARIKTILRR 120

Query: 123 A 123
           +
Sbjct: 121 S 121


>gi|300087391|ref|YP_003757913.1| winged helix family two component transcriptional regulator
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527124|gb|ADJ25592.1| two component transcriptional regulator, winged helix family
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 229

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++++D    + + R  +E  GY  L   +G   L++ RQ +PD++++D+ + ++S
Sbjct: 3   MAKKILVIDDERKIIDIVRAYLEKEGYRVLTATDGEAGLKVWRQERPDLVVLDLMMPKLS 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ + I+++SE    PVI +TA     D+    + G + Y++KP      +  IK  +
Sbjct: 63  GNDVCRIIRQESET---PVIMLTARDELTDKIVGLELGADDYVTKPFEGRELVARIKAVL 119

Query: 121 GE 122
             
Sbjct: 120 RR 121


>gi|302519214|ref|ZP_07271556.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
 gi|302428109|gb|EFK99924.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
          Length = 290

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++V+D+    ++    +  +G    +  +G  AL  A  H+PD++++D+ L  + GLE
Sbjct: 18  HVLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTHRPDLVVLDLMLPGMDGLE 77

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 78  VCRRMRARHP---VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRR 133


>gi|75908165|ref|YP_322461.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|75701890|gb|ABA21566.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 238

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED     +L +  +E  G+    +R+G+ AL + ++  PD+II+D+ +  + GLE+
Sbjct: 3   ILIVEDESEIAQLIQHSLEKEGFSCRTSRDGINALRMFQEQPPDLIILDLMIPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CARIRQKPGAKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRALLRRS 121


>gi|116619023|ref|YP_819394.1| DNA-binding response regulator [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116097870|gb|ABJ63021.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 235

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++V+D +    + +  +   GY  +   +G EAL++     PD++++D  L E+ G
Sbjct: 1   MSKVLVVDDEKPISDIIKFNLTKEGYDVVTAADGQEALDMYNDENPDLVLLDQMLPEVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ +QI+  S   ++PVI VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  IEVLRQIRSKS---DVPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117


>gi|296111034|ref|YP_003621415.1| response regulator [Leuconostoc kimchii IMSNU 11154]
 gi|295832565|gb|ADG40446.1| response regulator [Leuconostoc kimchii IMSNU 11154]
          Length = 237

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +  +   GY  +   +G EAL +  + KPD++++D  L EI G
Sbjct: 1   MSKILVVDDEKPISDIIKFNLTKEGYEVITAADGQEALTIFNEEKPDLVLLDQMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ +QI+  SE    PVI VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  VEVLRQIRSKSET---PVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117


>gi|238063933|ref|ZP_04608642.1| two-component system response regulator receiver [Micromonospora
           sp. ATCC 39149]
 gi|237885744|gb|EEP74572.1| two-component system response regulator receiver [Micromonospora
           sp. ATCC 39149]
          Length = 318

 Score =  167 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 60/118 (50%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D+    +     +   G+  +   +G EALE+  + +PD+ ++D+ +  I GLE+
Sbjct: 11  ILVVDDDADIARFVEFNLRLHGFEVIHASDGQEALEVIERQRPDLAVVDLMMPRIDGLEL 70

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T++++ +     +PVI +TA  M  D+      G + Y+ KP   +  +  +   +  
Sbjct: 71  TRRLRANPMTSALPVIMLTAKGMTVDKVHGLSAGADDYLVKPFDTAELVARVSSTLRR 128


>gi|298492569|ref|YP_003722746.1| response regulator receiver sensor signal transduction histidine
           kinase ['Nostoc azollae' 0708]
 gi|298234487|gb|ADI65623.1| response regulator receiver sensor signal transduction histidine
           kinase ['Nostoc azollae' 0708]
          Length = 383

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IV+D   N+ L   ++E  GY      +G  AL       PD+I++DI +  ++G E+
Sbjct: 13  ILIVDDTPNNLHLLSSMLEEQGYEVRCANSGAIALRAVEMEHPDIILLDINMPNMNGYEV 72

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY--IGE 122
            +++K D   ++IPVI ++A +   D+ +  + G   YI+KP  L   +  ++ +  +  
Sbjct: 73  CERLKLDPRTRDIPVIFLSALSETIDKVKAFRIGGIDYITKPFQLEEVLARLENHISLRR 132


>gi|119490790|ref|ZP_01623122.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
 gi|119453774|gb|EAW34932.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
          Length = 1111

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQH-KPDVIIMDIQLQEISGL 62
           K+++V+D  +N+++  + +    Y   Q  NG+EAL L  +  KPD+I++D+ +  ++G 
Sbjct: 717 KILVVDDEPVNIQVIANNLSLQNYAITQATNGLEALTLIEKGFKPDLILLDVMMPRMTGY 776

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           E+ ++++E     E+P++ +TA     D       G   Y+SKP S    +  IK ++ 
Sbjct: 777 EVCQKLREKYLHSELPILMLTAKNQVTDLVDGLSSGANDYLSKPFSKQELLARIKTHLR 835


>gi|154498462|ref|ZP_02036840.1| hypothetical protein BACCAP_02451 [Bacteroides capillosus ATCC
           29799]
 gi|150272530|gb|EDM99715.1| hypothetical protein BACCAP_02451 [Bacteroides capillosus ATCC
           29799]
          Length = 238

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 67/120 (55%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D ++ +K  +  +E+ GY      +G EA+ELAR    D+II+D+ + +I GL+
Sbjct: 13  KILVVDDEKVLVKGIKFNLESEGYQVETGCDGEEAVELARSGGFDLIILDLMMPKIDGLQ 72

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
              +I+E      +P+I +TA +   D+    + G + YI+KP ++      ++  +  A
Sbjct: 73  ACMRIRE---FSNVPIIMLTARSEDADKIIGFECGADDYITKPFNILELKARVRALLRRA 129


>gi|145594416|ref|YP_001158713.1| response regulator receiver [Salinispora tropica CNB-440]
 gi|145303753|gb|ABP54335.1| response regulator receiver modulated diguanylate cyclase
           [Salinispora tropica CNB-440]
          Length = 326

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 62/118 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D+E   +     +   GY  +   +G EALE+  +H+PD+ ++D+ +  + GLE+
Sbjct: 11  ILVVDDDEDIARFVEFNLRLHGYEVIHAGDGQEALEVIARHRPDLAVVDLMMPRVDGLEL 70

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T++++ D     +PVI +TA  M  D+      G + Y+ KP   +  +  +   +  
Sbjct: 71  TRRLRADPMTAVLPVIMLTAKGMTVDKVHGLSAGADDYLVKPFDTAELVARVSSTLRR 128


>gi|227431461|ref|ZP_03913510.1| response regulator [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352827|gb|EEJ43004.1| response regulator [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 235

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++V+D +    + +  +   GY  +   +G EAL++     PD++++D  L E+ G
Sbjct: 1   MSKVLVVDDEKPISDIIKFNLTKEGYDVVTAADGQEALDMYNDENPDLVLLDQMLPEVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ +QI+  S   ++PVI VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  IEVLRQIRSKS---DVPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117


>gi|221134917|ref|ZP_03561220.1| putative DNA-binding response regulator PhoB [Glaciecola sp.
           HTCC2999]
          Length = 228

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + +++VED     ++ + ++E +G+   +  +   AL+   +  PD++++D  L   S
Sbjct: 1   MSRSILLVEDEAPIREMIKIILEQAGFTVNEAEDFDIALDKMVEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ ++ KE    +EIPVI +TA   + D+ R    G + YI+KP S    +  IK  +
Sbjct: 61  GVQLARKFKEHEFTREIPVILLTARGEEDDKIRGLDAGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|159901175|ref|YP_001547422.1| two component transcriptional regulator [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159894214|gb|ABX07294.1| two component transcriptional regulator, winged helix family
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 232

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +  +++V+D     ++    +   G+  L+  +G  AL LARQ  PD++++D+ L +++G
Sbjct: 1   MANILVVDDEPNIREVVGLYLRREGHTVLEASDGEAALRLARQQPPDLVVLDLMLPKVTG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++++ D   +  PVI +TA + + D       G + Y+ KP S    +  ++  + 
Sbjct: 61  LEVCRRLQSD---RRTPVIMLTAKSEENDRIIGLGVGADDYVVKPFSPRELVARVEAVLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|90577311|ref|ZP_01233122.1| putative DNA-binding response regulator [Vibrio angustum S14]
 gi|90440397|gb|EAS65577.1| putative DNA-binding response regulator [Vibrio angustum S14]
          Length = 243

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K++++V+D++   +L  + +  +G+       G E         PD+I++DI +    G
Sbjct: 4   SKQILVVDDDKEIRELLEEYLTKNGFEVQTAAEGEEMKRCLAGGYPDLILLDIMMPGDDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + I++     ++P+I +TA + + D+    + G + YI+KP S    +  IK  + 
Sbjct: 64  FTLCQHIRK---TSDVPIIMLTAVSEEMDQIIGLEIGADDYIAKPFSPRQLLARIKAILR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|86739037|ref|YP_479437.1| two component transcriptional regulator [Frankia sp. CcI3]
 gi|86565899|gb|ABD09708.1| two component transcriptional regulator, winged helix family
           [Frankia sp. CcI3]
          Length = 406

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D     +L    +   G+      +G  AL LAR  +PD +++DI L ++ GLE
Sbjct: 160 RVLVVDDETTLAELLSMALRYEGWEVRSAADGRGALRLARDFRPDAVVLDIMLPDMDGLE 219

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++ +S   ++PV+ +TA     D       G + Y++KP SL   +  ++  +  A
Sbjct: 220 VLRRLRAES--PDVPVLFLTARDAVEDRVAGLTAGGDDYVTKPFSLEELVARLRGLMRRA 277


>gi|51894442|ref|YP_077133.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
 gi|51858131|dbj|BAD42289.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
          Length = 234

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D     ++ +   E  G+      +G EA+  AR    D++I+DI L ++ 
Sbjct: 1   MADRILVVDDERPIAEILKFSFEREGFEVEMAFDGEEAVAKARASDFDLVILDIMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + ++I+       +P++ +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GFTVCREIR---RFSTVPILMLTAKEDEVDKVLGLELGADDYVTKPFSPRELIARVRAIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|320012489|gb|ADW07339.1| two component transcriptional regulator, winged helix family
           [Streptomyces flavogriseus ATCC 33331]
          Length = 275

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQE-ISGL 62
           +V++V+D+    ++    +  +GY   +  +G  ALE     +PD++++D+ L   + G 
Sbjct: 44  RVLVVDDDPTVAEVAAGYLGRAGYDVGRADDGPAALESVAALRPDLVVLDLMLPGGMDGF 103

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++I+       +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 104 EVCRRIRARGP---VPVIMLTARGDEDDRILGLETGADDYVTKPFSPRELVLRVEAVLRR 160


>gi|295399496|ref|ZP_06809478.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109946|ref|YP_003988262.1| transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294978962|gb|EFG54558.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215047|gb|ADP73651.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +  + L    +E +G+  +   +G EA+E     +P+ II+D+ L ++ 
Sbjct: 1   MSKKVLVVDDEQSIVTLLTYNLERAGFTVVTANDGEEAIEKVAAERPEFIILDLMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCKQLRQQKVM--TPILMLTAKDDEFDKILGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|153810970|ref|ZP_01963638.1| hypothetical protein RUMOBE_01361 [Ruminococcus obeum ATCC 29174]
 gi|149832858|gb|EDM87941.1| hypothetical protein RUMOBE_01361 [Ruminococcus obeum ATCC 29174]
          Length = 233

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 58/120 (48%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    +      +G +AL+     +PD+I++D+ L  I G 
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFETRIVNDGEQALKDFASFQPDLILLDLMLPGIDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ ++I+      ++P+I ++A     D+    + G + YI KP      +  ++  +  
Sbjct: 65  QVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYIIKPFDTKELVARVRAVLRR 121


>gi|238760009|ref|ZP_04621161.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           aldovae ATCC 35236]
 gi|238701762|gb|EEP94327.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           aldovae ATCC 35236]
          Length = 260

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 32  MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVMRLSEPFPDLVLLDWMLPGGS 91

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 92  GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 151

Query: 121 GE 122
             
Sbjct: 152 RR 153


>gi|16330477|ref|NP_441205.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
 gi|1652968|dbj|BAA17885.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
          Length = 1014

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 68/116 (58%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D + N+ +  +L+E  GY      +G EAL+   Q +PD+I++D+ +  + GLE+
Sbjct: 20  ILVVDDVKENIYVISELLEGEGYSTTFVTSGPEALQRVTQAQPDLILLDLMMPGMDGLEV 79

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
             ++K+D + ++IPVI +TA   K D  +    G   Y++KP S    +  +K ++
Sbjct: 80  CDRLKQDPQTRDIPVIFLTASNEKQDLLQAFAKGAVDYVTKPFSPPELLARVKTHL 135



 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++ EDN +N ++ + L++  GY      NG EAL    +   DV++MD+++ E+ GL 
Sbjct: 741 TILLAEDNLINQQVAKLLLKKLGYPVDVVNNGQEALSALAKGDYDVVLMDVEMPEMDGLT 800

Query: 64  ITKQIKEDSELQEIP-VIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            T+ I+      E P +IAVTA++M+GD ER    G   Y+SKPI L    + ++
Sbjct: 801 ATEHIRRSQGRSERPWIIAVTAYSMEGDRERCLASGMNDYVSKPIRLEALQQALQ 855


>gi|89072346|ref|ZP_01158925.1| putative DNA-binding response regulator [Photobacterium sp. SKA34]
 gi|89051878|gb|EAR57330.1| putative DNA-binding response regulator [Photobacterium sp. SKA34]
          Length = 243

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            K++++V+D++   +L  + +  +G+       G E         PD+I++DI +    G
Sbjct: 4   SKQILVVDDDKEIRELLEEYLTKNGFEVQTAAEGEEMKRCLAGGYPDLILLDIMMPGDDG 63

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + I++     ++P+I +TA + + D+    + G + YI+KP S    +  IK  + 
Sbjct: 64  FTLCQHIRK---TSDVPIIMLTAVSEEMDQIIGLEIGADDYIAKPFSPRQLLARIKAILR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|186686259|ref|YP_001869455.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186468711|gb|ACC84512.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 236

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED      L +  +E  G+    +R+G+ AL + ++  PD+II+D+ +  + GLE+
Sbjct: 3   ILIVEDEPEIAHLIQLSLEKEGFFCRISRDGINALRMFQEQPPDLIILDLMIPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CARIRQKPGTKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELIARVRALLRRS 121


>gi|124024957|ref|YP_001014073.1| two-component response regulator [Prochlorococcus marinus str.
           NATL1A]
 gi|123960025|gb|ABM74808.1| two-component response regulator [Prochlorococcus marinus str.
           NATL1A]
          Length = 242

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 56/119 (47%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D        +  +E  G+      +G E  E A++  PDVII D+ +    G  
Sbjct: 16  RILLVDDEPGLRTAVQAYLEDEGFQVTTAVDGEEGWEKAQKMIPDVIISDVMMPRCDGYG 75

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+I+ED  L   PVI +TA  M  D  +  + G + Y+ KP      +  +K  +  
Sbjct: 76  LLKKIREDERLGGTPVIFLTAKGMTADRTQGYQAGVDDYMPKPFDPDELVARVKNVVQR 134


>gi|72383373|ref|YP_292728.1| two component LuxR family transcriptional regulator
           [Prochlorococcus marinus str. NATL2A]
 gi|72003223|gb|AAZ59025.1| two component transcriptional regulator, LuxR family
           [Prochlorococcus marinus str. NATL2A]
          Length = 242

 Score =  167 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 56/119 (47%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++V+D        +  +E  G+      +G E  E A++  PDVII D+ +    G  
Sbjct: 16  RILLVDDEPGLRTAVQAYLEDEGFQVTTAVDGEEGWEKAQKMIPDVIISDVMMPRCDGYG 75

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K+I+ED  L   PVI +TA  M  D  +  + G + Y+ KP      +  +K  +  
Sbjct: 76  LLKKIREDERLGGTPVIFLTAKGMTADRTQGYQAGVDDYMPKPFDPDELVARVKNVVQR 134


>gi|188534673|ref|YP_001908470.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia tasmaniensis Et1/99]
 gi|188029715|emb|CAO97594.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia tasmaniensis Et1/99]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   A+ L  +  PD+I++D  L   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQNDYHPIEAADYDSAVSLLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|52080826|ref|YP_079617.1| two-component response regulator ResD [Bacillus licheniformis ATCC
           14580]
 gi|52786197|ref|YP_092026.1| hypothetical protein BLi02458 [Bacillus licheniformis ATCC 14580]
 gi|319645215|ref|ZP_07999448.1| transcriptional regulatory protein resD [Bacillus sp. BT1B_CT2]
 gi|52004037|gb|AAU23979.1| two-component response regulator ResD [Bacillus licheniformis ATCC
           14580]
 gi|52348699|gb|AAU41333.1| ResD [Bacillus licheniformis ATCC 14580]
 gi|317393024|gb|EFV73818.1| transcriptional regulatory protein resD [Bacillus sp. BT1B_CT2]
          Length = 240

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     +L +  +E   Y   +  NG EA++ A  +  D+I++D+ +    G+E
Sbjct: 8   KILVVDDEARIRRLLKMYLERENYKIEEAENGDEAIDKALGNDYDLILLDLMMPGTDGIE 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +Q++   + +  P+I +TA   + +  +  + G + YI KP S    +  +K  +  +
Sbjct: 68  VCRQVR---DKKATPIIMLTAKGEEANRVQGFEVGTDDYIVKPFSPREVVLRVKALLRRS 124


>gi|332881804|ref|ZP_08449452.1| response regulator receiver domain protein [Capnocytophaga sp. oral
            taxon 329 str. F0087]
 gi|332680443|gb|EGJ53392.1| response regulator receiver domain protein [Capnocytophaga sp. oral
            taxon 329 str. F0087]
          Length = 1341

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 1/117 (0%)

Query: 5    VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
            +++V+DN   +++   ++ T  Y  L   NG+EAL+  + H  D+I+ D+ +  + G  +
Sbjct: 1094 ILLVDDNMQLLEMMEKILATK-YRVLTAENGLEALKQLKAHAVDLIVSDVMMPGMDGFAL 1152

Query: 65   TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             +++K   E   IPVI +TA     D     + G + Y++KP  L +    I   + 
Sbjct: 1153 CRKLKSQLETSHIPVIMLTAKQSADDRVDCYEAGADGYLAKPFELKVLAARIDNLLR 1209


>gi|294630116|ref|ZP_06708676.1| DNA-binding response regulator [Streptomyces sp. e14]
 gi|292833449|gb|EFF91798.1| DNA-binding response regulator [Streptomyces sp. e14]
          Length = 246

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            ++++IV+D     +  +  +   GY      +G +ALE A  ++PD++++DIQ+  + G
Sbjct: 12  TQRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKAAAYRPDLVVLDIQMPRMDG 71

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L   ++I+   +    P++ +TA    GD       G + Y+ KP  L      I+  + 
Sbjct: 72  LTAARRIRGTGDT--TPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLR 129

Query: 122 EA 123
            +
Sbjct: 130 RS 131


>gi|317121455|ref|YP_004101458.1| transcriptional regulator [Thermaerobacter marianensis DSM 12885]
 gi|315591435|gb|ADU50731.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter marianensis DSM 12885]
          Length = 326

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D    +K  R  +E +G+      +G +ALE       D+II+D+ L EI 
Sbjct: 1   MGERILLVDDEAALVKGLRRSLEQAGFEVEVATDGRQALERFAAGGIDLIILDLMLPEID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + +++++     ++P+I +TA     D     + G + Y+ KP +    +  I+  +
Sbjct: 61  GLTVCREVRK---TSQVPIIMLTARDEDVDRIVGLELGADDYVVKPFNPRELIARIRAVL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|270263528|ref|ZP_06191797.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
 gi|270042412|gb|EFA15507.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|209695992|ref|YP_002263922.1| chitin degradation sensor protein [Aliivibrio salmonicida LFI1238]
 gi|208009945|emb|CAQ80259.1| chitin degradation sensor protein [Aliivibrio salmonicida LFI1238]
          Length = 1127

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 60/115 (52%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++ +D  +N+++    ++  GY      +G E L+   +  P+++++D+ +  +SG E+ 
Sbjct: 723 LVADDEPVNLQVLSSFLKLEGYRVKTANDGPETLKQLEEETPELVLLDVMMPGMSGYEVC 782

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           +++++     ++P+I +TA     D  R  + G   Y+SKP +       IK ++
Sbjct: 783 QEVRKQYSHSQLPIIMLTALNQTQDRVRGFESGANDYLSKPFNKQELAARIKAHL 837


>gi|226315498|ref|YP_002775394.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226098448|dbj|BAH46890.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 236

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +   E  GY  +   +G EAL + +  +PD+I++D+ L    G
Sbjct: 1   MAKLLVVDDEKPIADILKFTFEKEGYQVVCAYDGDEALVVVKDERPDLILLDVMLPGRDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +++ + +++     ++P+I +TA   + D+    + G + Y++KP S    +  +K ++ 
Sbjct: 61  MDVCRTVRQ---TYDVPIIMLTAKDSELDKVLGLELGADDYVTKPFSTRELVARVKAHLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|269119755|ref|YP_003307932.1| two component transcriptional regulator, winged helix family
           [Sebaldella termitidis ATCC 33386]
 gi|268613633|gb|ACZ08001.1| two component transcriptional regulator, winged helix family
           [Sebaldella termitidis ATCC 33386]
          Length = 217

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 67/119 (56%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IVED E   K+ R  +  +GYI  +  +G E L+L  +  PD++++D+ + +  G E
Sbjct: 2   KILIVEDEERIRKVVRSFLVKNGYIVREAADGEEGLDLFYEWNPDLVLLDVMMPKKDGYE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + IK +   +  PV+ +TA   + DE R  + G + YI KP SL I    +K  +G+
Sbjct: 62  VCRAIKSE---KTTPVLMLTAKTQEEDEIRGLEIGADDYIRKPFSLKILELRLKNLLGD 117


>gi|229828450|ref|ZP_04454519.1| hypothetical protein GCWU000342_00511 [Shuttleworthia satelles DSM
           14600]
 gi|229793044|gb|EEP29158.1| hypothetical protein GCWU000342_00511 [Shuttleworthia satelles DSM
           14600]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +L +K  R  +E          +G EAL+ AR+   D+I++D+ L  + 
Sbjct: 1   MAKKVLVVDDEKLIVKGIRFSLEQDEMKVDCAYDGQEALDKAREGDYDLILLDVMLPRMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ + ++E      +P++ +TA     D+    + G + YI+KP ++      IK  +
Sbjct: 61  GFEVCRAVRE---FSNVPIVMLTAKGDDMDKIMGLEYGADDYITKPFNILEVKARIKAIL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|254410153|ref|ZP_05023933.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183189|gb|EDX78173.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 237

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D+          +E  GY   Q  +G EALE   ++ PD+++ D+ + E+ G
Sbjct: 1   MKKILVVDDDRTLRITLTRALENMGYQVQQVSSGAEALEACVKNPPDLVVSDVMMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E  ++++     Q +P I ++      D       G + Y+ KP++       I+  + 
Sbjct: 61  IEFCRRLRATPSGQLMPFIFLSGKGELEDRIHGHSIGADDYLIKPVNPRELAAKIEAQLE 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|189423658|ref|YP_001950835.1| two component transcriptional regulator, winged helix family
           [Geobacter lovleyi SZ]
 gi|189419917|gb|ACD94315.1| two component transcriptional regulator, winged helix family
           [Geobacter lovleyi SZ]
          Length = 226

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 66/122 (54%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV+IVED     +L    +E  GY AL T  G+E LE AR+  PD+I++D+ L  + G
Sbjct: 1   MKKVLIVEDERDLAELLAYNLEKEGYQALVTGTGVEGLETARRELPDLILLDLMLPGMMG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+   ++   + + IPV+ +TA   + D     + G + YI KP S+   M  I+  + 
Sbjct: 61  TEVCSALRHSDKTRGIPVLMLTARGDEIDRVVGFEMGADDYIVKPFSMRELMLRIRAILR 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|167465147|ref|ZP_02330236.1| two-component response regulator [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381788|ref|ZP_08055742.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154176|gb|EFX46498.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 237

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D E   +L R  +E  GY   ++++G  AL+LA     D+I++DI L  + G E+
Sbjct: 7   ILVVDDEERIRRLLRMYLEKEGYDIEESQDGETALKLAMDKDYDLILLDIMLPGMDGTEV 66

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             ++++    +  PVI +TA   + +     + G + Y+ KP S    +  +K  +  +
Sbjct: 67  CARLRQ---FKTTPVIMLTAKGEETNRVHGFEVGADDYVVKPFSPREVIYRVKAILRRS 122


>gi|20809033|ref|NP_624204.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|20517704|gb|AAM25808.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
          Length = 231

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D +  + + +  +E  GYI  +  +G EA+++A++  PD+II+D+ L ++ 
Sbjct: 1   MSSKILIVDDEKPLVDIIKYNLEKEGYITFEAYDGEEAVKMAKEQNPDLIILDVMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + K +++      +P++ +TA   + D+    + G + YI+KP S+   +  +K  +
Sbjct: 61  GFTVLKTLRQS---MTVPILMLTAKEEEVDKVLGLELGADDYITKPFSMRELVARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|327392936|dbj|BAK10358.1| phosphate regulon transcriptional regulatory protein PhoB [Pantoea
           ananatis AJ13355]
          Length = 245

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   A+    +  PD+I++D  L   S
Sbjct: 17  MAKRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVSKLIEPWPDLILLDWMLPGGS 76

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    M  IK  +
Sbjct: 77  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVM 136

Query: 121 GE 122
             
Sbjct: 137 RR 138


>gi|325662837|ref|ZP_08151406.1| hypothetical protein HMPREF0490_02146 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331086560|ref|ZP_08335638.1| hypothetical protein HMPREF0987_01941 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325470889|gb|EGC74118.1| hypothetical protein HMPREF0490_02146 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330410393|gb|EGG89825.1| hypothetical protein HMPREF0987_01941 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +++IVED E    L RD +E SG+      +G   LE A   + D++I+D+ L  + G
Sbjct: 1   MSRILIVEDEETIADLERDYLELSGFEVEVANDGETGLEKALTDQFDLVILDLMLPGVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            EI +++++    +  P+I V+A     D+ R    G + Y++KP S S  +  +K ++ 
Sbjct: 61  FEICREVRQK---KNTPIIMVSAKKDDIDKIRGLGLGADDYMTKPFSPSELVARVKAHLA 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|291545359|emb|CBL18467.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Ruminococcus sp. SR1/5]
          Length = 233

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 57/120 (47%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    +      +G EAL+      PD+I++D+ L  I G 
Sbjct: 5   QKILIVDDDNNIAELVALYLTKECFETKIVNDGEEALKQFHIFHPDLILLDLMLPGIDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ ++I+      ++P+I ++A     D+    + G + YI KP      +  ++  +  
Sbjct: 65  QVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYIIKPFDSKELVARVRAVLRR 121


>gi|253579598|ref|ZP_04856867.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849099|gb|EES77060.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 233

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 57/120 (47%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           +K++IV+D+    +L    +    +      +G EAL      +PD+II+D+ L  I G 
Sbjct: 5   QKILIVDDDNNIAELIALYLTKECFETKIVNDGEEALREFASFRPDLIILDLMLPGIDGY 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           ++ ++I+      ++P+I ++A     D+    + G + Y+ KP      +  ++  +  
Sbjct: 65  QVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYMIKPFDSKELVARVRAVLRR 121


>gi|254479597|ref|ZP_05092907.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|214034471|gb|EEB75235.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 231

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D +  + + +  +E  GYI  +  +G EA+++A++  PD+II+D+ L ++ 
Sbjct: 1   MSSKILIVDDEKPLVDIIKYNLEKEGYITFEAYDGEEAVKMAKEQNPDLIILDVMLPKMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + K +++      +P++ +TA   + D+    + G + YI+KP S+   +  +K  +
Sbjct: 61  GFTVLKTLRQS---MTVPILMLTAKEEEVDKVLGLELGADDYITKPFSMRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|90023478|ref|YP_529305.1| response regulator receiver domain-containing protein
           [Saccharophagus degradans 2-40]
 gi|89953078|gb|ABD83093.1| Phosphate regulon transcriptional regulatory protein phoB
           [Saccharophagus degradans 2-40]
          Length = 234

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 63/120 (52%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++V+D      + R  +E + Y  L+  +  +A  L    KPD+I++D  L   SG+
Sbjct: 4   KTILVVDDEPPIRDMLRVALEMAEYAVLEAGDAQQAHSLIVDKKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    EIP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDEVTSEIPIIMLTAKGEEDNKVQGLEVGADDYITKPFSPRELVARLKAVLRR 123


>gi|291616506|ref|YP_003519248.1| PhoB [Pantoea ananatis LMG 20103]
 gi|291151536|gb|ADD76120.1| PhoB [Pantoea ananatis LMG 20103]
          Length = 245

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   A+    +  PD+I++D  L   S
Sbjct: 17  MAKRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAISKLIEPWPDLILLDWMLPGGS 76

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    M  IK  +
Sbjct: 77  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVM 136

Query: 121 GE 122
             
Sbjct: 137 RR 138


>gi|255524035|ref|ZP_05390997.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296186892|ref|ZP_06855293.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
 gi|255512322|gb|EET88600.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296048606|gb|EFG88039.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
          Length = 228

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D+E   ++ +  +E SGY      +G EA E+  ++KPD++++DI L  + G++
Sbjct: 7   KILIVDDDENICEVIKMYVENSGYNTQVCHDGREAQEVFLEYKPDLVLLDIMLPHVDGID 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I+++ E    PVI +TA     D+    + G + YI KP      +  +K  +  
Sbjct: 67  VLKWIRKEYET---PVIMLTAKGETFDKVLGLELGADDYIVKPFEPKELLARVKAVLRR 122


>gi|150390626|ref|YP_001320675.1| two component transcriptional regulator [Alkaliphilus
           metalliredigens QYMF]
 gi|149950488|gb|ABR49016.1| two component transcriptional regulator, winged helix family
           [Alkaliphilus metalliredigens QYMF]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 70/121 (57%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K +++V+D E  ++L +  +E +G+  L + NG E++EL + +  D+I++D+ L  I G+
Sbjct: 4   KNILVVDDEEHIIELIKFNLEKNGFSVLTSDNGEESIELVKNNDVDLIVLDLMLPGIDGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ K+I+   +  + P+I +TA   + D     + G + Y++KP S+   +  IK  +  
Sbjct: 64  EVCKRIRRMDDYDKTPIIMLTAMGEETDRILGLELGADDYMTKPFSIRELVARIKAVLRR 123

Query: 123 A 123
           +
Sbjct: 124 S 124


>gi|289579453|ref|YP_003478080.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|289529166|gb|ADD03518.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
          Length = 231

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IV+D +  +++ +  +E  GYI  +  +G EAL++A++  PD+II+D+ L ++ 
Sbjct: 1   MTHRILIVDDEKPIVEIIKYNLEKEGYITYEAYDGEEALKIAKEQNPDLIILDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + +++      IP++ +TA   + D+    + G + YI+KP S+   +  +K  +
Sbjct: 61  GFSVLRTLRQS---MTIPILMLTAKEEEVDKVLGLELGADDYITKPFSIRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|170016543|ref|YP_001727462.1| response regulator [Leuconostoc citreum KM20]
 gi|169803400|gb|ACA82018.1| Response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Leuconostoc citreum
           KM20]
          Length = 235

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + K+++V+D +    + +  +   GY  +   +G EAL L    KPD++++D  L EI G
Sbjct: 1   MSKILVVDDEKPISDIIKFNLTKEGYDVITAADGQEALALFNDEKPDLVLLDQMLPEIDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+ +QI+  SE    PVI VTA   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  VEVLRQIRSKSET---PVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLR 117


>gi|77461827|ref|YP_351334.1| two component transcriptional regulator [Pseudomonas fluorescens
           Pf0-1]
 gi|77385830|gb|ABA77343.1| phosphate regulon two-component system, response regulator
           [Pseudomonas fluorescens Pf0-1]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|51595267|ref|YP_069458.1| two-component regulatory system response regulator [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808689|ref|YP_652605.1| phosphate regulon transcriptional regulator [Yersinia pestis
           Antiqua]
 gi|108811049|ref|YP_646816.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Nepal516]
 gi|149364950|ref|ZP_01886985.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CA88-4125]
 gi|153946834|ref|YP_001402096.1| PhoB family transcriptional regulator [Yersinia pseudotuberculosis
           IP 31758]
 gi|165935944|ref|ZP_02224514.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|167468099|ref|ZP_02332803.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis FV-1]
 gi|170025493|ref|YP_001721998.1| two component transcriptional regulator [Yersinia
           pseudotuberculosis YPIII]
 gi|186894284|ref|YP_001871396.1| two component transcriptional regulator [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930234|ref|YP_002348109.1| phosphate regulon transcriptional regulator [Yersinia pestis CO92]
 gi|229838810|ref|ZP_04458969.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229896037|ref|ZP_04511207.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Pestoides A]
 gi|229899378|ref|ZP_04514521.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901275|ref|ZP_04516397.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Nepal516]
 gi|51588549|emb|CAH20157.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulates Pi uptake (OmpR family) [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774697|gb|ABG17216.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Nepal516]
 gi|108780602|gb|ABG14660.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Antiqua]
 gi|115348845|emb|CAL21800.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CO92]
 gi|149291363|gb|EDM41437.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CA88-4125]
 gi|152958329|gb|ABS45790.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pseudotuberculosis IP 31758]
 gi|165916089|gb|EDR34696.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|169752027|gb|ACA69545.1| two component transcriptional regulator, winged helix family
           [Yersinia pseudotuberculosis YPIII]
 gi|186697310|gb|ACC87939.1| two component transcriptional regulator, winged helix family
           [Yersinia pseudotuberculosis PB1/+]
 gi|229681204|gb|EEO77298.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Nepal516]
 gi|229687780|gb|EEO79853.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695176|gb|EEO85223.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700960|gb|EEO88989.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Pestoides A]
 gi|320016389|gb|ADV99960.1| osmolarity response regulator [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|326791208|ref|YP_004309029.1| transcriptional regulator [Clostridium lentocellum DSM 5427]
 gi|326541972|gb|ADZ83831.1| two component transcriptional regulator, winged helix family
           [Clostridium lentocellum DSM 5427]
          Length = 228

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D +L +K  +  +E  G+      +G EAL   + +K DV+++D+ L +  
Sbjct: 1   MNSKILVVDDEKLIVKGIKFSLEQEGWEVDAAYDGEEALNYVKNNKYDVMLLDVMLPKYD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL++ + ++E      IP+I +TA     D+    + G + Y++KP ++      IK  +
Sbjct: 61  GLQVCQLVRE---FSNIPIIMLTAKGEDMDKIMGLEYGADDYVTKPFNILELKARIKAIL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|317129907|ref|YP_004096189.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
 gi|315474855|gb|ADU31458.1| two component transcriptional regulator, winged helix family
           [Bacillus cellulosilyticus DSM 2522]
          Length = 238

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M + +++V+D E  + L +  +E  G+      +G  AL+ A     D I++D+ L E+ 
Sbjct: 1   MAQHILVVDDEESIVTLLQFNLEQGGFQVSTAMDGQTALDKALNESFDFIVLDLMLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ KQ++++  +   P++ +TA   + D+    + G + Y++KP S    +  ++  +
Sbjct: 61  GLEVCKQLRQNKIM--TPILMLTAKDDEFDKVLGLELGADDYLTKPFSPREVVARVRAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|302552415|ref|ZP_07304757.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
 gi|302470033|gb|EFL33126.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
          Length = 245

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IV+D     +  +  +   GY      +G +AL+ A  ++PD++++DIQ+  + GL
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYGTEVAVDGADALDKAAAYRPDLVVLDIQMPRMDGL 70

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++I+   +    P++ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 71  TAARRIRATGDT--TPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128

Query: 123 A 123
           +
Sbjct: 129 S 129


>gi|153868898|ref|ZP_01998627.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
 gi|152074527|gb|EDN71372.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
          Length = 378

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 66/121 (54%), Gaps = 2/121 (1%)

Query: 2   LK--KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           +K   +++V+D   N+++   ++   GY     RNG +AL +AR   PD+I++DI + E+
Sbjct: 1   MKPETILVVDDLADNLRVLIGILSQQGYKVRPARNGQQALLMARTSPPDLILLDIMMPEM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+ +Q+K D +   IP+I ++A     D+ +    G   YI+KP      +  ++ +
Sbjct: 61  DGYEVCQQLKADQKTHHIPIIFISALNEVLDKIKAFSLGAVDYITKPFQAEEVLARVETH 120

Query: 120 I 120
           +
Sbjct: 121 L 121


>gi|309789889|ref|ZP_07684467.1| transcriptional regulator [Oscillochloris trichoides DG6]
 gi|308228096|gb|EFO81746.1| transcriptional regulator [Oscillochloris trichoides DG6]
          Length = 234

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++V+D     +L R  +   GY  +   +G EALE A   +P+VI++D+ L  + 
Sbjct: 1   MSERILVVDDEPQMGRLLRTGLSARGYEVVVAADGQEALEQAVHWRPEVIVLDLGLPVMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I+      ++P+I ++A   + D+      G + Y+ KP  +   +  I+  +
Sbjct: 61  GLEVCRRIR---GWSQVPIIVLSARDGEPDKVEALDLGADDYLVKPFGMDELLARIRVAL 117

Query: 121 GEA 123
             +
Sbjct: 118 RHS 120


>gi|17232219|ref|NP_488767.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17133864|dbj|BAB76426.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 238

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED     +L +  +E  G+    +R+G+ AL++  +  PD+II+D+ +  + GLE+
Sbjct: 3   ILIVEDESEIAQLIQHSLEKEGFSCRTSRDGINALQMFHERPPDLIILDLMIPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CARIRQKPGAKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRALLRRS 121


>gi|297517635|ref|ZP_06936021.1| transcriptional regulator PhoB [Escherichia coli OP50]
 gi|6573458|pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli
 gi|6573459|pdb|1B00|B Chain B, Phob Receiver Domain From Escherichia Coli
          Length = 127

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|145600097|ref|YP_001164173.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Pestoides F]
 gi|145211793|gb|ABP41200.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Pestoides F]
          Length = 229

 Score =  167 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|54307916|ref|YP_128936.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum SS9]
 gi|46912342|emb|CAG19134.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum SS9]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M++++++VED     ++   ++E  GY  ++  +  +ALE   +  P++I+MD  L   S
Sbjct: 1   MVRRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDDALEKICEPYPELILMDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  +
Sbjct: 61  GINLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|310779288|ref|YP_003967621.1| two component transcriptional regulator, winged helix family
           [Ilyobacter polytropus DSM 2926]
 gi|309748611|gb|ADO83273.1| two component transcriptional regulator, winged helix family
           [Ilyobacter polytropus DSM 2926]
          Length = 217

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++VED     +L +D +   GY   +  +GM+ALE+ ++   D++I+DI L ++ G
Sbjct: 1   MKKILVVEDEWKMRRLIKDYLVKEGYHVDEAGDGMQALEMFQEGGYDLVILDIMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++I+ +S    +PVI +TA + + D+    +   + YI+KP +  + +  IK    
Sbjct: 61  WSVCREIRRESM---VPVIMLTARSEENDQIFGFELEADEYITKPFNPRLLVARIKAIFR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|228955130|ref|ZP_04117144.1| Two component transcriptional regulator, winged helix [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228804541|gb|EEM51146.1| Two component transcriptional regulator, winged helix [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 232

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 2   LKKV--MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           +K++  +IV+D      L    +E  GY  ++  +G EA+ +      D++++DI + ++
Sbjct: 1   MKRISILIVDDEAEIADLIEIHLEKEGYHVVKAADGEEAVHIIETQPIDLVVLDIMMPKM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+T+QI+       +P+I ++A     D+      G + Y++KP +    +  +   
Sbjct: 61  DGYEVTRQIRAK---HHMPIIFLSAKTSDFDKVTGLVLGADDYMTKPFTPIELVARVNAQ 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|156744257|ref|YP_001434386.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156235585|gb|ABU60368.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 239

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D    +   R  +E  G   +   NG EALE  R   PDV+++DI +  + G E 
Sbjct: 9   ILVVDDEPRMVNFMRMNLELEGCRVVSASNGREALEKVRDEMPDVVLLDIMMPVMDGFET 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +++++      +PV+ +TA   + D  +  + G + YI KP S    +  I+  +  
Sbjct: 69  LRRLRQ---ASSVPVLVLTAKDDEEDRIKGLELGADDYIGKPFSHRELVSRIRAVLRR 123


>gi|89100385|ref|ZP_01173249.1| PhoP [Bacillus sp. NRRL B-14911]
 gi|89084904|gb|EAR64041.1| PhoP [Bacillus sp. NRRL B-14911]
          Length = 237

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 68/122 (55%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KKV++V+D +  + L    ++ +GY  +   +G    + A Q +PD+I++D+ L +++
Sbjct: 1   MDKKVLVVDDEQSIVTLLEYNLKQAGYEVITAMDGESGKDFALQERPDLIVLDLMLPKLN 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ++++      P++ +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GIEVCKQLRQEKI--HTPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|163845997|ref|YP_001634041.1| histidine kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222523722|ref|YP_002568192.1| multi-sensor hybrid histidine kinase [Chloroflexus sp. Y-400-fl]
 gi|163667286|gb|ABY33652.1| Histidine kinase [Chloroflexus aurantiacus J-10-fl]
 gi|222447601|gb|ACM51867.1| multi-sensor hybrid histidine kinase [Chloroflexus sp. Y-400-fl]
          Length = 1347

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 73/122 (59%)

Query: 2    LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
             +++++ EDNE+N     D +   GY       G EAL++A + +PD+IIMDIQ+  + G
Sbjct: 1222 SRRILLAEDNEVNRVTLSDYLVAQGYEVRVACQGKEALQIAAEWRPDLIIMDIQMPGLDG 1281

Query: 62   LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            LE+ ++++ D+     P+IAVTA AM GD ER    G   Y +KPI L   +E I++++ 
Sbjct: 1282 LEVIQRLRADAAFAATPIIAVTALAMPGDRERCLSAGANDYFAKPIRLRQLVERIEQFLA 1341

Query: 122  EA 123
             +
Sbjct: 1342 SS 1343



 Score = 95.2 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 3/114 (2%)

Query: 6    MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
            +I+ED+          +E      +    G  A+E  +  +PD+I++D+Q+ + SG EI 
Sbjct: 1096 LIIEDSATTADQLARYLEELQIQPVICSYGKGAVEQVQALRPDLILLDVQMPDRSGWEIL 1155

Query: 66   KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
              ++ D +L+++PVI V+         R    G  AY+ KPI+  +    + + 
Sbjct: 1156 ADLRRDPDLRQVPVIIVSVVDEPE---RGLAAGAAAYLVKPINRLMLRRALSQI 1206


>gi|317492787|ref|ZP_07951211.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918909|gb|EFV40244.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  ++  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVNSLSEPYPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  +EIPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREALTREIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|223938485|ref|ZP_03630378.1| two component transcriptional regulator, winged helix family
           [bacterium Ellin514]
 gi|223892904|gb|EEF59372.1| two component transcriptional regulator, winged helix family
           [bacterium Ellin514]
          Length = 237

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 70/118 (59%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D    ++L +  ++++GY  +   +G EAL  AR   P++II+D+ + E+ GLE
Sbjct: 14  KILVVDDEPDAIELIKFNLKSAGYEVITAADGEEALNKARSLLPNLIILDLMIPEVDGLE 73

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           + K ++ D+ +  IP+I +TA A + D     + G + Y++KP S    +  +K+ + 
Sbjct: 74  VCKILRRDARVSGIPIIMLTAKAAEIDRVLGLELGADDYVTKPFSPRELVLRVKRLLR 131


>gi|150390092|ref|YP_001320141.1| two component transcriptional regulator [Alkaliphilus
           metalliredigens QYMF]
 gi|149949954|gb|ABR48482.1| two component transcriptional regulator, winged helix family
           [Alkaliphilus metalliredigens QYMF]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+ K+++V+D  L +K  R  +E  GY  L   +G EAL+   +   D+II+D+ L +I 
Sbjct: 1   MVYKLLVVDDEPLLVKGLRYSLEQDGYEILSASDGEEALDKFNKGSFDLIILDLMLPKID 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ + I++     + P+I +TA      +    + G + Y++KP ++      IK  +
Sbjct: 61  GLEVCQTIRQ---TSQTPIIMLTAKGEDMTKILGLEYGADDYMTKPFNILELKARIKAVL 117

Query: 121 GEA 123
             A
Sbjct: 118 RRA 120


>gi|312898518|ref|ZP_07757908.1| response regulator receiver domain protein [Megasphaera
           micronuciformis F0359]
 gi|310620437|gb|EFQ04007.1| response regulator receiver domain protein [Megasphaera
           micronuciformis F0359]
          Length = 226

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++++I +D  L  +L  D +   GY  L+  +G +AL++  + KPD++++D+ +    G
Sbjct: 1   MERILIADDEALMRQLVADFLRPEGYEVLEAVDGKQALDIFNEQKPDLVLLDVMMPGYDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++I+       +P+I +TA   + D+      G + YI+KP S  + +  +K  + 
Sbjct: 61  WTVCREIR---RTSTVPIIMITAKDEEIDQLFAYDLGVDDYITKPFSPKLLVAKMKALLR 117

Query: 122 E 122
            
Sbjct: 118 R 118


>gi|134300813|ref|YP_001114309.1| two component transcriptional regulator [Desulfotomaculum reducens
           MI-1]
 gi|134053513|gb|ABO51484.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum reducens MI-1]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M + +V++V+D +   ++    +   GY   +  +G EAL   +    D+I++D+ + ++
Sbjct: 1   MSRLRVLVVDDEDKIRQVIGIYLTNEGYYVEEALDGEEALRKFKAESWDLIVLDVMMPKM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G+ + ++I++   + ++P+I +TA   + D     + G + Y+ KP S    +  IK  
Sbjct: 61  DGITVCQEIRK---VSKVPIIMLTAKNDEVDRILGLEFGADDYMGKPFSPRELVARIKAV 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|333008591|gb|EGK28059.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri VA-6]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLLGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K +S  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|190570797|ref|YP_001975155.1| response regulator/GGDEF domain protein [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019676|ref|ZP_03335481.1| response regulator/GGDEF domain protein [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190357069|emb|CAQ54466.1| response regulator/GGDEF domain protein [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212994717|gb|EEB55360.1| response regulator/GGDEF domain protein [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 458

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K+++V+D   N+KL    ++   Y  +   +G EA++L  + +PD+I++D+ + ++S
Sbjct: 1   MTAKILVVDDIPSNVKLLEAQLKAEYYTVIVAYDGEEAIDLVAEQQPDIILLDVMMPKMS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G E+ K++K D     IP+I VTA     D       G + +++KPI  +     IK  +
Sbjct: 61  GFEVCKKLKNDPLTTYIPIIMVTALHDTHDRVEGINAGADDFLTKPIDETALSARIKSLV 120

Query: 121 G 121
            
Sbjct: 121 R 121



 Score = 85.2 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 51/113 (45%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+++    +   ++++          +  EAL++  +   D+II D+Q  +  GL +
Sbjct: 159 ILVVDEDTFQAEQIHNVLKQRFRSIKILHDPKEALKVGIKDNYDLIISDMQFSKTDGLRL 218

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
             + +   E +  P++ ++    K +  +    G   Y++ P+  S  +  + 
Sbjct: 219 CSKFRSKVETRYTPILILSEDYDKSNLVKALDVGANDYLTVPLDESELIARVN 271


>gi|269103311|ref|ZP_06156008.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163209|gb|EEZ41705.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 229

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 66/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M++++++VED     ++   ++E  GY  ++  +   ALE   +  P++I+MD  L   S
Sbjct: 1   MVRRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDSALEKICEPYPELILMDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  +
Sbjct: 61  GINLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|67924495|ref|ZP_00517917.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
 gi|67853668|gb|EAM49005.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
          Length = 236

 Score =  167 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 64/120 (53%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IVED     K+ +  +E   +  L   +G+ AL+L +  +PD+II+D+ L ++ GLE
Sbjct: 2   KILIVEDEMEIAKIIQTTLERESFDCLVAYDGLTALDLFQNQEPDLIILDLMLPKLDGLE 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           +  +I++ +  ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 62  VCTRIRQKTTTKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPIELLARVRALLRRS 121


>gi|182418948|ref|ZP_02950205.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Clostridium butyricum 5521]
 gi|237668366|ref|ZP_04528350.1| DNA-binding response regulator [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377231|gb|EDT74799.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Clostridium butyricum 5521]
 gi|237656714|gb|EEP54270.1| DNA-binding response regulator [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 232

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 73/123 (59%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M + K++IV+D E  ++L    ++ SGY      +G+EA+ +A++ KP++I++D+ +  +
Sbjct: 1   MTREKILIVDDEEHIVELLDFNLKNSGYETFIATDGIEAVRIAKEEKPNLILLDLMIPGM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G ++ K+IK+D E++   +I +TA   + D+    + G + YI+KP S+   +  +K  
Sbjct: 61  DGFDVCKEIKKDKEMKNTSIIMLTAKGEELDKILGLELGADDYITKPFSVRELLARVKAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|26991996|ref|NP_747421.1| winged helix family two component transcriptional regulator
           [Pseudomonas putida KT2440]
 gi|24987128|gb|AAN70885.1|AE016732_10 DNA-binding response regulator PhoB [Pseudomonas putida KT2440]
          Length = 242

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 64/120 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  L+  N  +A  +    KPD+I++D  L   SG+
Sbjct: 17  RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQAHAIIVDRKPDLILLDWMLPGTSGI 76

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 77  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 136


>gi|313632601|gb|EFR99591.1| transcriptional regulatory protein ResD [Listeria seeligeri FSL
           N1-067]
 gi|313637138|gb|EFS02678.1| transcriptional regulatory protein ResD [Listeria seeligeri FSL
           S4-171]
          Length = 238

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D +   +L +  +E   Y   +  +G EAL++A  +  +VI++D+ +    G+E
Sbjct: 6   RVLVVDDEDRIRRLLKMYLERENYRIEEASDGDEALDMALNNNYEVILLDLMMPGKDGIE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++E    +  PV+ +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 66  VCRELRE---YKSTPVVMLTAKGEEANRVQGFEVGADDYIVKPFSPREVVLRVKAVLRRA 122


>gi|269104854|ref|ZP_06157550.1| putative DNA-binding response regulator [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161494|gb|EEZ39991.1| putative DNA-binding response regulator [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 241

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KKV++V+D++   +L  + +  SG+  +    G E        +PD+I++D+ +    G 
Sbjct: 5   KKVLVVDDDQEIRELLDEYLTKSGFHVVTAAEGEEMKRKLAAGEPDLILLDVMMPGDDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + + I++     ++P+I +TA + + D+    + G + YI+KP S    M  IK  +  
Sbjct: 65  TLCQHIRK---TSDVPIIMLTAVSDEMDQIIGLELGADDYIAKPFSPRQLMARIKALLRR 121


>gi|113476774|ref|YP_722835.1| response regulator receiver protein [Trichodesmium erythraeum
           IMS101]
 gi|110167822|gb|ABG52362.1| response regulator receiver protein [Trichodesmium erythraeum
           IMS101]
          Length = 121

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 70/121 (57%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + KV++VED+    ++   L++ SG       +G+EAL   +  KPD++++DI + +++G
Sbjct: 1   MSKVLVVEDSVTQREMISQLLKNSGLAVTVANDGVEALGRLKNTKPDIVVLDIVMPKMNG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E+ ++IK D + + IPV+  ++   + D     K G +AYI+KP   +  + T+K+ + 
Sbjct: 61  YEVCRRIKSDPQTKHIPVVMCSSKGEEFDRYWGLKQGADAYIAKPFQPTELVGTVKQLLR 120

Query: 122 E 122
            
Sbjct: 121 R 121


>gi|259418415|ref|ZP_05742333.1| transcriptional regulatory protein ChvI [Silicibacter sp.
           TrichCH4B]
 gi|259345810|gb|EEW57654.1| transcriptional regulatory protein ChvI [Silicibacter sp.
           TrichCH4B]
          Length = 230

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  ++++V+D+   +++    +E +G+  L   +G+ A+   +Q  PD+I++DI L E+ 
Sbjct: 1   MPARILVVDDDPDILEVTGFAVEKAGFETLFASDGLAAINAQQQEDPDLIVLDIGLPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE+ ++I++ SE   +P++ +TA   + D     + G + Y++KP S    +  IK  +
Sbjct: 61  GLEVCREIRKISE---VPILFLTARDEEIDRILGLELGADDYLTKPFSPRELVARIKAIL 117

Query: 121 GEA 123
             +
Sbjct: 118 KRS 120


>gi|149190144|ref|ZP_01868420.1| sensory box sensor histidine kinase/response regulator [Vibrio
           shilonii AK1]
 gi|148836033|gb|EDL52994.1| sensory box sensor histidine kinase/response regulator [Vibrio
           shilonii AK1]
          Length = 1128

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++ +D  +N+++    +   GY     ++G+E L++    KPD++++DI +  +SG E+ 
Sbjct: 725 LVADDEPVNLRILESFLRLEGYQVKLAKDGLETLDIIEHEKPDLLLLDIMMPGMSGFEVC 784

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI----- 120
           + I+E  +   +P+I +TA     D  R  + G   Y++KP S       I  ++     
Sbjct: 785 ETIREQYDHAALPIIMLTALNQSEDRVRGFELGANDYLAKPFSKPELAARIAAHLQASKA 844

Query: 121 --GEA 123
               A
Sbjct: 845 EERRA 849


>gi|302559898|ref|ZP_07312240.1| DNA-binding response regulator [Streptomyces griseoflavus Tu4000]
 gi|302477516|gb|EFL40609.1| DNA-binding response regulator [Streptomyces griseoflavus Tu4000]
          Length = 244

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           ++++IV+D     +  +  +   GY      +G +ALE A  ++PD++++DIQ+  + GL
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYGTEVAVDGADALEKAAAYRPDLVVLDIQMPRMDGL 70

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
              ++I+   +    P++ +TA    GD       G + Y+ KP  L      I+  +  
Sbjct: 71  TAARRIRATGDT--TPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128

Query: 123 A 123
           +
Sbjct: 129 S 129


>gi|157369284|ref|YP_001477273.1| two component transcriptional regulator [Serratia proteamaculans
           568]
 gi|157321048|gb|ABV40145.1| two component transcriptional regulator, winged helix family
           [Serratia proteamaculans 568]
          Length = 229

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|148654376|ref|YP_001274581.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148566486|gb|ABQ88631.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 243

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++V+D    +   R  +E  G   +   NG EALE  R   PDV+++DI +  + G E 
Sbjct: 9   ILVVDDEPRMVNFMRMNLELEGCRVISASNGREALEKVRDEMPDVVLLDIMMPVMDGFET 68

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +++++      +PV+ +TA   + D  +  + G + YI KP S    +  I+  +  
Sbjct: 69  LRRLRQ---ASSVPVLVLTAKDDEEDRIKGLELGADDYIGKPFSHRELVSRIRAVLRR 123


>gi|73748088|ref|YP_307327.1| DNA-binding response regulator [Dehalococcoides sp. CBDB1]
 gi|289432114|ref|YP_003461987.1| transcriptional regulator [Dehalococcoides sp. GT]
 gi|73659804|emb|CAI82411.1| DNA-binding response regulator [Dehalococcoides sp. CBDB1]
 gi|288945834|gb|ADC73531.1| two component transcriptional regulator, winged helix family
           [Dehalococcoides sp. GT]
          Length = 230

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++VED+    +L    +   GY      +G++AL + R  KP ++I+D+ +  I G E
Sbjct: 5   KILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALSVYRLFKPALVILDVMIPGIDGFE 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + + I+ +S    +P++ +TA + + D+    + G + Y+SKP  +   +  +K  +  +
Sbjct: 65  LCRLIRAES---SVPILMLTARSSEADKVNGLEAGADDYLSKPFGMKELLARMKALLRRS 121


>gi|218439789|ref|YP_002378118.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
 gi|218172517|gb|ACK71250.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
          Length = 234

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 62/119 (52%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           ++IVED     +L R+ +E   +     ++G +ALE+  Q +PD+II+D+ L  + GLE+
Sbjct: 3   ILIVEDEPEIAQLIRETLERENFSCQIAKSGTQALEIFGQLQPDLIILDLMLPGLDGLEV 62

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             +I++    ++  ++ +TA   + D       G + Y+ KP S    +  ++  +  +
Sbjct: 63  CTRIRQKPGAKDPYILMLTARGEEIDRIIGLSTGADDYLVKPFSPIELVARVRALLRRS 121


>gi|153952801|ref|YP_001393566.1| sensory transduction protein [Clostridium kluyveri DSM 555]
 gi|219853466|ref|YP_002470588.1| hypothetical protein CKR_0123 [Clostridium kluyveri NBRC 12016]
 gi|146345682|gb|EDK32218.1| Predicted sensory transduction protein [Clostridium kluyveri DSM
           555]
 gi|219567190|dbj|BAH05174.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 228

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D+E   ++ +  +E++GY      +G  A     ++KPD++I+DI L  I G++
Sbjct: 7   KILIVDDDENICEVIKMYVESAGYEVQVANDGKSAETTFLEYKPDLVILDIMLPNIDGID 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K I++D E    PVI +TA     D+    + G + YI KP      +  IK  +  
Sbjct: 67  VLKWIRKDYET---PVIMLTAKGETFDKVLGLELGADDYIVKPFEPKEMLARIKAVLRR 122


>gi|294635418|ref|ZP_06713908.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
 gi|291091207|gb|EFE23768.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
          Length = 237

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   AL    +  PD+I++D  L   S
Sbjct: 9   MARRILVVEDETPIREMVSFVLEQNGYQPLEAESYDGALSRLCEPYPDLILLDWMLPGGS 68

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ K +K +   ++IPV+ +TA   + D  R  + G + YI KP S    +  IK  +
Sbjct: 69  GIQLIKHLKREPATRDIPVMMLTARGEEEDRVRGLEVGADDYIIKPFSPKELVARIKAVM 128

Query: 121 GE 122
             
Sbjct: 129 RR 130


>gi|262199700|ref|YP_003270909.1| response regulator receiver sensor signal transduction histidine
           kinase [Haliangium ochraceum DSM 14365]
 gi|262083047|gb|ACY19016.1| response regulator receiver sensor signal transduction histidine
           kinase [Haliangium ochraceum DSM 14365]
          Length = 397

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 2/120 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++V+DN  N+ +  + ++  GY  L   +G EA+ELA + +PD+I++D+ +  I G E 
Sbjct: 22  VLLVDDNPANLAVLFEHLDEHGYRVLVAEDGSEAVELASRIQPDIILLDVMMPGIDGFET 81

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY--IGE 122
            +Q+K  S L +IP+I +TA     D+    + G   Y++KP      +  ++ +  +  
Sbjct: 82  CRQLKSHSTLSDIPIIFMTALTDTRDKVEGFRAGAVDYVTKPFQHREVLARVRTHVVLRR 141


>gi|24987831|pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From
           Bacillus Subtilis
          Length = 136

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 70/123 (56%), Gaps = 2/123 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D E  + L +  +E SGY  +   +G EAL+ A   KPD+I++D+ L ++ 
Sbjct: 2   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ KQ+++   +   P++ +TA   + D+    + G + Y++KP S       +K  +
Sbjct: 62  GIEVCKQLRQQKLM--FPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAIL 119

Query: 121 GEA 123
             +
Sbjct: 120 RRS 122


>gi|307328971|ref|ZP_07608139.1| two component transcriptional regulator, winged helix family
           [Streptomyces violaceusniger Tu 4113]
 gi|306885333|gb|EFN16351.1| two component transcriptional regulator, winged helix family
           [Streptomyces violaceusniger Tu 4113]
          Length = 274

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D+    ++    +  +G+   Q  +G  AL  A    PD++++D+ L  + GLE
Sbjct: 9   RVLVVDDDPTVAEVVAGYLGRAGFAVDQAADGPGALARAAARWPDLVVLDLMLPGMDGLE 68

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + + ++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 69  VCRALRGRGP---VPVIMLTARGDEEDRILGLEIGADDYVTKPFSPRELVLRVESVLRR 124


>gi|308071608|ref|YP_003873213.1| transcriptional regulatory protein yycF [Paenibacillus polymyxa
           E681]
 gi|305860887|gb|ADM72675.1| Transcriptional regulatory protein yycF [Paenibacillus polymyxa
           E681]
          Length = 243

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D +    + +  +E  GY  +   +G+ A+++A + +PD+I++D+ L  + 
Sbjct: 1   MQGTILVVDDEQPIADILKFNLEKEGYQVICAFDGITAVDIAVKQQPDLILLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ ++++      + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMDVCREVRGHQL--QTPIIMLTAKDGEIDKVLGLELGADDYVTKPFSTRELLARVKAQM 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|50120049|ref|YP_049216.1| phosphate regulon response regulator [Pectobacterium atrosepticum
           SCRI1043]
 gi|227113361|ref|ZP_03827017.1| phosphate regulon response regulator [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227327489|ref|ZP_03831513.1| phosphate regulon response regulator [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|253687403|ref|YP_003016593.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|261822544|ref|YP_003260650.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium wasabiae WPP163]
 gi|49610575|emb|CAG74020.1| phosphate regulon response regulator [Pectobacterium atrosepticum
           SCRI1043]
 gi|251753981|gb|ACT12057.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|261606557|gb|ACX89043.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium wasabiae WPP163]
          Length = 229

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E +GY  ++  +   A+    +  P+++++D  L   S
Sbjct: 1   MAKRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVTQLSEPFPELVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL+  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GLQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|146297552|ref|YP_001181323.1| two component transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145411128|gb|ABP68132.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 230

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 65/123 (52%), Gaps = 4/123 (3%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K  +++V+D +  + + +  +E  GY    + +G +AL   +    D++++D+ L ++
Sbjct: 1   MSKAHILVVDDEKPIVDIIKFNLEKEGYKITTSYDGEDALNKIKNENFDMVLLDVMLPKM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G  + K+++E     E+P+I +TA A + D+    + G + YI+KP  +   +  I+  
Sbjct: 61  DGFTVCKKVRE---FSEVPIIMITAKADEVDKVLGLELGADDYITKPFGIRELIARIRAN 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|307266330|ref|ZP_07547869.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326391193|ref|ZP_08212737.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
 gi|306918637|gb|EFN48872.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325992762|gb|EGD51210.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 231

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IV+D +  +++ +  +E  GYI  +  +G EAL++A++  PD+II+D+ L ++ 
Sbjct: 1   MSYRILIVDDEKPIVEIIKYNLEKEGYITYEAYDGEEALKIAKEQNPDLIILDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + +++      IP++ +TA   + D+    + G + YI+KP S+   +  +K  +
Sbjct: 61  GFSVLRTLRQS---MTIPILMLTAKEEEVDKVLGLELGADDYITKPFSIRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|7144547|gb|AAA62132.2| orf246; ompR homolog [Rhodella violacea]
          Length = 247

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IV+D     +L    +   GY  +   +G EAL + R+  P++I++DI + ++ G  
Sbjct: 12  TILIVDDEASMRRLLEYRLSIIGYNVISASDGEEALNIFRKEHPNLIVLDIMMPKLDGFG 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++I+++S   +IP+I +T      D     + G + Y+ KP S       IK  +  +
Sbjct: 72  VCQEIRKES---DIPIIMLTGLGDIVDRITGLELGADDYLVKPFSPKELEARIKSVLRRS 128


>gi|254488622|ref|ZP_05101827.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. GAI101]
 gi|214045491|gb|EEB86129.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. GAI101]
          Length = 229

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 65/118 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VED     ++    +E+ GY   +  NG EA+ L  +  PD++I+D  +  +SG+E+
Sbjct: 8   ILLVEDEPAQREVLAYNLESEGYDVRRAENGEEAMLLVAEALPDLVILDWMMPLLSGIEV 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +Q+K   + + IPVI ++A + + D  R  + G + Y+ KP S+   M  ++  +  
Sbjct: 68  CRQLKTREDTRNIPVIMLSARSEEVDAVRGLETGADDYVVKPYSMRELMARVRTQLRR 125


>gi|188588892|ref|YP_001920540.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Clostridium botulinum E3 str. Alaska E43]
 gi|251779766|ref|ZP_04822686.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|188499173|gb|ACD52309.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Clostridium botulinum E3 str. Alaska E43]
 gi|243084081|gb|EES49971.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 234

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 70/119 (58%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K++IV+D E  ++L +  +  +GY  +   NG++AL++A+   P +I++D+ L  + G +
Sbjct: 5   KILIVDDEEHIIELLKFNLINAGYKVISANNGIDALKIAKAENPKLILLDLMLPGLDGFD 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K++K++ E Q I +I +TA   + D+    + G + YI+KP S+   +  +K  +  
Sbjct: 65  VCKEVKKNKETQNISIIMLTAKGEEIDKILGLELGADDYITKPFSVRELLARVKAVLRR 123


>gi|188585611|ref|YP_001917156.1| two component transcriptional regulator, winged helix family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350298|gb|ACB84568.1| two component transcriptional regulator, winged helix family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 246

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 1/120 (0%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + ++++VED     KL    +   GY      +G EA     ++  D+II+D+ L  + G
Sbjct: 1   MHRILLVEDEHHIAKLVNHNLIKEGYEVEHVTHGDEAFNKYFENDYDLIILDLMLPGLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ ++I+ +S L  IPVI +TA + + ++    + G + Y++KP S    +  +K  + 
Sbjct: 61  LEVCRKIRGNSSL-HIPVIMLTAKSDEIEKIVGLEMGADDYVTKPFSPRELLARVKAQLR 119


>gi|167648501|ref|YP_001686164.1| two component transcriptional regulator [Caulobacter sp. K31]
 gi|167350931|gb|ABZ73666.1| two component transcriptional regulator, winged helix family
           [Caulobacter sp. K31]
          Length = 230

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   V++VED +    L    ++  GY+     +G EAL +A +  PD++I+D  L ++S
Sbjct: 1   MTPYVLVVEDEDALATLLHYNLDKEGYVVGVAGDGEEALTMASERAPDLVILDWMLPKVS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ ++++  SE + +P+I +TA   + D  R    G + Y+ KP S+      ++  +
Sbjct: 61  GIEVCRRLRGRSETRNVPIIMLTARGEESDRIRGLDTGADDYVVKPFSMIELTARVRAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|256827579|ref|YP_003151538.1| response regulator with CheY-like receiver domain protein and
           winged-helix DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
 gi|256583722|gb|ACU94856.1| response regulator with CheY-like receiver domain protein and
           winged-helix DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
          Length = 236

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
            +++++VED +         +E   Y      +G EALE   +H  D++I+D+ L  + G
Sbjct: 5   TRRILLVEDEKAIRDAVAAYLERENYWVTAVGDGQEALEEFSKHHFDLVILDLMLPRVPG 64

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + + I+++S   ++P+I +TA     D     + G + Y+ KP S    +  ++  + 
Sbjct: 65  ERVCRAIRDNS---DVPIIMLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARVRALLR 121

Query: 122 E 122
            
Sbjct: 122 R 122


>gi|254477021|ref|ZP_05090407.1| phosphate regulon transcriptional regulatory protein PhoB [Ruegeria
           sp. R11]
 gi|214031264|gb|EEB72099.1| phosphate regulon transcriptional regulatory protein PhoB [Ruegeria
           sp. R11]
          Length = 229

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 67/119 (56%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V++VED     ++    +E  G+  L+  NG EAL +  +  PD+I++D  +  +SG+E
Sbjct: 7   TVLVVEDELAQREVLAYNLEADGFRVLRAENGEEALLIVEEDTPDIIVLDWMMPNLSGIE 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + +++K  +E + IP+I ++A + + D+ R  + G + Y+ KP S+   M  ++  +  
Sbjct: 67  VCRRLKSRTETRNIPIIMLSARSEEVDKVRGLETGADDYVVKPYSVVELMARVRTQLRR 125


>gi|293392590|ref|ZP_06636910.1| phosphate regulon response regulator [Serratia odorifera DSM 4582]
 gi|291424992|gb|EFE98201.1| phosphate regulon response regulator [Serratia odorifera DSM 4582]
          Length = 229

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +GY  L+  +   A+    +  PD++++D  L   S
Sbjct: 1   MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPFPDLVLLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    +  IK  +
Sbjct: 61  GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|298244000|ref|ZP_06967807.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297557054|gb|EFH90918.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 240

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            ++IV+D        R  +E   Y  ++  NG+EAL+  R+H PD++++D+ + E+ G E
Sbjct: 12  TILIVDDEPRIRDFVRMNLEMEHYRVIEASNGLEALDRLREHLPDLVVLDVMMPEMDGFE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
             K I+E   +  +PV+ +T    + D+ R    G + YI+KP S    +  I+  +  +
Sbjct: 72  TLKAIRE---VSTVPVVMLTVRQSEQDKIRGLDLGADDYIAKPFSPPELLSRIRALLRRS 128


>gi|289435296|ref|YP_003465168.1| DNA-binding response regulator ResD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289171540|emb|CBH28086.1| DNA-binding response regulator ResD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 238

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++V+D +   +L +  +E   Y   +  +G EAL++A  +  +VI++D+ +    G+E
Sbjct: 6   RVLVVDDEDRIRRLLKMYLERENYRIEEASDGDEALDMALNNNYEVILLDLMMPGKDGIE 65

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + ++++E    +  PV+ +TA   + +  +  + G + YI KP S    +  +K  +  A
Sbjct: 66  VCRELRE---YKSTPVVMLTAKGEEANRVQGFEVGADDYIVKPFSPREVVLRVKAVLRRA 122


>gi|227358160|ref|ZP_03842501.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis ATCC 29906]
 gi|227161496|gb|EEI46533.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis ATCC 29906]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 65/122 (53%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +++++VED     ++   ++E +G+  ++  +   AL       PD++++D  +   S
Sbjct: 1   MARRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLIDPYPDLVLLDWMIPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ KQ+K +   ++IP+I +TA   + D+ +  + G + Y+ KP S    +  +K  +
Sbjct: 61  GIQVIKQMKREINTRDIPIIMLTAKGEEEDKVKGLETGADDYVIKPFSPKELVARVKAIL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|86608522|ref|YP_477284.1| LuxR family DNA-binding response regulator [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557064|gb|ABD02021.1| DNA-binding response regulator, LuxR family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 64/122 (52%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +K+V++V+D+ L++K+    +   GY      +G+E L L  Q +PDV++ D+ + E+ G
Sbjct: 1   MKRVLVVDDDPLSLKVLSRHLTQHGYRVCTGASGVEGLRLFAQEQPDVVVSDVVMPEMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            E  +Q+++    + +P I +++     D  +  + G + YI KP      +  I+  I 
Sbjct: 61  FEFCRQLRQQRGGELVPFIFLSSRGEIDDRVQGYERGADDYIIKPFEPLELVAKIEAQIE 120

Query: 122 EA 123
            +
Sbjct: 121 RS 122


>gi|20806986|ref|NP_622157.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|20515468|gb|AAM23761.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
          Length = 225

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++++I++D E+ +K  +  +E  G+      +G E LE  R    D++I+DI L ++ G
Sbjct: 1   MERLLIIDDEEMFVKGLKLSLEEEGFEVDAAYDGEEGLEKVRIGNYDLVILDIMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++I+       IP+I +TA     D     + G + Y++KP +    +  I+  + 
Sbjct: 61  FSVCREIR---TFSNIPIIMLTARGDDVDRIVGIEIGADDYLAKPFNTRELIARIRALLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|332980939|ref|YP_004462380.1| winged helix family two component transcriptional regulator
           [Mahella australiensis 50-1 BON]
 gi|332698617|gb|AEE95558.1| two component transcriptional regulator, winged helix family
           [Mahella australiensis 50-1 BON]
          Length = 227

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++M+VED E   +L    ++  G+  +   +G +AL+L  ++  D++I+D+ L  + G  
Sbjct: 5   RIMVVEDEERMRQLLHLYMQNEGFEVVDAYDGQQALDLFEKYPMDLVILDVMLPNVDGWT 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           + +QI++     ++P+I +TA   + D+      G + Y+ KP S    +  +K  +  +
Sbjct: 65  VCRQIRQ---GSQVPIIMLTARGEENDKLFGFDLGVDDYVVKPFSPKELVARVKALLKRS 121


>gi|229175570|ref|ZP_04303080.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
 gi|228607966|gb|EEK65278.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
          Length = 232

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 2   LKKV--MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           +K++  +IV+D      L    +E  GY  ++  +G EA+ +      D++++DI + ++
Sbjct: 1   MKRISILIVDDEAEIADLIEIHLEKEGYHVVKAADGEEAIHIIETQPIDLVVLDIMMPKM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E+T+QI+       +P+I ++A     D+      G + Y++KP +    +  +   
Sbjct: 61  DGYEVTRQIRAK---HHMPIIFLSAKTSDFDKVTGLVLGADDYMTKPFTPIELVARVNAQ 117

Query: 120 IGE 122
           +  
Sbjct: 118 LRR 120


>gi|298528299|ref|ZP_07015703.1| two component transcriptional regulator, winged helix family
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511951|gb|EFI35853.1| two component transcriptional regulator, winged helix family
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 232

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 73/123 (59%), Gaps = 1/123 (0%)

Query: 1   MLK-KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           M K K++++ED E    L    +E +GY    T NG + L++AR+ +P++II+D+ L  +
Sbjct: 1   MKKSKILVIEDEEDIQNLLHINLEAAGYRVFLTDNGYDGLKIAREEQPELIILDLMLPHM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            GLE+ +++K+D +L++I VI VTA + + D     + G + Y+ KP S+   +  IK  
Sbjct: 61  DGLEVCRRLKKDDKLKDIIVIMVTAKSEEMDRVVGFELGADDYVVKPFSIRELLLRIKAV 120

Query: 120 IGE 122
           +  
Sbjct: 121 LRR 123


>gi|158321804|ref|YP_001514311.1| two component transcriptional regulator [Alkaliphilus oremlandii
           OhILAs]
 gi|158142003|gb|ABW20315.1| two component transcriptional regulator, winged helix family
           [Alkaliphilus oremlandii OhILAs]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K ++IVED +    + R  +E  GY  L   +G + +  A    PD++++D+ L ++ 
Sbjct: 1   MAKNILIVEDEKPISDIVRFNLEKEGYKVLVAYDGEDGVNKALTLNPDLVLLDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ ++I+  S    +P++ +TA   + D+    + G + YI+KP  +   +  +K  +
Sbjct: 61  GFQVCRKIRASS---SVPILMLTAKEEEVDKVLGLEMGADDYITKPFGMRELLARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|56964476|ref|YP_176207.1| two-component response regulator of alkaline phosphatase synthesis
           [Bacillus clausii KSM-K16]
 gi|56910719|dbj|BAD65246.1| two-component response regulator of alkaline phosphatase synthesis
           [Bacillus clausii KSM-K16]
          Length = 240

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++V+D      L +  +E +G+      +G    + A++   D+II+D+ L  + 
Sbjct: 1   MAKRILVVDDEPSISTLLQYNLEQAGFEVETKLDGQAGFDRAKEADFDLIILDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ +Q++++     +P++ +TA   + D+    + G + Y++KP S       ++  +
Sbjct: 61  GMDVCRQLRQEQIF--VPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVTARVRAIL 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|229075281|ref|ZP_04208274.1| Two-component response regulator [Bacillus cereus Rock4-18]
 gi|228707832|gb|EEL60012.1| Two-component response regulator [Bacillus cereus Rock4-18]
          Length = 228

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  K++IV+D++    L    +E  G    +  + MEAL+L  + + D+II+DI +  + 
Sbjct: 1   MESKILIVDDDKEIRNLISVYLENEGLKTQKAEDAMEALKLLEEKEFDLIILDIMMPNMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E   +I+ED   + IP+I ++A +   D+ +    G + Y+SKP +    +  +K  +
Sbjct: 61  GIEACMKIRED---RNIPIIMLSAKSEDIDKIQGLASGADDYLSKPFNPLELIARVKSQL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|125718372|ref|YP_001035505.1| two-component response transcriptional regulator [Streptococcus
           sanguinis SK36]
 gi|323351211|ref|ZP_08086867.1| DNA-binding response regulator [Streptococcus sanguinis VMC66]
 gi|125498289|gb|ABN44955.1| Two-component response transcriptional regulator (CheY-like
           receiver and winged-helix DNA-binding domains), putative
           [Streptococcus sanguinis SK36]
 gi|322122435|gb|EFX94146.1| DNA-binding response regulator [Streptococcus sanguinis VMC66]
 gi|324991492|gb|EGC23425.1| DNA-binding response regulator [Streptococcus sanguinis SK353]
 gi|324993852|gb|EGC25771.1| DNA-binding response regulator [Streptococcus sanguinis SK405]
 gi|324994827|gb|EGC26740.1| DNA-binding response regulator [Streptococcus sanguinis SK678]
 gi|325687268|gb|EGD29290.1| DNA-binding response regulator [Streptococcus sanguinis SK72]
 gi|325690802|gb|EGD32803.1| DNA-binding response regulator [Streptococcus sanguinis SK115]
 gi|325694846|gb|EGD36751.1| DNA-binding response regulator [Streptococcus sanguinis SK150]
 gi|325696129|gb|EGD38020.1| DNA-binding response regulator [Streptococcus sanguinis SK160]
 gi|327461010|gb|EGF07343.1| DNA-binding response regulator [Streptococcus sanguinis SK1057]
 gi|327463116|gb|EGF09437.1| DNA-binding response regulator [Streptococcus sanguinis SK1]
 gi|327470647|gb|EGF16103.1| DNA-binding response regulator [Streptococcus sanguinis SK330]
 gi|327474727|gb|EGF20132.1| DNA-binding response regulator [Streptococcus sanguinis SK408]
 gi|327490284|gb|EGF22072.1| DNA-binding response regulator [Streptococcus sanguinis SK1058]
 gi|328946751|gb|EGG40889.1| DNA-binding response regulator [Streptococcus sanguinis SK1087]
 gi|332358683|gb|EGJ36506.1| DNA-binding response regulator [Streptococcus sanguinis SK355]
 gi|332358954|gb|EGJ36775.1| DNA-binding response regulator [Streptococcus sanguinis SK49]
 gi|332362447|gb|EGJ40247.1| DNA-binding response regulator [Streptococcus sanguinis SK1056]
 gi|332367141|gb|EGJ44877.1| DNA-binding response regulator [Streptococcus sanguinis SK1059]
          Length = 233

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY  L   +G EALE+    +PD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDEKPISDIIKFNMAKEGYEVLTAFDGKEALEMFEAEQPDILILDLMLPEVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           LE+ + I++      +P+I ++A   + D+    + G + Y++KP S       +K  + 
Sbjct: 61  LEVARTIRK---TSNVPIIVLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|308185867|ref|YP_003929998.1| phosphate regulon transcriptional regulatory protein phoB [Pantoea
           vagans C9-1]
 gi|317047132|ref|YP_004114780.1| winged helix family two component transcriptional regulator
           [Pantoea sp. At-9b]
 gi|308056377|gb|ADO08549.1| Phosphate regulon transcriptional regulatory protein phoB [Pantoea
           vagans C9-1]
 gi|316948749|gb|ADU68224.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. At-9b]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 64/122 (52%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++   ++E + Y  ++  +   A+    +  PD+I++D  L   S
Sbjct: 1   MAKRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVGKLIEPWPDLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K ++  ++IPV+ +TA   + D  R  + G + YI+KP S    M  IK  +
Sbjct: 61  GIQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|158338752|ref|YP_001519929.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158308993|gb|ABW30610.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
          Length = 243

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           K+++V+D     ++    +   GY  +   +G EA++      PD++++D+ + ++ G  
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEAIDTFHHAIPDLVVLDVMMPKLDGYG 66

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P+I +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 67  VCQELRKES---DVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|116333280|ref|YP_794807.1| DNA-binding response regulator [Lactobacillus brevis ATCC 367]
 gi|116098627|gb|ABJ63776.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus brevis ATCC 367]
          Length = 235

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 67/121 (55%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           + +V++V+D    + L +  +E + Y  +   +G +AL LA   K DVI++D+ L ++ G
Sbjct: 1   MSRVLVVDDEPAIVTLLQYNLEQADYQVVTAIDGEQALNLALHEKFDVILLDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +E+TK+++++    + P+I +TA   + D     + G + YI+KP S    +  +K  + 
Sbjct: 61  VEVTKRLRQEKV--KTPIIMITAKTSEFDTVFGLELGADDYITKPFSPREVIARMKAVMR 118

Query: 122 E 122
            
Sbjct: 119 R 119


>gi|110679874|ref|YP_682881.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter denitrificans OCh 114]
 gi|109455990|gb|ABG32195.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter denitrificans OCh 114]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 65/118 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V++VED     ++    +E  G+   +  NG EA+ L  +  PD+I++D  +  +SG+E+
Sbjct: 8   VLVVEDEPAQREVLAYNLEAEGFAVSRAENGEEAMMLVDETAPDLIVLDWMMPNLSGIEV 67

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            +++K  SE + IP+I ++A + + D  R  + G + Y+ KP S+   M  ++  +  
Sbjct: 68  CRRLKTRSETRAIPIIMLSARSEEVDRVRGLETGADDYVIKPYSIVELMARVRSQLRR 125


>gi|73541850|ref|YP_296370.1| phosphate regulon transcriptional regulatory protein phoB
           [Ralstonia eutropha JMP134]
 gi|72119263|gb|AAZ61526.1| Phosphate regulon transcriptional regulatory protein phoB
           [Ralstonia eutropha JMP134]
          Length = 235

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    ++ +G+  ++  N  +AL L     PD++++D  L   S
Sbjct: 1   MPSSILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLMSDVLPDLVLLDWMLPGKS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    K+++ +   ++IP+I +TA + + D+    + G + Y++KP S    +  IK  +
Sbjct: 61  GATFAKELRANDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|323496468|ref|ZP_08101526.1| putative two-component response regulator [Vibrio sinaloensis DSM
           21326]
 gi|323318745|gb|EGA71698.1| putative two-component response regulator [Vibrio sinaloensis DSM
           21326]
          Length = 235

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++V+DN+   +   D +  +G+  L   NG    +  +   PD+II+DI +    G 
Sbjct: 4   KRILVVDDNQELREALSDYLGRAGFEVLGAENGRAMWQTLQHTTPDLIILDIMMPGEDGF 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + +Q+++DS+   IP+I +TA   + D     + G + YI+K  S    +  IK  +  
Sbjct: 64  CLCRQLRQDSQ---IPIIMLTAVTEEADRVAGLEMGADDYITKSFSPRELLARIKTILRR 120

Query: 123 A 123
           +
Sbjct: 121 S 121


>gi|310644837|ref|YP_003949596.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phop [Paenibacillus polymyxa SC2]
 gi|309249788|gb|ADO59355.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Paenibacillus polymyxa SC2]
          Length = 243

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D +    + +  +E  GY  +   +G+ A+++A + +PD+I++D+ L  + 
Sbjct: 1   MQGTILVVDDEQPIADILKFNLEKEGYEVICAFDGISAVDIAVKQQPDLILLDLMLPGMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+++ ++++      + P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GMDVCREVRGHQL--QTPIIMLTAKDGEIDKVLGLELGADDYVTKPFSTRELLARVKAQM 118

Query: 121 GE 122
             
Sbjct: 119 RR 120


>gi|269928581|ref|YP_003320902.1| two component transcriptional regulator, winged helix family
           [Sphaerobacter thermophilus DSM 20745]
 gi|269787938|gb|ACZ40080.1| two component transcriptional regulator, winged helix family
           [Sphaerobacter thermophilus DSM 20745]
          Length = 233

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 67/124 (54%), Gaps = 5/124 (4%)

Query: 2   LKK--VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
           ++K  V++ +D+   ++L R  ++  GY  +   NG EA+E+  + +PD++I+D+ +  +
Sbjct: 1   MRKDLVLVADDDAPILRLVRTKLQADGYSVVTAMNGREAVEIFERERPDIVILDLMMPVM 60

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
            G E  ++I++ S     PVI +TA + + D+ R    G + Y++KP S       +   
Sbjct: 61  DGFEAMQRIRQMS---NAPVIMLTARSGQADKIRGLDLGADDYVTKPFSPDELSARVAAV 117

Query: 120 IGEA 123
           +  A
Sbjct: 118 LRRA 121


>gi|299821102|ref|ZP_07052990.1| response regulator [Listeria grayi DSM 20601]
 gi|299816767|gb|EFI84003.1| response regulator [Listeria grayi DSM 20601]
          Length = 237

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KK+++V+D +    + +  +   G+      +G EAL+L  + +PD+I++DI L    G+
Sbjct: 4   KKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALQLVEEVQPDLILLDIMLPGRDGV 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++++     ++P+I VTA   + D+    + G + Y++KP S    +  +K  +  
Sbjct: 64  EVCREVRKK---YDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANLRR 120


>gi|73748816|ref|YP_308055.1| DNA-binding response regulator [Dehalococcoides sp. CBDB1]
 gi|73660532|emb|CAI83139.1| DNA-binding response regulator [Dehalococcoides sp. CBDB1]
          Length = 227

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK++I +D +   ++ +  +E  G+  + T +G  AL    +  PD+II+D+ L EIS
Sbjct: 1   MSKKILIADDEKRIAEILQAYLEREGFRVIATYDGKTALAKFHEENPDLIILDLMLPEIS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G ++ ++I+++S    +P+I +TA     D+    + G + Y++KP      +  +K  +
Sbjct: 61  GWDVCREIRKES---HVPIIMLTARDELTDKLIGLEIGADDYMTKPFESKELVARVKVQL 117

Query: 121 GEA 123
             +
Sbjct: 118 RRS 120


>gi|182680204|ref|YP_001834350.1| two component transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636087|gb|ACB96861.1| two component transcriptional regulator, winged helix family
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 230

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 61/122 (50%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++V+D+    ++    +E +G   +   +G + L +     PD+I++DI + E+ 
Sbjct: 1   MAATILVVDDDPHIREVICFALEKAGMRVVVAEDGSQVLTIMAAQTPDLIVLDIGMPEMD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GLE  ++I++     E+P++ ++A   + D     + G + Y++KP S    +  +   +
Sbjct: 61  GLETCRRIRK---TSEVPILFLSARDEEIDRVLGLEIGGDDYVTKPFSPRELVARVNVIL 117

Query: 121 GE 122
             
Sbjct: 118 KR 119


>gi|86739691|ref|YP_480091.1| two component transcriptional regulator [Frankia sp. CcI3]
 gi|86566553|gb|ABD10362.1| two component transcriptional regulator, winged helix family
           [Frankia sp. CcI3]
          Length = 321

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +V++V+D+ L  ++    +  +G+   +  +G  AL +A    PD++++D+ L  + G+
Sbjct: 56  ARVLVVDDDALVSEVVDRYLRNAGFDVDRAADGPTALRVAETTPPDLVVLDLMLPGLDGI 115

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++     + +PVI +TA A + D     + G + Y++KP S       ++  +  
Sbjct: 116 EVFRRLRAH---RPVPVIMLTARADESDRITGLEIGADDYVTKPFSPRELTLRVQSVLRR 172

Query: 123 A 123
           A
Sbjct: 173 A 173


>gi|256786760|ref|ZP_05525191.1| response regulator [Streptomyces lividans TK24]
 gi|289770653|ref|ZP_06530031.1| response regulator [Streptomyces lividans TK24]
 gi|289700852|gb|EFD68281.1| response regulator [Streptomyces lividans TK24]
          Length = 280

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++V+D+    ++    ++ +GY   +  +G EAL  A  H+PD++++D+ L  + GL
Sbjct: 53  ARILVVDDDPTVAEVVAGYLDRAGYRVDRAGDGPEALARAAGHRPDLVVLDLMLPGMDGL 112

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           E+ ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +
Sbjct: 113 EVCRRLRGQGP---VPVIMLTARGDEDDRVLGLEVGADDYVTKPFSPRELVLRVESVL 167


>gi|153873722|ref|ZP_02002207.1| Response Regulator Receiver Signal Transduction Histidine Kinase
           [Beggiatoa sp. PS]
 gi|152069810|gb|EDN67791.1| Response Regulator Receiver Signal Transduction Histidine Kinase
           [Beggiatoa sp. PS]
          Length = 299

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 1   MLKK---VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQ 57
           M+ K   +++V+D   N+K+    ++   +  L   +G  ALE      PD+I++D+ + 
Sbjct: 140 MMPKRPKILLVDDMPANIKVLFTFLKKQNFELLIAEDGEMALESVLWDHPDLILLDVMMP 199

Query: 58  EISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           ++ G E+ +++KE+ + ++IPVI +TA +   D+ +  K G   YISKP  +   +  IK
Sbjct: 200 KMDGFEVCQRLKENEKTKDIPVIFMTALSDTIDKIKGFKLGAVDYISKPFDVEEVLLRIK 259

Query: 118 KYI 120
            ++
Sbjct: 260 THL 262


>gi|90414588|ref|ZP_01222561.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum 3TCK]
 gi|90324304|gb|EAS40873.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum 3TCK]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 67/122 (54%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M++++++VED     ++   ++E  GY  ++  +  +ALE   +  P++I+MD  L   S
Sbjct: 1   MVRRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDDALEKICEPYPELILMDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+ + K +K D   ++IPV+ +TA   + D+ R  + G + YI+KP S    M  +K  +
Sbjct: 61  GINLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|319779028|ref|YP_004129941.1| Phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Taylorella equigenitalis MCE9]
 gi|317109052|gb|ADU91798.1| Phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Taylorella equigenitalis MCE9]
          Length = 233

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 60/122 (49%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    +  +G+  L+  +  +A  L     PD+I++D  L   S
Sbjct: 1   MASTILVVEDEPAIQELISVNLTFAGHKVLRALDAQQAKILIDAELPDLILLDWMLPTTS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           GL + + ++ D   Q+IP+I +TA   + D+    + G + YI+KP S    +  IK  +
Sbjct: 61  GLSLARSLRSDERTQDIPIIMLTAKNSEHDKVEGLENGADDYITKPFSPKELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|182680313|ref|YP_001834459.1| two component transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636196|gb|ACB96970.1| two component transcriptional regulator, winged helix family
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 252

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 60/120 (50%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           ++++VED      L    +E  G+       G EA     +  PD++++D  L  +SGLE
Sbjct: 25  RILLVEDEAALSTLLTYNLEAEGFEVESLECGDEAEARLDESLPDLVLLDWMLPGVSGLE 84

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           I ++I+   + + +P+I +TA   + ++ R    G + YI KP S+   M  ++  +  +
Sbjct: 85  ICRRIRAREKTRALPIIMLTARGEESEKIRGLATGADDYIVKPFSVPELMARVRALLRRS 144


>gi|302557641|ref|ZP_07309983.1| DNA-binding response regulator ResD [Streptomyces griseoflavus
           Tu4000]
 gi|302475259|gb|EFL38352.1| DNA-binding response regulator ResD [Streptomyces griseoflavus
           Tu4000]
          Length = 242

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 64/121 (52%), Gaps = 3/121 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            +V++V+D+    ++    ++ +GY+  +  +G  AL  A  H PD++++D+ L  + GL
Sbjct: 12  ARVLVVDDDPTVAEIVTGYLDRAGYVVDRAGDGPGALARAAAHWPDLVVLDLMLPGMDGL 71

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ ++++       +PVI +TA   + D     + G + Y++KP S    +  ++  +  
Sbjct: 72  EVCRRMRGRGP---VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRR 128

Query: 123 A 123
           +
Sbjct: 129 S 129


>gi|297545597|ref|YP_003677899.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296843372|gb|ADH61888.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 231

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 70/122 (57%), Gaps = 3/122 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M  +++IV+D +  +++ +  +E  GYI  +  +G EAL++A++  PD+II+D+ L ++ 
Sbjct: 1   MTHRILIVDDEKPIVEIIKYNLEKEGYITYEAYDGEEALKIAKEQNPDLIILDVMLPKLD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G  + + +++      IP++ +TA   + D+    + G + YI+KP S+   +  +K  +
Sbjct: 61  GFSVLRTLRQS---MTIPILMLTAKEEEVDKVLGLELGADDYITKPFSIRELIARVKANL 117

Query: 121 GE 122
             
Sbjct: 118 RR 119


>gi|33239646|ref|NP_874588.1| two-component response regulator [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33237171|gb|AAP99240.1| Two-component response regulator [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 242

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 59/120 (49%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++V+D        +  +   G+  L   +G + L+ A+Q  PDV+I D+ + +  G 
Sbjct: 15  ARILLVDDEPGIRTAVQAYLNDEGFDVLTAIDGEDGLQKAKQFMPDVVITDVMMPQCDGY 74

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +Q++ED  L   PVI +TA  M  D  +  + G + YI KP      +  +K  +  
Sbjct: 75  ELLRQLREDERLGGTPVIFLTAKGMTIDRTQGYQAGVDDYIPKPFDPDELVARVKNVVKR 134


>gi|254432325|ref|ZP_05046028.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
 gi|197626778|gb|EDY39337.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
          Length = 253

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++V+D     ++    +   GY  +   +GMEALE  R+  PD++++D+ + ++ G  
Sbjct: 15  TILVVDDEASIRRILETRLSMIGYQVVTASDGMEALECFRESHPDLVVLDVMMPKLDGYG 74

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + ++++++S   ++P++ +TA     D     + G + Y+ KP S       I+  +  
Sbjct: 75  VCQELRKES---DVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 130


>gi|94311118|ref|YP_584328.1| two component transcriptional regulator [Cupriavidus metallidurans
           CH34]
 gi|93354970|gb|ABF09059.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Cupriavidus metallidurans CH34]
          Length = 235

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M   +++VED     +L    ++ +G+  ++  N  +AL L     PD++++D  L   S
Sbjct: 1   MPSSILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLMSDVLPDLVLLDWMLPGKS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G    K+++ +   ++IP+I +TA + + D+    + G + Y++KP S    +  IK  +
Sbjct: 61  GATFAKELRNNDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVL 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|262275912|ref|ZP_06053721.1| putative DNA-binding response regulator [Grimontia hollisae CIP
           101886]
 gi|262219720|gb|EEY71036.1| putative DNA-binding response regulator [Grimontia hollisae CIP
           101886]
          Length = 240

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K++++V+D+    +L ++ +  +GY     +NG E         PD+I++DI L    G 
Sbjct: 5   KRILVVDDDLEIRELLQEYLSKAGYNVTTAQNGQEMKAKLAVQYPDLILLDIMLPGDDGF 64

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + K +++DS    +P+I +TA + + D+    + G + YI+KP S    +  I+  +  
Sbjct: 65  TLCKYVRQDS---SVPIIMLTAVSDETDQIIGLELGADDYIAKPFSPRQLVARIRALLRR 121


>gi|289577696|ref|YP_003476323.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|297544009|ref|YP_003676311.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289527409|gb|ADD01761.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|296841784|gb|ADH60300.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 225

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +++++I++D E+ +K  +  +E  G+      +G E L+  R    D++I+DI L ++ G
Sbjct: 1   MERLLIIDDEEMFVKGLKLSLEEEGFEVDTAYDGEEGLDKVRLGNYDLVILDIMLPKLDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
             + ++I+       IP+I +TA     D     + G + Y++KP +    +  I+  + 
Sbjct: 61  FSVCREIR---TFSNIPIIMLTARGEDVDRIVGIEIGADDYLAKPFNTRELIARIRALLR 117

Query: 122 EA 123
            A
Sbjct: 118 RA 119


>gi|284993022|ref|YP_003411576.1| winged helix family two component transcriptional regulator
           [Geodermatophilus obscurus DSM 43160]
 gi|284066267|gb|ADB77205.1| two component transcriptional regulator, winged helix family
           [Geodermatophilus obscurus DSM 43160]
          Length = 240

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            ++++V+D     +L    +  +G+      +G +AL +A   +PD++++D+ +  + G 
Sbjct: 12  ARLLVVDDEPNIRELLSASLRYAGFEVATAADGHQALAMAASFRPDLLVLDVMMPGLDGF 71

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
            + ++++E    +  PV+ +TA     D+      G + Y++KP SL   +  I+  +  
Sbjct: 72  GVVRRLRESG--RHTPVLFLTARDAAEDKVSGLTLGGDDYVTKPFSLDEVLARIRAVLRR 129

Query: 123 A 123
           +
Sbjct: 130 S 130


>gi|114566853|ref|YP_754007.1| signal transduction histidine kinase-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114337788|gb|ABI68636.1| PAS/PAC sensor hybrid histidine kinase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 763

 Score =  166 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 75/121 (61%), Gaps = 2/121 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDNE+N  +  +L+ + G+      NG+EALEL  ++  D++ MDI +  + GLE 
Sbjct: 535 ILVVEDNEVNQMVLSNLLRSQGHQVEVAANGVEALELLDKNNYDLVFMDILMPVMDGLET 594

Query: 65  TKQIKEDSELQ--EIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           T++I+E  E+    IP+IA+TA A+ GD E+    G + Y++KP+ +    + I K I +
Sbjct: 595 TRRIREQEEITGFHIPIIAITAHAIHGDREKFLAAGMDDYLAKPVQMEELNQAISKIIKK 654

Query: 123 A 123
           A
Sbjct: 655 A 655


>gi|330976281|gb|EGH76342.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 229

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 65/121 (53%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           + ++IV+D     ++    +E +GY  ++  N  +A  +    KPD+I++D  L   SG+
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHPIIVDRKPDLILLDWMLPGTSGI 63

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           E+ +++K D    +IP+I +TA   + ++ +  + G + YI+KP S    +  +K  +  
Sbjct: 64  ELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLRR 123

Query: 123 A 123
           A
Sbjct: 124 A 124


>gi|322385035|ref|ZP_08058685.1| DNA-binding response regulator [Streptococcus cristatus ATCC 51100]
 gi|321270945|gb|EFX53855.1| DNA-binding response regulator [Streptococcus cristatus ATCC 51100]
          Length = 233

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KK+++V+D +    + +  +   GY  L   +G EALE+    +PD++I+D+ L E+ G
Sbjct: 1   MKKILVVDDEKPISDIIKFNMAKEGYEVLTAFDGKEALEMFEAEQPDILILDLMLPEVDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           L++ + I++      +P+I ++A   + D+    + G + Y++KP S    +  +K  + 
Sbjct: 61  LDVARTIRK---TSNVPIIVLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKALLR 117

Query: 122 EA 123
            +
Sbjct: 118 RS 119


>gi|313884444|ref|ZP_07818205.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620228|gb|EFR31656.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Eremococcus coleocola ACS-139-V-Col8]
          Length = 273

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 67/121 (55%), Gaps = 2/121 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           ++ ++IV+D    + L    ++ +GY   Q  +G+ A E+  Q+K D II+D+ L  + G
Sbjct: 1   MEHILIVDDEPSILTLLAYNLQQAGYQVDQADDGLLAYEMIEQNKYDFIILDVMLPGMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           ++I +++++  +  ++P++ +TA   + D+    + G + Y++KP S    +  IK  + 
Sbjct: 61  MDICRKVRK--KGSQVPILMLTAKDEEYDKVVGLELGADDYMTKPFSPREVLARIKAILR 118

Query: 122 E 122
            
Sbjct: 119 R 119


>gi|295398526|ref|ZP_06808560.1| response regulator [Aerococcus viridans ATCC 11563]
 gi|294973249|gb|EFG49042.1| response regulator [Aerococcus viridans ATCC 11563]
          Length = 255

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 68/122 (55%), Gaps = 2/122 (1%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +KKV+IV+D +  + L +  +E  GY  +Q  +G   LELA  H+ D II+D+ L ++ G
Sbjct: 1   MKKVLIVDDEQSILTLLKYSLEKEGYEVIQAEDGQTGLELAMNHQLDFIILDLMLPKMDG 60

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
           +++ K ++++      P++ +TA   + ++    + G + Y++KP S    +  +K  + 
Sbjct: 61  MDVCKNLRQNKI--NTPILMLTAKDDELEKIIGLELGADDYMTKPFSPREVLARMKAILR 118

Query: 122 EA 123
            A
Sbjct: 119 RA 120


>gi|149909265|ref|ZP_01897921.1| Response regulator [Moritella sp. PE36]
 gi|149807582|gb|EDM67530.1| Response regulator [Moritella sp. PE36]
          Length = 228

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 62/122 (50%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M K++++VED     ++    +E  G+  ++  +  EA++   +  P++I++D  L   S
Sbjct: 1   MSKRILVVEDELAIREMLCFALEQKGFDVVEAGDYNEAVDRLVEPYPNLILLDWMLPGGS 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++  K +K    L  IPV+ +TA   + D+ +  + G + YI+KP S    +  +   +
Sbjct: 61  GIKYIKHLKSQPHLSAIPVVMLTARGEEEDKVKGLEVGADDYITKPFSPKELIARLNAVM 120

Query: 121 GE 122
             
Sbjct: 121 RR 122


>gi|120554687|ref|YP_959038.1| integral membrane sensor hybrid histidine kinase [Marinobacter
           aquaeolei VT8]
 gi|120324536|gb|ABM18851.1| integral membrane sensor hybrid histidine kinase [Marinobacter
           aquaeolei VT8]
          Length = 782

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 64/115 (55%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           +++VEDN++N  +   L++  G+      NG  ALE  +    D+++MD Q+  + G E 
Sbjct: 657 ILLVEDNQVNQLVASSLLKKLGHRVDHAENGRRALEALQNKTYDLVLMDCQMPVMDGYEA 716

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           T+ I+++ + Q +PVIAVTA  M+GD E     G   YI+KP +       I ++
Sbjct: 717 TRAIRQNPQWQTLPVIAVTANVMQGDREDCLASGMNDYITKPYNRDELRAVIARW 771


>gi|229195595|ref|ZP_04322361.1| Two-component response regulator [Bacillus cereus m1293]
 gi|228587844|gb|EEK45896.1| Two-component response regulator [Bacillus cereus m1293]
          Length = 218

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 6   MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65
           ++V+D     +L    ++  GY   +  NG EAL+    +  D +++DI + E+ GL + 
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWEEAENGKEALKKLETNHYDFVVLDIMMPEMDGLSVC 61

Query: 66  KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           K+I++     ++P+I +TA   + +     + G + YI KP S    +  ++  +  
Sbjct: 62  KEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 115


>gi|94266053|ref|ZP_01289772.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93453375|gb|EAT03803.1| Response regulator receiver [delta proteobacterium MLMS-1]
          Length = 240

 Score =  166 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 62/119 (52%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            +++VED+E   +L    +  +G+  +   +G +AL L  +  PD++++D+ L  + G E
Sbjct: 12  TILVVEDDENIQQLVGYNLVKAGFQVVYADHGEQALALVFRENPDLVLLDLMLPGLDGGE 71

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE 122
           + K ++ D   + +P++ +TA   + +       G + YI+KP S  I +  +K  +  
Sbjct: 72  VCKALRRDPRSRHLPIVMLTARGDEDEISAGLDLGADDYITKPFSPKILVARVKAALRR 130


>gi|90415561|ref|ZP_01223495.1| DNA-binding response regulator PhoB [ma