RPSBLAST alignment for GI: 254780476 and conserved domain: pfam00072

>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Length = 111
 Score = 91.9 bits (229), Expect = 4e-20
 Identities = 37/113 (32%), Positives = 65/113 (57%), Gaps = 2/113 (1%)

Query: 5   VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64
           V+IV+D+ L  +L R L+E  GY+  +  +G EALEL ++ +PD+I++DI++  + GLE+
Sbjct: 1   VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLEL 60

Query: 65  TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
            ++I+        PVI +TA   + D     K G   ++SKP      +  ++
Sbjct: 61  LRRIRRRPP--TTPVIVLTAHGDEEDAVEALKAGANDFLSKPFDPEELVAALR 111