RPSBLAST alignment for GI: 254780476 and conserved domain: PRK10610

>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional. Length = 129
 Score = 52.3 bits (125), Expect = 3e-08
 Identities = 30/116 (25%), Positives = 59/116 (50%), Gaps = 1/116 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQ-TRNGMEALELARQHKPDVIIMDIQLQEISGL 62
           K ++V+D     ++ R+L++  G+  ++   +G++AL   +      +I D  +  + GL
Sbjct: 7   KFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFVISDWNMPNMDGL 66

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           E+ K I+ D  +  +PV+ VTA A K +     + G   Y+ KP + +   E + K
Sbjct: 67  ELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNK 122