RPSBLAST alignment for GI: 254780476 and conserved domain: PRK10693

>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional. Length = 303
 Score = 40.7 bits (96), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 34  NGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEER 93
           NG++ALEL     PD+II D+ +  ++G+E  + ++  +   + PV+ ++A     D  +
Sbjct: 5   NGVDALELLGGFTPDLIICDLAMPRMNGIEFVEHLR--NRGDQTPVLVISATENMADIAK 62

Query: 94  IRKGGCEAYISKPIS 108
             + G +  + KP+ 
Sbjct: 63  ALRLGVQDVLLKPVK 77