RPSBLAST alignment for GI: 254780476 and conserved domain: PRK11083

>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional. Length = 228
 Score = 51.1 bits (123), Expect = 6e-08
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 10/78 (12%)

Query: 35  GMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDE-ER 93
           G+ AL+  RQ  PD++I+D+ L +ISG E+ +Q+        +PVI +TA   + DE +R
Sbjct: 36  GLPALDKLRQQPPDLVILDVGLPDISGFELCRQLLA--FHPALPVIFLTA---RSDEVDR 90

Query: 94  IRKG---GCEAYISKPIS 108
           +  G   G + Y++KP S
Sbjct: 91  L-VGLEIGADDYVAKPFS 107