RPSBLAST alignment for GI: 254780476 and conserved domain: PRK11107

>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional. Length = 919
 Score = 94.1 bits (235), Expect = 7e-21
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 8/108 (7%)

Query: 4   KVMIVEDNELNMKL----FRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEI 59
            VM V+DN  N+KL      + +E      +   +G +A+E A+Q   D+I+MDIQ+  +
Sbjct: 669 TVMAVDDNPANLKLIGALLEEQVEH----VVLCDSGHQAVEQAKQRPFDLILMDIQMPGM 724

Query: 60  SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI 107
            G+   + I++    Q  P+IAVTA AM G+ ER+   G + Y++KPI
Sbjct: 725 DGIRACELIRQLPHNQNTPIIAVTAHAMAGERERLLSAGMDDYLAKPI 772