RPSBLAST alignment for GI: 254780476 and conserved domain: PRK13435

>gnl|CDD|184052 PRK13435, PRK13435, response regulator; Provisional. Length = 145
 Score = 44.3 bits (105), Expect = 8e-06
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGY-IALQTRNGMEALELARQHKPDVIIMDIQLQE-ISG 61
           KV+IVED  L       L+E +G+ +     +  +A+ L R+ +PDV ++D+ L +  +G
Sbjct: 7   KVLIVEDEALIALELEKLVEEAGHEVVGIAMSSEQAIALGRRRQPDVALVDVHLADGPTG 66

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG--GCEAYISKPISLS 110
           +E+ +++   S    + V+ +T     G+ ER+     G    I+KP S  
Sbjct: 67  VEVARRL---SADGGVEVVFMT-----GNPERVPHDFAGALGVIAKPYSPR 109