RPSBLAST alignment for GI: 254780476 and conserved domain: PRK15369

>gnl|CDD|185267 PRK15369, PRK15369, two component system sensor kinase SsrB; Provisional. Length = 211
 Score = 47.8 bits (114), Expect = 8e-07
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 4   KVMIVEDNELNMKLFRDLIET--SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           K+++V+D+EL +   ++++       I  Q  NG+E     RQ +PD++I+D+ L  ++G
Sbjct: 5   KILLVDDHELIINGIKNMLAPYPRYKIVGQVDNGLEVYNACRQLEPDIVILDLGLPGMNG 64

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117
           L++  Q+        + ++ +TA   +    R    G   Y+ K     I +  I+
Sbjct: 65  LDVIPQLH--QRWPAMNILVLTARQEEHMASRTLAAGALGYVLKKSPQQILLAAIQ 118