RPSBLAST alignment for GI: 254780476 and conserved domain: COG2201

>gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]. Length = 350
 Score = 62.6 bits (152), Expect = 3e-11
 Identities = 32/107 (29%), Positives = 62/107 (57%), Gaps = 7/107 (6%)

Query: 4   KVMIVEDNELNMKLFRDLIETSG--YIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61
           +V++V+D+ L  K+  D++ +     +    RNG EA++  ++ KPDVI +D+++  + G
Sbjct: 3   RVLVVDDSALMRKVISDILNSDPDIEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDG 62

Query: 62  LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKP 106
           LE  ++I     L+ +PVI V++   +G E  +   + G   +I+KP
Sbjct: 63  LEALRKIM---RLRPLPVIMVSSLTEEGAEATLEALELGAVDFIAKP 106