RPSBLAST alignment for GI: 254780476 and conserved domain: COG2204

>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464
 Score = 67.6 bits (165), Expect = 7e-13
 Identities = 30/123 (24%), Positives = 64/123 (52%), Gaps = 8/123 (6%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+ ++++V+D+    +L    +E +GY  +   +  EALE   +   D++++DI++  + 
Sbjct: 3   MMARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMD 62

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR---KGGCEAYISKPISLSIFMETIK 117
           GLE+ K+IK      ++PVI +T     GD +      + G   ++ KP  L   +  ++
Sbjct: 63  GLELLKEIKSRDP--DLPVIVMTGH---GDIDTAVEALRLGAFDFLEKPFDLDRLLAIVE 117

Query: 118 KYI 120
           + +
Sbjct: 118 RAL 120