RPSBLAST alignment for GI: 254780476 and conserved domain: COG3706

>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]. Length = 435
 Score = 43.8 bits (103), Expect = 1e-05
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 27  YIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFA 86
                 + G+ AL +   HKPD  ++D+ +  + G E+ +++K +       V+ VTA  
Sbjct: 13  KEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLKAEPA----TVVMVTALD 68

Query: 87  MKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
                 R  K G + +++KP++ S      K 
Sbjct: 69  DSAPRVRGLKAGADDFLTKPVNDSQLFLRAKS 100