RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers. Length = 113 Score = 92.6 bits (230), Expect = 3e-20 Identities = 38/115 (33%), Positives = 66/115 (57%), Gaps = 2/115 (1%) Query: 6 MIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEIT 65 +IV+D+ L +L R L+E GY ++ +G EAL L + KPD+I++DI + + GLE+ Sbjct: 1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELL 60 Query: 66 KQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 ++I++ +IP+I +TA D K G + Y++KP S + I+ + Sbjct: 61 RRIRKR--GPDIPIIFLTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113 >gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Length = 111 Score = 91.9 bits (229), Expect = 4e-20 Identities = 37/113 (32%), Positives = 65/113 (57%), Gaps = 2/113 (1%) Query: 5 VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64 V+IV+D+ L +L R L+E GY+ + +G EALEL ++ +PD+I++DI++ + GLE+ Sbjct: 1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLEL 60 Query: 65 TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117 ++I+ PVI +TA + D K G ++SKP + ++ Sbjct: 61 LRRIRRRPP--TTPVIVLTAHGDEEDAVEALKAGANDFLSKPFDPEELVAALR 111 >gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms]. Length = 130 Score = 79.1 bits (194), Expect = 2e-16 Identities = 40/126 (31%), Positives = 74/126 (58%), Gaps = 5/126 (3%) Query: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNG-MEALELARQHK-PDVIIMDIQLQE 58 +V++V+D +N +L + L+E GY ++ +G EALEL R+ PD+I++DI + Sbjct: 4 SGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEALELLRELPQPDLILLDINMPG 63 Query: 59 ISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLS-IFMETIK 117 + G+E+ ++++ IPVI +TA+A + D ER G + Y++KPI L + ++ Sbjct: 64 MDGIELLRRLRAR--GPNIPVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALR 121 Query: 118 KYIGEA 123 + + A Sbjct: 122 RLLARA 127 >gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]. Length = 360 Score = 75.7 bits (186), Expect = 3e-15 Identities = 38/118 (32%), Positives = 71/118 (60%), Gaps = 1/118 (0%) Query: 4 KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63 V++V+D N++ R L+ GY ++ NG EAL+L ++ PD++++D+++ E+ G E Sbjct: 16 TVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAE 75 Query: 64 ITKQIKEDSEL-QEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 + ++K S + IPVI +TA+A D +R + G + Y+SKPIS + + ++ Sbjct: 76 VLNKLKAMSPSTRRIPVILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSSHL 133 >gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms]. Length = 786 Score = 72.8 bits (178), Expect = 2e-14 Identities = 38/118 (32%), Positives = 71/118 (60%), Gaps = 2/118 (1%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALE-LARQHKPDVIIMDIQLQEISG 61 K+++V+DN +N K+ +++ G + +G EAL+ L H DVI MD+Q+ E+ G Sbjct: 667 PKILLVDDNPVNRKVATGMLKKLGAEVTEVNSGQEALDKLKPPHSYDVIFMDLQMPEMDG 726 Query: 62 LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119 E T++I++ E +P++A+TA A EE + G + Y+SKP +L ++ ++++ Sbjct: 727 YEATREIRKK-ERWHLPIVALTADADPSTEEECLEVGMDGYLSKPFTLEKLVKILREF 783 >gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 229 Score = 68.1 bits (166), Expect = 7e-13 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 2/118 (1%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62 ++++VED+ +L ++ +E GY +G EALE AR+ PD++++D+ L ++ GL Sbjct: 1 MRILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPDLDGL 59 Query: 63 EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 E+ ++++ P+I +TA + D + G + Y++KP S + ++ + Sbjct: 60 ELCRRLRAKKGSG-PPIIVLTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALL 116 >gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464 Score = 67.6 bits (165), Expect = 7e-13 Identities = 30/123 (24%), Positives = 64/123 (52%), Gaps = 8/123 (6%) Query: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60 M+ ++++V+D+ +L +E +GY + + EALE + D++++DI++ + Sbjct: 3 MMARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMD 62 Query: 61 GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR---KGGCEAYISKPISLSIFMETIK 117 GLE+ K+IK ++PVI +T GD + + G ++ KP L + ++ Sbjct: 63 GLELLKEIKSRDP--DLPVIVMTGH---GDIDTAVEALRLGAFDFLEKPFDLDRLLAIVE 117 Query: 118 KYI 120 + + Sbjct: 118 RAL 120 >gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211 Score = 65.7 bits (160), Expect = 3e-12 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 4/116 (3%) Query: 4 KVMIVEDNELNMKLFRDLIETSG--YIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61 KV+IV+D+ L + R L+E + + NG EAL+LAR+ KPDV+++D+ + + G Sbjct: 2 KVLIVDDHPLVREGLRQLLELEPDLEVVGEASNGEEALDLARELKPDVVLLDLSMPGMDG 61 Query: 62 LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIK 117 LE KQ++ +I V+ +TA R + G + Y+ K S +E I+ Sbjct: 62 LEALKQLRA--RGPDIKVVVLTAHDDPAYVIRALRAGADGYLLKDASPEELVEAIR 115 >gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]. Length = 475 Score = 63.0 bits (153), Expect = 2e-11 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 11/125 (8%) Query: 4 KVMIVEDNELNMKLFRDLIETSGY---IALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60 KV+IV+D L + + LI+ + NG EALEL ++ +PD++I DI + + Sbjct: 3 KVLIVDDEPLIREGLKSLIDWEALGIEVVGTAANGKEALELIQETQPDIVITDINMPGMD 62 Query: 61 GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPISLSIFMETIK 117 GL++ K IKE S + I ++ + + E +K G + Y+ KP+ + E +K Sbjct: 63 GLDLIKAIKEQS--PDTEFIILSGY---DEFEYAKKAMKLGVKDYLLKPVDKAELEEALK 117 Query: 118 KYIGE 122 K IG+ Sbjct: 118 KIIGK 122 >gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]. Length = 350 Score = 62.6 bits (152), Expect = 3e-11 Identities = 32/107 (29%), Positives = 62/107 (57%), Gaps = 7/107 (6%) Query: 4 KVMIVEDNELNMKLFRDLIETSG--YIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61 +V++V+D+ L K+ D++ + + RNG EA++ ++ KPDVI +D+++ + G Sbjct: 3 RVLVVDDSALMRKVISDILNSDPDIEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDG 62 Query: 62 LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIR--KGGCEAYISKP 106 LE ++I L+ +PVI V++ +G E + + G +I+KP Sbjct: 63 LEALRKIM---RLRPLPVIMVSSLTEEGAEATLEALELGAVDFIAKP 106 >gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]. Length = 435 Score = 59.9 bits (145), Expect = 2e-10 Identities = 28/109 (25%), Positives = 64/109 (58%), Gaps = 6/109 (5%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62 KK+++V+D+ + R +++ G+ ++ +G EAL + PD++++D + ++ GL Sbjct: 133 KKILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGL 192 Query: 63 EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKG---GCEAYISKPIS 108 E+ ++++ ++IP+I +++ K D+E + + G YI+KPI Sbjct: 193 ELCTRLRQLERTRDIPIILLSS---KDDDELVVRAFELGVNDYITKPIE 238 Score = 43.8 bits (103), Expect = 1e-05 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 4/92 (4%) Query: 27 YIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFA 86 + G+ AL + HKPD ++D+ + + G E+ +++K + V+ VTA Sbjct: 13 KEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLKAEPA----TVVMVTALD 68 Query: 87 MKGDEERIRKGGCEAYISKPISLSIFMETIKK 118 R K G + +++KP++ S K Sbjct: 69 DSAPRVRGLKAGADDFLTKPVNDSQLFLRAKS 100 >gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed. Length = 240 Score = 53.2 bits (128), Expect = 2e-08 Identities = 29/106 (27%), Positives = 61/106 (57%), Gaps = 3/106 (2%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62 +K+++V+D K+ + GY + +G EAL+L R+ +PD++I+D+ + ++ G Sbjct: 7 EKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDGY 66 Query: 63 EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108 + ++I+++S ++P+I +TA D + G + Y+ KP S Sbjct: 67 GVCQEIRKES---DVPIIMLTALGDVSDRITGLELGADDYVVKPFS 109 >gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]. Length = 361 Score = 51.9 bits (124), Expect = 5e-08 Identities = 26/105 (24%), Positives = 59/105 (56%), Gaps = 4/105 (3%) Query: 4 KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63 +++IV+D+ +KL ++ +G+ + +EAL+L KPD+I +DI + ++G+E Sbjct: 2 RIIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIE 61 Query: 64 ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108 +Q+++ +P+I +++ A D+ + Y+ KP++ Sbjct: 62 FAEQVRD--IESAVPIIFISSHAEYADDS--FGMNLDDYLPKPVT 102 >gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms]. Length = 202 Score = 51.0 bits (122), Expect = 7e-08 Identities = 26/116 (22%), Positives = 56/116 (48%), Gaps = 2/116 (1%) Query: 5 VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEI 64 V +V+D+E L+E++G+ + E L A +P +++D+++ +SGLE+ Sbjct: 7 VHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLEL 66 Query: 65 TKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 ++ E +PVI +T + K G ++ KP S ++ +++ + Sbjct: 67 QDRLAE--RGIRLPVIFLTGHGDIPMAVQAMKAGAVDFLEKPFSEQDLLDAVERAL 120 >gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms]. Length = 194 Score = 50.2 bits (120), Expect = 1e-07 Identities = 34/117 (29%), Positives = 64/117 (54%), Gaps = 4/117 (3%) Query: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIAL-QTRNGMEALELARQHKPDVIIMDIQLQEI 59 ML +V++ +D L R+ + +GY + + +G+EA+E+ + +PDV+I+DI E+ Sbjct: 4 MLLRVLVADDEALTRMDIREGLLEAGYQRVGEAADGLEAVEVCERLQPDVVILDI---EM 60 Query: 60 SGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETI 116 +I + + SE P++A+TA++ E + G AYI KP+ S + + Sbjct: 61 PRRDIIEALLLASENVARPIVALTAYSDPALIEAAIEAGVMAYIVKPLDESRLLPIL 117 >gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]. Length = 224 Score = 48.7 bits (116), Expect = 4e-07 Identities = 28/121 (23%), Positives = 61/121 (50%), Gaps = 10/121 (8%) Query: 4 KVMIVEDNELNMKLFRDLIETSGY--IALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61 V+I+ED+ + ++ R ++ + EA + + KPD+I++DI + + +G Sbjct: 2 NVLIIEDDPMVAEIHRRYVKQIPGFSVVGTAGTLEEAKMIIEEFKPDLILLDIYMPDGNG 61 Query: 62 LEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRK---GGCEAYISKPISLSIFMETIKK 118 +E+ +++ S+ + VI +TA + D E I++ G Y+ KP + + + + Sbjct: 62 IELLPELR--SQHYPVDVIVITAAS---DMETIKEALRYGVVDYLIKPFTFERLQQALTR 116 Query: 119 Y 119 Y Sbjct: 117 Y 117 >gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]. Length = 182 Score = 44.6 bits (105), Expect = 7e-06 Identities = 25/105 (23%), Positives = 57/105 (54%), Gaps = 4/105 (3%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62 K +++V+D+ ++ +E G+ + + EAL AR P ++D++L + SGL Sbjct: 10 KSLLLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGL 69 Query: 63 EITKQIKEDSELQEIPVIAVTAFA-MKGDEERIRKGGCEAYISKP 106 + + ++E ++ ++ +T +A + E ++ G C+ Y++KP Sbjct: 70 AVIEALRE--RRADMRIVVLTGYASIATAVEAVKLGACD-YLAKP 111 >gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]. Length = 244 Score = 42.3 bits (99), Expect = 4e-05 Identities = 33/120 (27%), Positives = 61/120 (50%), Gaps = 8/120 (6%) Query: 4 KVMIVEDNELNMKLFRDLIETS--GYIALQTRNGMEALELARQHKPDVIIMDIQLQEISG 61 KV+IV+D L + R ++ I + NG EAL+L + +PD++ +DI + +I+G Sbjct: 3 KVLIVDDEPLAREELRRILNEIPDIEIVGEAENGEEALQLLQGLRPDLVFLDIAMPDING 62 Query: 62 LEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 +E+ +I++ D + V A +A+ E Y+ KPIS +T+++ Sbjct: 63 IELAARIRKGDPRPAIVFVTAHDEYAVAAFEVEA-----LDYLLKPISEERLAKTLERLR 117 >gnl|CDD|145766 pfam02782, FGGY_C, FGGY family of carbohydrate kinases, C-terminal domain. This domain adopts a ribonuclease H-like fold and is structurally related to the N-terminal domain. Length = 193 Score = 30.7 bits (70), Expect = 0.090 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Query: 17 LFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMD 53 L+R ++E +ALQ R +EAL D II Sbjct: 119 LYRAILEG---LALQLRQILEALA-ELGAPIDRIIAS 151 >gnl|CDD|176521 cd08579, GDPD_memb_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor. Length = 220 Score = 29.1 bits (66), Expect = 0.36 Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 26 GYIALQTRNGMEALELARQHKPDVIIMDIQL 56 G + N +EALE A + KPD + +D+Q Sbjct: 6 GVSSNGVENTLEALEAAIKAKPDYVEIDVQE 36 >gnl|CDD|153436 cd07967, OBF_DNA_ligase_III, The Oligonucleotide/oligosaccharide binding (OB)-fold domain of ATP-dependent DNA ligase III is a DNA-binding module that is part of the catalytic core unit. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriohages, eukarya, archaea and bacteria. There are three classes of ATP-dependent DNA ligases in eukaryotic cells (I, III and IV). DNA ligase III is not found in lower eukaryotes and is present both in the nucleus and mitochondria. It has several isoforms; two splice forms, III-alpha and III-beta, differ in their carboxy-terminal sequences. DNA ligase III-beta is believed to play a role in homologous recombination during meiotic prophase. DNA ligase III-alpha interacts with X-ray Cross Complementing factor 1 (XRCC1) and functions in single nucleotide Base Excision Repair (BER). The mitochondrial form of DNA ligase III originates from the nucleolus and is involved in the mitochondrial DNA repair pathway. This isoform is expressed by a second start site on the DNA ligase III gene. DNA ligases have a highly modular architecture consisting of a unique arrangement of two or more discrete domains. The adenylation and C-terminal oligouncleotide/oligosaccharide binding (OB)-fold domains comprise a catalytic core unit that is common to most members of the ATP-dependent DNA ligase family. The catalytic core unit contains six conserved sequence motifs (I, III, IIIa, IV, V and VI) that define this family of related nucleotidyltransferases. The OB-fold domain contacts the nicked DNA substrate and is required for the ATP-dependent DNA ligase nucleotidylation step. The RxDK motif (motif VI), which is essential for ATP hydrolysis, is located in the OB-fold domain. Length = 139 Score = 28.1 bits (63), Expect = 0.71 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Query: 39 LELARQHKPDVIIMDI---QLQEISGLEITK 66 L+ + PD I+ D + EI+G E +K Sbjct: 76 LKCNKSLVPDFIVKDPKKAPVWEITGAEFSK 106 >gnl|CDD|145645 pfam02606, LpxK, Tetraacyldisaccharide-1-P 4'-kinase. This family consists of tetraacyldisaccharide-1-P 4'-kinase also known as Lipid-A 4'-kinase or Lipid A biosynthesis protein LpxK, EC:2.7.1.130. This enzyme catalyses the reaction: ATP + 2,3-bis(3-hydroxytetradecanoyl)-D -glucosaminyl-(beta-D-1,6)-2, 3-bis(3-hydroxytetradecanoyl)-D-glu cosam inyl beta-phosphate <=> ADP + 2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-D- glucosaminyl-1,6-beta-D-glucosamine 1,4'-bisphosphate. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS). The family contains a P-loop motif at the N terminus. Length = 318 Score = 27.5 bits (62), Expect = 0.96 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 38 ALELARQHKPDVIIMD 53 A L H DVII+D Sbjct: 119 ARALLEAHGADVIILD 134 >gnl|CDD|144163 pfam00465, Fe-ADH, Iron-containing alcohol dehydrogenase. Length = 312 Score = 27.6 bits (62), Expect = 1.00 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 36 MEALELARQHKPDVII 51 EA AR+ DVII Sbjct: 69 DEAAAAAREEGADVII 84 >gnl|CDD|113680 pfam04916, Phospholip_B, Phospholipase B. Phospholipase B (PLB) catalyses the hydrolytic cleavage of both acylester bonds of glycerophospholipids. This family of PLB enzymes has been identified in mammals, flies and nematodes but not in yeast. In Drosophila this protein was named LAMA for laminin ancestor since it is expressed in the neuronal and glial precursors that surround the lamina. Length = 563 Score = 26.7 bits (59), Expect = 1.7 Identities = 8/26 (30%), Positives = 12/26 (46%) Query: 22 IETSGYIALQTRNGMEALELARQHKP 47 I +SG ++T G L L + P Sbjct: 284 ITSSGLAVIETTIGNYNLTLLKNVVP 309 >gnl|CDD|173937 cd08178, AAD_C, C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD). Alcohol dehydrogenase domain located on the C-terminal of a bifunctional two-domain protein. The N-terminal of the protein contains an acetaldehyde-CoA dehydrogenase domain. This protein is involved in pyruvate metabolism. Pyruvate is converted to acetyl-CoA and formate by pyruvate formate-lysase (PFL). Under anaerobic condition, acetyl-CoA is reduced to acetaldehyde and ethanol by this two-domain protein. Acetyl-CoA is first converted into an enzyme-bound thiohemiacetal by the N-terminal acetaldehyde dehydrogenase domain. The enzyme-bound thiohemiacetal is subsequently reduced by the C-terminal NAD+-dependent alcohol dehydrogenase domain. In E. coli, this protein is called AdhE and was shown pyruvate formate-lysase (PFL) deactivase activity, which is involved in the inactivation of PFL, a key enzyme in anaerobic metabolism. In Escherichia coli and Entamoeba histolytica, this enzyme forms homopolymeric peptides composed of more than 20 protomers associated in a helical rod-like structure. Length = 398 Score = 26.8 bits (60), Expect = 1.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Query: 36 MEALELARQHKPDVII 51 + LEL KPD II Sbjct: 68 RKGLELMNSFKPDTII 83 >gnl|CDD|35947 KOG0728, KOG0728, KOG0728, 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]. Length = 404 Score = 26.1 bits (57), Expect = 2.9 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 27 YIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQ 75 YI +R E +AR+H P +I MD ++ I + DSE+Q Sbjct: 221 YIGEGSRMVRELFVMAREHAPSIIFMD-EIDSIGSSRVESGSGGDSEVQ 268 >gnl|CDD|30371 COG0021, TktA, Transketolase [Carbohydrate transport and metabolism]. Length = 663 Score = 25.9 bits (57), Expect = 3.2 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query: 14 NMKLFR--DLIETSG--YIALQTRNGMEALELARQHKP 47 N+ + R D ET+ AL+ ++G AL L RQ+ P Sbjct: 487 NLSVIRPADANETAAAWKYALERKDGPTALILTRQNLP 524 >gnl|CDD|30537 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair]. Length = 804 Score = 25.6 bits (56), Expect = 4.1 Identities = 11/26 (42%), Positives = 19/26 (73%) Query: 51 IMDIQLQEISGLEITKQIKEDSELQE 76 I+D++L+ ++GLE K KE EL++ Sbjct: 423 ILDLRLRRLTGLEEEKIEKELKELEK 448 >gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 439 Score = 24.9 bits (54), Expect = 5.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 39 LELARQHKPDVIIMD 53 E+AR++KP +I +D Sbjct: 218 FEMARENKPSIIFID 232 >gnl|CDD|163654 cd07411, MPP_SoxB_N, Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain. SoxB (sulfur oxidation protein B) is a periplasmic thiosulfohydrolase and an essential component of the sulfur oxidation pathway in archaea and bacteria. SoxB has a dinuclear manganese cluster and is thought to catalyze the release of sulfate from a protein-bound cysteine S-thiosulfonate. SoxB is expressed from the sox (sulfur oxidation) gene cluster, which encodes 15 other sox genes, and has two domains, an N-terminal metallophosphatase domain and a C-terminal 5'-nucleotidase domain. SoxB binds the SoxYZ complex and is thought to function as a sulfate-thiohydrolase. SoxB is closely related to the UshA, YchR, and CpdB proteins, all of which have the same two-domain architecture. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 264 Score = 24.9 bits (55), Expect = 5.8 Identities = 8/41 (19%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Query: 40 ELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVI 80 +L R+ DV+++ +S + ++ + I VI Sbjct: 177 KLRREEGVDVVVL------LSHNGLPVDVELAERVPGIDVI 211 >gnl|CDD|147744 pfam05758, Ycf1, Ycf1. The chloroplast genomes of most higher plants contain two giant open reading frames designated ycf1 and ycf2. Although the function of Ycf1 is unknown, it is known to be an essential gene. Length = 832 Score = 24.6 bits (54), Expect = 6.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 106 PISLSIFMETIKKYI 120 P SLS F E I++ I Sbjct: 352 PPSLSTFGEMIERKI 366 >gnl|CDD|163616 cd00840, MPP_Mre11_N, Mre11 nuclease, N-terminal metallophosphatase domain. Mre11 (also known as SbcD in Escherichia coli) is a subunit of the MRX protein complex. This complex includes: Mre11, Rad50, and Xrs2/Nbs1, and plays a vital role in several nuclear processes including DNA double-strand break repair, telomere length maintenance, cell cycle checkpoint control, and meiotic recombination, in eukaryotes. During double-strand break repair, the MRX complex is required to hold the two ends of a broken chromosome together. In vitro studies show that Mre11 has 3'-5' exonuclease activity on dsDNA templates and endonuclease activity on dsDNA and ssDNA templates. In addition to the N-terminal phosphatase domain, the eukaryotic MRE11 members of this family have a C-terminal DNA binding domain (not included in this alignment model). MRE11-like proteins are found in prokaryotes and archaea was well as in eukaryotes. Mre11 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 223 Score = 24.6 bits (54), Expect = 6.7 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 37 EALELARQHKPDVIIM 52 E +ELA + K D +++ Sbjct: 32 EIVELAIEEKVDFVLI 47 >gnl|CDD|31415 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]. Length = 406 Score = 24.4 bits (53), Expect = 7.5 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Query: 27 YIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQ 75 YI R E ELAR+ P +I +D ++ I D E+Q Sbjct: 225 YIGEGARLVRELFELAREKAPSIIFID-EIDAIGAKRFDSGTSGDREVQ 272 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,385,570 Number of extensions: 66262 Number of successful extensions: 327 Number of sequences better than 10.0: 1 Number of HSP's gapped: 308 Number of HSP's successfully gapped: 63 Length of query: 123 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 41 Effective length of database: 4,491,799 Effective search space: 184163759 Effective search space used: 184163759 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)