RPSBLAST alignment of GI: 254780476 and protein with PDBid: 1dcf

>1dcf_A ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136
 Score = 85.8 bits (212), Expect = 2e-18
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 4/121 (3%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            KV+++++N ++  + + L+   G       +  E L     H+  V+ MD+ +  +   
Sbjct: 8   LKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLR-VVSHEHKVVFMDVCMPGVENY 66

Query: 63  EITKQIKE---DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119
           +I  +I E       Q   ++A++    K  +E+    G +  + KP+SL    + +   
Sbjct: 67  QIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDL 126

Query: 120 I 120
           +
Sbjct: 127 L 127