RPSBLAST alignment of GI: 254780476 and protein with PDBid: 1p2f

>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 Length = 220
 Score = 58.2 bits (140), Expect = 4e-10
 Identities = 28/120 (23%), Positives = 60/120 (50%), Gaps = 5/120 (4%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M+ K+ +V+D++  +K   + ++  G +      G + L    +    V+++D+ L + S
Sbjct: 1   MMWKIAVVDDDKNILKKVSEKLQQLGRVK-TFLTGEDFLN--DEEAFHVVVLDVMLPDYS 57

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G EI + IKE     E  VI +T  +      +  + G + Y++KP +  I +  +K+++
Sbjct: 58  GYEICRMIKETR--PETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFL 115