RPSBLAST alignment of GI: 254780476 and protein with PDBid: 1p6q

>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129
 Score = 93.4 bits (232), Expect = 1e-20
 Identities = 22/119 (18%), Positives = 56/119 (47%), Gaps = 1/119 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQT-RNGMEALELARQHKPDVIIMDIQLQEISGL 62
           KV+IV+D   +  L  D ++  G+  +    +G + +++  Q+   ++I D  + ++ GL
Sbjct: 8   KVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGL 67

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIG 121
            + + ++ +   ++   I +TA   +   ++    G    ++KP ++      I+   G
Sbjct: 68  GLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFG 126