RPSBLAST alignment of GI: 254780476 and protein with PDBid: 1qkk

>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155
 Score = 85.8 bits (212), Expect = 3e-18
 Identities = 22/117 (18%), Positives = 52/117 (44%), Gaps = 2/117 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            V +++D+    K  +  +E +G+      +  EAL         ++I DI++  + GL 
Sbjct: 5   SVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLA 64

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           + ++I       ++P+I VT         +  + G   +I+KP +    +++ ++  
Sbjct: 65  LFRKILALD--PDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAE 119