RPSBLAST alignment of GI: 254780476 and protein with PDBid: 1srr

>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124
 Score = 93.4 bits (232), Expect = 1e-20
 Identities = 33/120 (27%), Positives = 67/120 (55%), Gaps = 2/120 (1%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M +K++IV+D      L  ++    GY   Q  NG++AL++  + +PD++++D+++  + 
Sbjct: 2   MNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMD 61

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+EI K++K   E   I VI +TA+      +  ++ G   + +KP  +    + +KKY+
Sbjct: 62  GIEILKRMKVIDE--NIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 119