RPSBLAST alignment of GI: 254780476 and protein with PDBid: 2pl1

>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121
 Score = 66.7 bits (162), Expect = 1e-12
 Identities = 27/115 (23%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
           +V++VEDN L     +  I+ +G+      +  EA     +H PD+ I+D+ L +  GL 
Sbjct: 2   RVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGLS 61

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKK 118
           + ++ + +     I  + +TA     D+  +   G + Y++KP  +   M  ++ 
Sbjct: 62  LIRRWRSNDVSLPI--LVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQA 114