RPSBLAST alignment of GI: 254780476 and protein with PDBid: 2zwm

>2zwm_A Transcriptional regulatory protein YYCF; two-component system, response regulator, dimerization domain, phosphorylation site, cytoplasm; 2.04A {Bacillus subtilis} Length = 130
 Score = 96.1 bits (239), Expect = 2e-21
 Identities = 30/120 (25%), Positives = 65/120 (54%), Gaps = 3/120 (2%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           M KK+++V+D +    +    +   GY      +G EA+E+  + +PD+I++DI L    
Sbjct: 1   MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKD 60

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G+E+ +++++     ++P+I +TA   + D+    + G + Y++KP S    +  +K  +
Sbjct: 61  GVEVCREVRKKY---DMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANL 117