RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3bre

>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358
 Score = 96.7 bits (240), Expect = 1e-21
 Identities = 22/118 (18%), Positives = 51/118 (43%), Gaps = 1/118 (0%)

Query: 4   KVMIVEDNELNMKLFRDLIET-SGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGL 62
            V++V+D  +  +  R  + + +G       +  +A+ +A Q KP VI+ D+ +  + GL
Sbjct: 20  MVLLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGL 79

Query: 63  EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
            +    + +   ++IP+I ++       +      G   Y+ K       +  I+ + 
Sbjct: 80  TLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHS 137