RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3c3w

>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis} Length = 225
 Score = 51.5 bits (122), Expect = 6e-08
 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 4  KVMIVEDNELNMKLFRDLIETSGYIAL--QTRNGMEALELARQHKPDVIIMDIQLQEISG 61
          KV +V+D+E+  +   DL+     + +  +  +  EA+      +PDV ++D++L + +G
Sbjct: 3  KVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNG 62