RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3h5i

>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140
 Score = 71.6 bits (175), Expect = 4e-14
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 5/120 (4%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELA-RQHKPDVIIMDIQL-QEIS 60
           KK++IVED++   K   +++   GY       G  A+E       PD+I+MDI+L + + 
Sbjct: 6   KKILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGWYPDLILMDIELGEGMD 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120
           G++    I++ SE   +PV+ +TA       E+IR      Y+ K  +  + +  ++  +
Sbjct: 66  GVQTALAIQQISE---LPVVFLTAHTEPAVVEKIRSVTAYGYVMKSATEQVLITIVEMAL 122