RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3heb

>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, protein structure initiative; 2.40A {Rhodospirillum rubrum atcc 11170} Length = 152
 Score = 84.4 bits (208), Expect = 6e-18
 Identities = 26/129 (20%), Positives = 60/129 (46%), Gaps = 11/129 (8%)

Query: 1   MLKKVMIVEDNELNMKLFRDLIETSGYI-----------ALQTRNGMEALELARQHKPDV 49
           +   ++++ED+  + +L    I  +G             AL    G +        +  +
Sbjct: 3   LSVTIVMIEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSALNYLFGDDKSGRVSAGRAQL 62

Query: 50  IIMDIQLQEISGLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109
           +++D+ L +++G++I K +KE+   +  PV+ +T    + + +R    G   YI+KP++ 
Sbjct: 63  VLLDLNLPDMTGIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNY 122

Query: 110 SIFMETIKK 118
             F   I++
Sbjct: 123 ENFANAIRQ 131