RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3ilh

>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406} Length = 146
 Score = 70.6 bits (172), Expect = 1e-13
 Identities = 22/132 (16%), Positives = 54/132 (40%), Gaps = 10/132 (7%)

Query: 2   LKKVMIVEDNELNMKLFRDLIETSGYIA--LQTRNGMEALELARQ-----HKPDVIIMDI 54
           +  V++++D+++   L   +I  +  +       +G  A+    +       P +I +DI
Sbjct: 9   IDSVLLIDDDDIVNFLNTTIIRMTHRVEEIQSVTSGNAAINKLNELYAAGRWPSIICIDI 68

Query: 55  QLQEISGLEITKQIKE--DSELQEIPVIAVTAFAMKGDEER-IRKGGCEAYISKPISLSI 111
            +  I+G E+    K+       +  V  +++     D+ +       + Y+SKP++ + 
Sbjct: 69  NMPGINGWELIDLFKQHFQPMKNKSIVCLLSSSLDPRDQAKAEASDWVDYYVSKPLTANA 128

Query: 112 FMETIKKYIGEA 123
                 K + E 
Sbjct: 129 LNNLYNKVLNEG 140