RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3kht

>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396} Length = 144
 Score = 96.9 bits (241), Expect = 1e-21
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 3/118 (2%)

Query: 3   KKVMIVEDNELNMKLFRDLIETSG--YIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60
           K+V++VEDN  ++ L R +++            NG +AL   +Q K D+II+DI L   +
Sbjct: 6   KRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQAKYDLIILDIGLPIAN 65

Query: 61  GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPI-SLSIFMETIK 117
           G E+   +++    Q  P++ +T        ++    G  + + K   +++ F   I 
Sbjct: 66  GFEVMSAVRKPGANQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIY 123