RPSBLAST alignment of GI: 254780476 and protein with PDBid: 3kto

>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136
 Score = 82.0 bits (202), Expect = 3e-17
 Identities = 13/120 (10%), Positives = 36/120 (30%)

Query: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63
            + +V+  +        L+           +    +          +I++  L++     
Sbjct: 8   IIYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQISDDAIGMIIEAHLEDKKDSG 67

Query: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGEA 123
           I            +P I + + +      R  +     +I KP    + +  +++ I  A
Sbjct: 68  IELLETLVKRGFHLPTIVMASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGA 127