BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] (123 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 248 bits (632), Expect = 4e-68, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS Sbjct: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60 Query: 61 GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI Sbjct: 61 GLEITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYI 120 Query: 121 GEA 123 GEA Sbjct: 121 GEA 123 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 41.6 bits (96), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 25/107 (23%), Positives = 58/107 (54%), Gaps = 4/107 (3%) Query: 5 VMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELAR--QHKPDVIIMDIQLQEISGL 62 V++VED + + + ++ET GY + +G +AL++ Q + D++I D+ + E+ G Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743 Query: 63 EITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISL 109 + +++++ + I ++ +A + + K +++SKP SL Sbjct: 744 TLLRELRK--TYPSLKFIFISGYAEDAFSKNLPKDAKFSFLSKPFSL 788 >gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Score = 41.2 bits (95), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 24/105 (22%), Positives = 55/105 (52%), Gaps = 2/105 (1%) Query: 4 KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63 +++++ED++ ++++ + T G + +EL + ++ D II+D+ L +I G E Sbjct: 2 RILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFE 61 Query: 64 ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108 + + ++ PV ++ + D+ R + G + YISKP + Sbjct: 62 VLRALRVAK--ISTPVCILSGMSSIEDKVRGLQSGADDYISKPFN 104 >gi|254780312|ref|YP_003064725.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 40.4 bits (93), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 25/121 (20%), Positives = 57/121 (47%), Gaps = 4/121 (3%) Query: 1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60 M +K+++ ED++ + + +GY + NG A + R+ +++ DI + E+ Sbjct: 1 MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60 Query: 61 GLEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119 G+E+ ++ E D +L+ + + A A+ D + +SKP L + + + Sbjct: 61 GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKV---LSKPFHLRDLVNEVNRL 117 Query: 120 I 120 + Sbjct: 118 L 118 >gi|254780916|ref|YP_003065329.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 482 Score = 24.3 bits (51), Expect = 0.81, Method: Compositional matrix adjust. Identities = 8/25 (32%), Positives = 19/25 (76%) Query: 3 KKVMIVEDNELNMKLFRDLIETSGY 27 K+V+I++ ++ +K+ +D +E+ GY Sbjct: 11 KRVLIIDKDDEQIKIIKDHVESYGY 35 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Query: 94 IRKGGCEAYISKP----ISLSIFMETIKKYIG 121 +RKG CEA I+K +L + + KKY Sbjct: 434 VRKGECEASIAKKEMVEANLRLVISVAKKYTN 465 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 23.1 bits (48), Expect = 1.8, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 77 IPVIAVTAFAMKGDEERIR 95 +PVIA+ + MKGD++ R Sbjct: 412 VPVIALMSEWMKGDQQEKR 430 >gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Score = 22.3 bits (46), Expect = 3.1, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 20 DLIETSGYIALQTRNGMEALELARQHKPDVIIMD 53 + I +S YIA++T L KPD++I+D Sbjct: 141 NTINSSVYIAIETNVEDIIATLITNEKPDLVIID 174 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 21.2 bits (43), Expect = 6.7, Method: Compositional matrix adjust. Identities = 5/17 (29%), Positives = 13/17 (76%) Query: 93 RIRKGGCEAYISKPISL 109 ++ GG + Y+S+P+++ Sbjct: 73 KVTGGGAQVYLSQPLAV 89 >gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 20.8 bits (42), Expect = 8.2, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 66 KQIKEDSELQEIPVIA 81 K+ KE+ E+ E+PV A Sbjct: 82 KKPKENQEVNEVPVAA 97 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.136 0.360 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,251 Number of Sequences: 1233 Number of extensions: 2418 Number of successful extensions: 18 Number of sequences better than 100.0: 16 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 16 length of query: 123 length of database: 328,796 effective HSP length: 64 effective length of query: 59 effective length of database: 249,884 effective search space: 14743156 effective search space used: 14743156 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)