HHsearch alignment for GI: 254780477 and conserved domain: COG3531

>COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones].
Probab=98.40  E-value=1.9e-05  Score=54.48  Aligned_cols=95  Identities=13%  Similarity=0.198  Sum_probs=68.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHC-CHHHHHHHHHHHHHHHHHCCCCCCCEEEE--CCEEE
Q ss_conf             5588888865433211345689987643110000688986405-98999999999999998618853657998--98996
Q gi|254780477|r  133 WGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLN-DQNILDDIKAGKKRASEDFAIDSTPVFFI--GGNLY  209 (232)
Q Consensus       133 ~~~~~~~~~~q~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~-~~~~~~~i~~~~~~~~~~~gi~gTPt~~V--nG~~~  209 (232)
T Consensus       108 l~ml~aIQrA~YvEGrdi~~t~vl~~laa~~GL~~~~f~~~f~~s~~~~~~~~a~~r~l~~rlg~~GfPTl~le~ng~~~  187 (212)
T COG3531         108 LTMLHAIQRAHYVEGRDITQTEVLAELAAAIGLAAEEFDNAFDQSGAARQAHIADSRRLMQRLGAAGFPTLALERNGTMY  187 (212)
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEE
T ss_conf             17999999998860566103399999999839998999985615678888899999999999455888711000589467


Q ss_pred             C---C--CCCHHHHHHHHHHHHH
Q ss_conf             1---8--9999999999999999
Q gi|254780477|r  210 L---G--DMSEGVFSKIIDSMIQ  227 (232)
Q Consensus       210 ~---g--~~~~~~~~~~id~ll~  227 (232)
T Consensus       188 ~l~~g~y~~~~~~~~arl~~~~~  210 (212)
T COG3531         188 VLGTGAYFGSPDAWLARLAQRLA  210 (212)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             51587655880999999999872