HHsearch alignment for GI: 254780477 and conserved domain: COG3917

>COG3917 NahD 2-hydroxychromene-2-carboxylate isomerase [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=98.84  E-value=2.9e-07  Score=65.96  Aligned_cols=153  Identities=18%  Similarity=0.117  Sum_probs=102.1

Q ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC---------CCCC------------------------
Q ss_conf             8888999970588820644334211344320000203799843---------3234------------------------
Q gi|254780477|r   64 DAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILR---------EFPL------------------------  110 (232)
Q Consensus        64 ~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~---------~~~~------------------------  110 (232)
T Consensus         5 ~~~ktIef~fdf~SP~ayL~~~~~~~l-aq~~ga~v~~rP~llg~vfk~tG~~~Pl~~~~~~~dY~~~d~~R~akr~Glp   83 (203)
T COG3917           5 GMNKTIEFYFDFSSPYAYLAWPRLPAL-AQAYGAAVALRPILLGGVFKATGNGVPLIKTPQPGDYITLDLKREAKRHGLP   83 (203)
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHH-HHHCCCCEEEEEEEECEEEEECCCCCCCCCCCCCCCEEHHHHHHHHHHCCCC
T ss_conf             888606999965881587602445999-9980985278753002058623788863006887751038889999981996


Q ss_pred             -----CCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHH
Q ss_conf             -----302-45777666666665321245588888865433211345689987643110000688986405989999999
Q gi|254780477|r  111 -----DSV-STVAVMLARCAEKRMDGGYWGFVSLLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIK  184 (232)
Q Consensus       111 -----~~~-~~~~~a~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~  184 (232)
T Consensus        84 ~~f~~~fp~nt~~~~R~~~~~~~~g~~a~~~~~a~lrAlw~d~~~l~epev~~~vA~~aGlDg~al~A~~gd~eik~~l~  163 (203)
T COG3917          84 LRFPRHFPPNTLGAARAMIALAMGGGLAEQFAEAVLRALWADGQNLGEPEVVYAVANAAGLDGAALLALLGDDEIKARLK  163 (203)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHCCCHHHHHHHH
T ss_conf             44688779832799999999984363479999999999853234468808999999871899799986428899999988


Q ss_pred             HHHHHHHHHCCCCCCCEEEECCEEECCCCCHHHH
Q ss_conf             9999999861885365799898996189999999
Q gi|254780477|r  185 AGKKRASEDFAIDSTPVFFIGGNLYLGDMSEGVF  218 (232)
Q Consensus       185 ~~~~~~~~~~gi~gTPt~~VnG~~~~g~~~~~~~  218 (232)
T Consensus       164 a~~~~a~s-rGvfGaPtfivg~q~fwGqDRL~~l  196 (203)
T COG3917         164 ANTAEAVS-RGVFGAPTFIVGDQLFWGQDRLYQL  196 (203)
T ss_pred             HHHHHHHH-CCCCCCCEEEECCEEEECHHHHHHH
T ss_conf             61999986-6766898278788034331378999