HHsearch alignment for GI: 254780477 and conserved domain: PRK03147

>PRK03147 thiol-disulfide oxidoreductase; Provisional.
Probab=98.49  E-value=1.2e-06  Score=61.97  Aligned_cols=116  Identities=10%  Similarity=0.277  Sum_probs=64.5

Q ss_pred             CCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             41168988889999705888206443342113443200002037998433234302457776666666653212455888
Q gi|254780477|r   58 VSIGQKDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKTGKLRYILREFPLDSVSTVAVMLARCAEKRMDGGYWGFVS  137 (232)
Q Consensus        58 ~~~G~~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  137 (232)
T Consensus        55 v~lsd~kGK~vll~FWAtWC~pC~~E~P~L~~l~~~~-~~~~-v~vi~i~~d--~~~--~~-------------------  109 (176)
T PRK03147         55 IELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKY-KEKG-VEIIAVNVD--ETD--IA-------------------  109 (176)
T ss_pred             EEHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHH-HCCC-EEEEEECCC--CCH--HH-------------------
T ss_conf             7189969997999997897927546715599999985-3064-478522078--878--88-------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE---CCE---EECC
Q ss_conf             8886543321134568998764311000068898640598999999999999998618853657998---989---9618
Q gi|254780477|r  138 LLFNKQDDWINSKNYRDALLNMAKFAGFSKNDFDTCLNDQNILDDIKAGKKRASEDFAIDSTPVFFI---GGN---LYLG  211 (232)
Q Consensus       138 ~~~~~q~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gi~gTPt~~V---nG~---~~~g  211 (232)
T Consensus       110 ------------------v~~f~~~~~~~~---pv~~D~~----------~~~~~~~~v~~~P~t~lId~~G~I~~~~~G  158 (176)
T PRK03147        110 ------------------VKNFVNQYGLKF---PVAIDKG----------RQVIDAYGVGPLPTTFLIDKDGKVVKVITG  158 (176)
T ss_pred             ------------------HHHHHHHCCCCC---EEEECCC----------CHHHHHCCCCCCCEEEEECCCCEEEEEEEC
T ss_conf             ------------------988898709962---2898797----------358987699988869999799979999978


Q ss_pred             CCCHHHHHHHHHHHHHHH
Q ss_conf             999999999999999986
Q gi|254780477|r  212 DMSEGVFSKIIDSMIQDS  229 (232)
Q Consensus       212 ~~~~~~~~~~id~ll~~~  229 (232)
T Consensus       159 ~i~~~~l~~~i~~lk~e~  176 (176)
T PRK03147        159 EMTEEMLEEYLNKIKPEA  176 (176)
T ss_pred             CCCHHHHHHHHHHHHCCC
T ss_conf             999999999999874469