HHsearch alignment for GI: 254780477 and conserved domain: TIGR01126

>TIGR01126 pdi_dom protein disulfide-isomerase domain; InterPro: IPR005788 This is a domain of eukaryotic protein disulphide isomerases, generally found in two copies. The domain is similar to thioredoxin but the redox-active disulphide region motif is APWCGHCK. ; GO: 0016853 isomerase activity.
Probab=96.37  E-value=0.0026  Score=40.96  Aligned_cols=35  Identities=11%  Similarity=0.293  Sum_probs=27.7

Q ss_pred             HHHHCCCCCCCEEEE--CCE-----EECCCCCHHHHHHHHHH
Q ss_conf             998618853657998--989-----96189999999999999
Q gi|254780477|r  190 ASEDFAIDSTPVFFI--GGN-----LYLGDMSEGVFSKIIDS  224 (232)
Q Consensus       190 ~~~~~gi~gTPt~~V--nG~-----~~~g~~~~~~~~~~id~  224 (232)
T Consensus        64 l~~~y~V~GfPTikff~~G~~~NP~~Y~G~R~~~~~~~F~~e  105 (107)
T TIGR01126        64 LASRYGVSGFPTIKFFPKGSKENPVDYEGGRDLEAIVEFVNE  105 (107)
T ss_pred             CCCEECCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             101002202550578628781489215898687889999860