HHsearch alignment for GI: 254780477 and conserved domain: TIGR01130

>TIGR01130 ER_PDI_fam protein disulfide isomerases; InterPro: IPR005792 This family represents eukaryotic protein disulphide isomerases retained in the endoplasmic reticulum (ER) and other closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulphide domains, each similar to thioredoxin but with the redox-active disulphide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). ; GO: 0016853 isomerase activity, 0005783 endoplasmic reticulum.
Probab=95.10  E-value=0.014  Score=36.38  Aligned_cols=47  Identities=17%  Similarity=0.336  Sum_probs=32.3

Q ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCC-C-EEEEEECCCCC
Q ss_conf             988889999705888206443342113443200002-0-37998433234
Q gi|254780477|r   63 KDAPVTMVEYASMTCFHCAEFHNKTFKYLEDKYIKT-G-KLRYILREFPL  110 (232)
Q Consensus        63 ~~A~v~ivef~D~~Cp~C~~~~~~~~~~l~~~~~~~-~-~~~~~~~~~~~  110 (232)
T Consensus       382 D~~KDVL~EFYAPWCGHCK~L~P-~Y~eLA~~y~~~~~~~VVIAKmDAT~  430 (522)
T TIGR01130       382 DETKDVLVEFYAPWCGHCKKLAP-IYEELAEKYKDSAEDDVVIAKMDATA  430 (522)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCC-HHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             79998899996686761002130-88999999875479870899647775