HHsearch alignment for GI: 254780477 and conserved domain: TIGR03140

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit. This enzyme is the partner of the peroxiredoxin (alkyl hydroperoxide reductase) AhpC which contains the peroxide-reactive cysteine. AhpF contains the reductant (NAD(P)H) binding domain (pfam00070) and presumably acts to resolve the disulfide which forms after oxidation of the active site cysteine in AphC. This proteins contains two paired conserved cysteine motifs, CxxCP and CxHCDGP.
Probab=90.46  E-value=0.48  Score=26.62  Aligned_cols=37  Identities=19%  Similarity=0.441  Sum_probs=25.9

Q ss_pred             HHHHHHCCCCCCCEEEECCEEEC-CCCCHHHHHHHHHH
Q ss_conf             99998618853657998989961-89999999999999
Q gi|254780477|r  188 KRASEDFAIDSTPVFFIGGNLYL-GDMSEGVFSKIIDS  224 (232)
Q Consensus       188 ~~~~~~~gi~gTPt~~VnG~~~~-g~~~~~~~~~~id~  224 (232)
T Consensus       160 ~~~~~~~~I~sVP~v~~n~e~~~~g~~~~~~~~~kl~~  197 (515)
T TIGR03140       160 QDEVEALGIQGVPAVFLNGEEFHNGRMDLAELLEKLEE  197 (515)
T ss_pred             HHHHHHCCCCCCCEEEECCEEEEECCCCHHHHHHHHHC
T ss_conf             77898648674772777883872256139999999855